NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080557

Metagenome Family F080557

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080557
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 137 residues
Representative Sequence ETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTDRRQIAAINQPAAPDDFPELPTFLRRVPATRGPAPALGPPGDSLDRADGRTQVIEEEESEWTL
Number of Associated Samples 82
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.52 %
% of genes from short scaffolds (< 2000 bps) 92.17 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.522 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(66.956 % of family members)
Environment Ontology (ENVO) Unclassified
(81.739 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(66.957 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.23%    β-sheet: 0.00%    Coil/Unstructured: 91.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00589Phage_integrase 0.87



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.52 %
UnclassifiedrootN/A3.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005332|Ga0066388_101455759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71194Open in IMG/M
3300005332|Ga0066388_101461527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71192Open in IMG/M
3300005332|Ga0066388_103938422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7757Open in IMG/M
3300005764|Ga0066903_100906412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71596Open in IMG/M
3300005764|Ga0066903_107700155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7554Open in IMG/M
3300005764|Ga0066903_108662716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7517Open in IMG/M
3300006163|Ga0070715_10406208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7758Open in IMG/M
3300006796|Ga0066665_10628134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7859Open in IMG/M
3300009162|Ga0075423_10825665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7981Open in IMG/M
3300010047|Ga0126382_10984141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7738Open in IMG/M
3300010376|Ga0126381_101599400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7942Open in IMG/M
3300012202|Ga0137363_10818013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7790Open in IMG/M
3300012971|Ga0126369_11518805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7759Open in IMG/M
3300016319|Ga0182033_10134699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71882Open in IMG/M
3300016319|Ga0182033_11356858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7640Open in IMG/M
3300016357|Ga0182032_10809274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7792Open in IMG/M
3300016357|Ga0182032_11310393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7625Open in IMG/M
3300016371|Ga0182034_11561427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7579Open in IMG/M
3300016387|Ga0182040_11329969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7607Open in IMG/M
3300016404|Ga0182037_11750317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7555Open in IMG/M
3300021560|Ga0126371_10463338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71414Open in IMG/M
3300022756|Ga0222622_11287479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7538Open in IMG/M
3300028715|Ga0307313_10198636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7622Open in IMG/M
3300028796|Ga0307287_10152514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7878Open in IMG/M
3300028880|Ga0307300_10225055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7615Open in IMG/M
3300028885|Ga0307304_10430438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7599Open in IMG/M
3300031543|Ga0318516_10244334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71038Open in IMG/M
3300031543|Ga0318516_10290874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7944Open in IMG/M
3300031543|Ga0318516_10878552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7505Open in IMG/M
3300031545|Ga0318541_10507005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7675Open in IMG/M
3300031546|Ga0318538_10030953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_72492Open in IMG/M
3300031546|Ga0318538_10832230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7501Open in IMG/M
3300031549|Ga0318571_10397904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7537Open in IMG/M
3300031561|Ga0318528_10147029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71254Open in IMG/M
3300031561|Ga0318528_10155522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71218Open in IMG/M
3300031561|Ga0318528_10387766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7750Open in IMG/M
3300031561|Ga0318528_10665481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7558Open in IMG/M
3300031564|Ga0318573_10134191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71290Open in IMG/M
3300031564|Ga0318573_10206150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71043Open in IMG/M
3300031573|Ga0310915_11189433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7527Open in IMG/M
3300031573|Ga0310915_11289877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7503Open in IMG/M
3300031640|Ga0318555_10429505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7716Open in IMG/M
3300031668|Ga0318542_10634168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7558Open in IMG/M
3300031680|Ga0318574_10280789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7966Open in IMG/M
3300031680|Ga0318574_10480441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7728Open in IMG/M
3300031681|Ga0318572_10295091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7957Open in IMG/M
3300031681|Ga0318572_10394391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7822Open in IMG/M
3300031682|Ga0318560_10354630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7792Open in IMG/M
3300031719|Ga0306917_10355367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71139Open in IMG/M
3300031723|Ga0318493_10187245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71087Open in IMG/M
3300031724|Ga0318500_10262985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7839Open in IMG/M
3300031736|Ga0318501_10642817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7583Open in IMG/M
3300031744|Ga0306918_10413068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71052Open in IMG/M
3300031747|Ga0318502_10232193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71073Open in IMG/M
3300031751|Ga0318494_10159838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71272Open in IMG/M
3300031764|Ga0318535_10113041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71196Open in IMG/M
3300031770|Ga0318521_10822623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7566Open in IMG/M
3300031771|Ga0318546_10052190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_72551Open in IMG/M
3300031771|Ga0318546_11123688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7552Open in IMG/M
3300031781|Ga0318547_10078837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71840Open in IMG/M
3300031793|Ga0318548_10114922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71297Open in IMG/M
3300031793|Ga0318548_10491545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7600Open in IMG/M
3300031794|Ga0318503_10305982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7516Open in IMG/M
3300031796|Ga0318576_10434536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7620Open in IMG/M
3300031796|Ga0318576_10505273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7570Open in IMG/M
3300031796|Ga0318576_10568375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7534Open in IMG/M
3300031797|Ga0318550_10227356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7904Open in IMG/M
3300031805|Ga0318497_10404257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7764Open in IMG/M
3300031805|Ga0318497_10584487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7626Open in IMG/M
3300031819|Ga0318568_10430627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7822Open in IMG/M
3300031846|Ga0318512_10241504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7890Open in IMG/M
3300031860|Ga0318495_10145136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71070Open in IMG/M
3300031879|Ga0306919_11339252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7541Open in IMG/M
3300031890|Ga0306925_10250275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71909Open in IMG/M
3300031890|Ga0306925_10731993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71032Open in IMG/M
3300031896|Ga0318551_10342753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7845Open in IMG/M
3300031897|Ga0318520_10140721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71391Open in IMG/M
3300031897|Ga0318520_10571647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7701Open in IMG/M
3300031910|Ga0306923_10829542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71018Open in IMG/M
3300031941|Ga0310912_10070207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_72519Open in IMG/M
3300031942|Ga0310916_10049907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3193Open in IMG/M
3300031942|Ga0310916_10662554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7885Open in IMG/M
3300031942|Ga0310916_11239822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7615Open in IMG/M
3300031945|Ga0310913_10623832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7764Open in IMG/M
3300031946|Ga0310910_10594685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7877Open in IMG/M
3300031947|Ga0310909_10403014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71148Open in IMG/M
3300031947|Ga0310909_11224481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7606Open in IMG/M
3300031954|Ga0306926_12802692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7526Open in IMG/M
3300032010|Ga0318569_10284302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7769Open in IMG/M
3300032010|Ga0318569_10431682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7614Open in IMG/M
3300032035|Ga0310911_10110828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71514Open in IMG/M
3300032039|Ga0318559_10199732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7919Open in IMG/M
3300032039|Ga0318559_10524119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7553Open in IMG/M
3300032042|Ga0318545_10275128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7605Open in IMG/M
3300032043|Ga0318556_10448083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7675Open in IMG/M
3300032044|Ga0318558_10481359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7619Open in IMG/M
3300032055|Ga0318575_10365465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7731Open in IMG/M
3300032059|Ga0318533_11020909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7606Open in IMG/M
3300032059|Ga0318533_11188449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7558Open in IMG/M
3300032063|Ga0318504_10132984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71136Open in IMG/M
3300032065|Ga0318513_10237685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7881Open in IMG/M
3300032076|Ga0306924_10469860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71435Open in IMG/M
3300032090|Ga0318518_10041822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_72147Open in IMG/M
3300032091|Ga0318577_10148658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71114Open in IMG/M
3300032091|Ga0318577_10201706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7951Open in IMG/M
3300032091|Ga0318577_10219782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7909Open in IMG/M
3300032094|Ga0318540_10365964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7696Open in IMG/M
3300032261|Ga0306920_102541754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7703Open in IMG/M
3300033289|Ga0310914_10971696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7749Open in IMG/M
3300033289|Ga0310914_11761810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7523Open in IMG/M
3300033290|Ga0318519_10941791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7535Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil66.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066388_10145575943300005332Tropical Forest SoilETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQSTELAAADLSRDLSRDDRDGQIGINRGSQDDFPELPAFLRRVPVTHGPAPALGPPGDSLDRADGRTQVIEEEESEWTL*
Ga0066388_10146152733300005332Tropical Forest SoilSICPSVQSVRENADTNGARASVPAQTDRTDGQTPAQETVEARQSGALDLSGDLSRGNQKTDCRQIAAINQPAAPDDFPELPASLRRVPVTHGPAPALGPPGDSPDGADGRTQVLEEEEEEASEWTL*
Ga0066388_10393842223300005332Tropical Forest SoilNASICPSVQSVRENADTNGARASVPAQTDRTDRQTPAQATEEVRQSGALNLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTFLRRAPVTRGPASALGPPGDSLARADGRTQVIEEEESEWTL*
Ga0066903_10090641213300005764Tropical Forest SoilTDLETEAPSAQTQETTGQKASICPSVQSVWENADTNGTPTSAPAQTDRTDRQTGAQVTEQPTELAAPDLSGDLSRGDQDGQIGTNRGSQDDFPELPVFLRRAPATRGPAPTIGPPGDSLDRADGRTQVIEEETGEWTL*
Ga0066903_10770015523300005764Tropical Forest SoilLTDPETEAPSAQTQETTGQKTSICPSVQSVRENADTNGAPSSVPAQTDRTDRQTSAQLTEDARQSGLLDLSGDLSRGDRKTDCRQIAAINQLAAPDDFPELPTFLRRVPATRGPAPALGPPGDSLDRADGRTQVIEEEESEWTL*
Ga0066903_10866271613300005764Tropical Forest SoilTDLETEAPSAQTQETTGQNASICPSVQSVRENADTNGARAPAPAQTDRTDRQSPAQVTEEVRQSGALDLSGDLSRGERKTDCAAINQPATPDDFPELPPFLRRVPVTRGPAPAGGQPADSLARADGRTQVVEEKESEWTL*
Ga0070715_1040620823300006163Corn, Switchgrass And Miscanthus RhizosphereSVPAQTDRTDRQTPAQATEEVRQSGALDLSSDLSRGDRKTDCRQIAAINQPGAPDDFPELPAFLRRAPVTRGPAPALGPPGDSLARADGRTQVIEEEESEWTL*
Ga0066665_1062813423300006796SoilRASVPAQTDRTDRQTGAQVTEQPTELASCDLSGDLSRDDRKTDCRQIAAINQPAAPDDFPEFRRAPVTLGPAPALGPPGDSLDGADGRTQAIEEEASEWTL*
Ga0075423_1082566513300009162Populus RhizosphereICPSVQSVRENADTNGARASVPAQTDRTDRQTPAQATVEARQSGALDLSGDLSRGNRKTDCRRIAAINQPAAPDDFPEFRRTPVTRGPAPALGPPGDSLDGADGRTQVIEEEETGEWTL*
Ga0126382_1098414113300010047Tropical Forest SoilICPSVQSVCENADTDGAHASVPAQTDQTDRQTPAQATEGARQSGALDLSGDLSRSDRKTDCGQVAEQPAAPDDYPELPTFLRREPVTGGPTPAQGPPGESLDRSDGRTQVIEEEGRWTL*
Ga0126370_1171969523300010358Tropical Forest SoilVPAQTDRTDRQTSSQATVEARQSGALDLSGDLSRGDRQTDCRQIAAINQPAAPDDFPELPTFLRRVPVTRGPAPALGPPDDRLDGAAGRTQVIEEEEAQWTL*
Ga0126381_10159940023300010376Tropical Forest SoilLTDLETEAPSAQTQETTGQNASICPSVQSVRENADTNGARASVPAQTDRTDRQTPAQATEEARQSGALDLSGGLSRGDRKTDCRQVAAINQSAAPDDFPEPPTFLRRAPVTRGPAPALGPSDRLDGAEEEAQWTL*
Ga0137363_1081801313300012202Vadose Zone SoilTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARQSGALDLSGDLSRGDRKTDCRQIAAINQPAATDDFPELPPSLRRVPVTRGPAPALGPPADSLDGADGQTQVIEEEETREWTL*
Ga0126369_1151880523300012971Tropical Forest SoilRENAKTNGPQASVPAQANRTDRQTPAQATEEVRHSGALDLSSDLSRGDRKTDCRQVAAINQPASPDDFPELPTILRRAPVTRGPAPVLGPPGDRLDGAAGRTHGIEEEETGEWTL*
Ga0182033_1013469913300016319SoilSICPSVQSVRENADTNGARSSVPAQTDRTDRQTSAQATVEARQSGALDLSSDLASGDRKTDCRQVAAINQSAAPDDFPELPTFLRRVPVTRGPAPALGPPSDRLDDLDP
Ga0182033_1135685813300016319SoilQETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTDRRQIAAINQPAAPDDFPELPAFLRRVPVTSGPAPALGPPGDSLDRADGRTQVIEEETGEWTL
Ga0182032_1080927413300016357SoilKAPSPQTQDTTGQKTSIRPSVQSLRENADTNGARASVPAQTDRTDRQTPAQATEEARQSDALDLSSDLSRGDRRTDCRQIAAINQPAAPDDFPELPTFLRRMPVSRGPAPAHGPPGDSPVGADGRTLIEEEEASEWTL
Ga0182032_1131039313300016357SoilIQRVGKGLYAHKDYVSPPDDLPPANPPSKNKQSKRGAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0182034_1156142713300016371SoilQETTGQKASICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRGDRKTDCRQIAVINQPAAPDDFPKLPTSLRRVPDTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0182040_1132996923300016387SoilCPSVQSVRENADTNGARSSVPARTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTNCRQIAAINQPAAPDDFPELPTFLRRVPVTRGPAPAHGLPGDSLDGAAGRTQVIEEEEAQWT
Ga0182037_1175031713300016404SoilYAHKDYVSPPDDLPPAKPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPELPAFLRRVPVTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0126371_1046333813300021560Tropical Forest SoilPAQTQETTGQKPSICPSVQSVRENPDTNGARASVPAQTDRTDRQTPAQGTEEARQSGALDLSGNLSREDQDAQIGTNRGSQDDFPELPAFLRRVPVTRGPAPALGPPGDRLDGAAGRTHGIEEEETGEWTL
Ga0222622_1128747913300022756Groundwater SedimentVLSVRSANVLTDPETEAPSAQTQETTGEKPSICPSVQSVRENADTNGARASVLAQTDRTDRQTGAQVAEQSTELAAADLSHDLSRGDRDGQIGTNRGSQDDFPELPTFLRRVPVTRGPAPALGPPGDSLDGADGGTQVIEEEETEWTL
Ga0209465_1019918623300027874Tropical Forest SoilVPAQTDRTDRQTSAQATEEASQSGALDLSGDLSRGDRKTDSRQIAANNQSAAPDDFPELPAFLRRVPVTRGPAPALGPPGDRLDGAAGRTQVIEEEAQWTL
Ga0307313_1019863613300028715SoilVSPPDDLPPANPPSKNKQSRRGTPRRSVLSVRSANVLTDPETEAPSAQTQETTGEKPSICPSVQSVRENADTNGARASVLAQTDRTDRQTGAQVAEQSTELAAADLSHDLSRGDRDGQIGTNRGSQDDFPELPTFLRRVPVTRGPAPALGPPGDSLDGADGGTQVIEEEETEWTL
Ga0307287_1015251413300028796SoilPPNPPSKNKRKKRGTPRLTDTNGARASVPAQTDGTDRQTGAQVTEQPTELAASDLSRDLSRGDRDGQIGTNRGSQDDFPELPTFLRRVPVTRGPAPALGPPGDSLDGADGGTQVIEEEETEWTL
Ga0307300_1022505523300028880SoilVRSAKVLTDPETEAPSAQTQETTGEKPSICPSVQSVRENADTNGARASVLAQTDRTDRQTGAQVAEQSTELAAADLSHDLSRGDRDGQIGTNRGSQDDFPELPTFLRRVPVTRGPAPALGPPGDSLDGADGGTQVIEEEESEWTL
Ga0307304_1043043823300028885SoilLSVRSANVLTDPETEAPSAQTQETTGEKPSICPSVQSVRENADTNGARASVLAQTDRTDRQTGAQVAEQSTELAAADLSHDLSRGDRDGQIGTNRGSQDDFPELPTFLRRVPVTRGPAPALGPPGDSLDGADGGTQVIEEEESEWTL
Ga0318516_1024433433300031543SoilANPPSKNKQSKRGAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPELPAFLRRVPVTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0318516_1029087413300031543SoilGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTDRRQIAAINQPAAPDDFPELPAFLRRVPVTSGPAPALGPPGDSLDRADGRTQVIEEETGEWTL
Ga0318516_1087855223300031543SoilSVRENADTNGARSSVFAQTDRTDRQTSAQATVEARQSGAPDLSGDLSRGDRMTDCRQIAAINQPAAPDDFPELPTFLRRVPVTRGPAPAHGLPGDSLDRADGRTQVIEEEEEEASEWTL
Ga0318541_1050700513300031545SoilVASVRPSKVLTDPETEAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRGDRKTDCRQIAVINQPAAPDDFPKLPTSLRRVPDTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0318538_1003095313300031546SoilPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318538_1083223013300031546SoilVLTDPETEAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRGDRKTDCRQIAVINQPAAPDDFPKLPTSLRRVPDTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0318571_1039790413300031549SoilSKVLTDRETDVPSAHTQETTGQKTSICPSVQSVRENADTNGAHASVPAQTDRTDRQTLAQAPAEARQSGALDLSGDQSRGDRKTDRRQSAATNQPAAPDDFPKLPTFLRRVPVTGGPAPALGPPGDSLDRADGRTQVIEDEEEREWTL
Ga0318528_1014702913300031561SoilETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTDRRQIAAINQPAAPDDFPELPTFLRRVPATRGPAPALGPPGDSLDRADGRTQVIEEEESEWTL
Ga0318528_1015552233300031561SoilSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318528_1038776623300031561SoilPSVQSVRENADTNGARSSVPARTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTNCRQIAAINQPAAPDDFPELPTFLRRVPVTRGPAPAHGLPGDSLDGAAGRTQVIEEEEAQWTL
Ga0318528_1066548123300031561SoilNKQSKRGAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318573_1013419113300031564SoilVLTDRETDAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318573_1020615023300031564SoilRIGKGLYAHLDYVSPPDDLPPANPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0310915_1118943323300031573SoilPSAQTQETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTDRRQIAAINQPAAPDDFPELPAFLRRVPVTSGPAPALGPPGDSLDRADGRTQVIEEETGEWTL
Ga0310915_1128987723300031573SoilDPETEAPSAQTQETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDAQIGTNRGSQDDFPELPTSLRRVPVTRGPPPAHGLPGDSLDRADGRTQVIEEEEEASEWTL
Ga0318555_1042950513300031640SoilKVLTDRETDAPSAQTQETTGQKPSICPSVQSVRENADTNGARASVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318542_1063416813300031668SoilSKVLTDRETDAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTCLRRVPVTRGPAPALGPPSDRLDGAAGRTQVIEEEEAQWTL
Ga0318574_1028078933300031680SoilADTNGDHASVPAQTDRTDRQTPAQATEEVRQSNALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTFLRRVPATRGPAPALGPPGDSLARADGRTQVIEEEEESEWTL
Ga0318574_1048044113300031680SoilDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318572_1029509123300031681SoilTDAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALEPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318572_1039439123300031681SoilGLYAHLDYVSPPDDLPPANPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318560_1035463013300031682SoilQNASICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0306917_1035536713300031719SoilDDLPPANPPSKNKQSKRGAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318493_1018724533300031723SoilRSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318500_1026298523300031724SoilRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318501_1064281723300031736SoilASICPSVQSVRENADANGARSSVPAQTDRTDRQTPAQAAEEARQSGVLDLSDDLSRGDRTTDCGQIAAIKQSAAADEFPELPTFLRRVPATRGPAPALGPPGDSLDRADGRTQVIEEEESEWTL
Ga0306918_1041306813300031744SoilADTNGAHASVPAQTDRTDRQTPAQATEEVRQSNALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTFLRRVPATRGPAPALGPPGDSLARADGRTQVIEEEEESEWTL
Ga0318502_1023219333300031747SoilCPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWT
Ga0318502_1100417023300031747SoilVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDAQIGTNRGSQDDFPELPTSLRRVPVTRGPPPAHGLPGDSLDRADGRTQVIEEEEEASEWTL
Ga0318494_1015983843300031751SoilASLCPSVQSVRENADTIGARASVPAQTDRTDRQTPAQATKEVRQSGALDLSGDLSRSDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALEPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318535_1011304133300031764SoilASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318521_1082262323300031770SoilTQETTGQKTSICPSVQSVRENADTNGARSSVPARTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTNCRQIAAVNQPAAPDDFPELPTFLRRVPVTRGPAPAHGLPGDSLDGAAGRTQVIEEEEAQWTL
Ga0318546_1005219013300031771SoilANPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318546_1112368823300031771SoilSKALTDRETEAPSAQTQETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTNCRQIAAINQPAAPDDFPELPTFLRRVPVTRGPAPAHGLPGDSLDGAAGRTQVIEEEEAQWTL
Ga0318547_1007883733300031781SoilSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318548_1011492243300031793SoilASVRSSKVLTDPETEAPSAQTQETTGQKASICPSVQSVRENADANGARSSVPAQTDRTDRQTPAQAAEEARQSGVLDLSDDLSRGDRKTDCGQIAAIKQSAAADEFPELPTFLRRVPATRGPAPALGPPGDSLDRADGRTQVIEEEESEWTL
Ga0318548_1049154513300031793SoilSAQTQETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRGDRKTDCRQIAVINQPAAPDDFPKLPTSLRRVPDTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0318503_1030598213300031794SoilVLTDPETEAPSAQTQETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTNCRQIAAINQPAAPDDFPELPTFLRRVPVTRGPAPAHGLPGDSLDGAAGRTQVIEEEEAQWTL
Ga0318576_1043453623300031796SoilRSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTDRRQIAAINQPAAPDDFPELPAFLRRVPVTSGPAPALGPPGDSLDRADGRTQVIEEETGEWTL
Ga0318576_1050527323300031796SoilPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPELPAFLRRVPVTSGPPPALGPPGDSLDGADGRTQVIEEEEAGEWTL
Ga0318576_1056837513300031796SoilKHRKSKRGAPRQSVASVRPSKVLTDPETEAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRGDRKTDCRQIAVINQPAAPDDFPKLPTSLRRVPDTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0318550_1022735633300031797SoilICPSVQSVRENADANGARSSVPAQTDRTDRQTPAQAAEEARQSGVLDLSDDLSRGDRKTDCGQIAAIKQSAAADEFPELPTFLRRVPATRGPAPALGPPGDSLDRADGRTQVIEEEESEWTL
Ga0318497_1040425723300031805SoilTDVPSAQTQETTGQKTSICPSVQSVRENADTNGAHASVPAQTDRTDRQTLAQAPAEARQSGALDLSGDQSRGDRKTDRRQSAATNQPAAPDDFPKLPTFLRRVPVTGGPAPALGPPGDSLDRADGRTQVIEDEEEREWTL
Ga0318497_1058448723300031805SoilRSSVPAQTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTDRRQIAAINQPAAPDDFPELPAFLRRVPVTSGPAPALGPPGDSLDRADGRTQVIEEEESEWTL
Ga0318568_1043062713300031819SoilPPANPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318512_1024150423300031846SoilANPPNKTKHRKSKRGAPRQSVASVRPSKVLTDPETEAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPELPAFLRRVPVTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0318495_1014513613300031860SoilKVLTDRETDAPSAQTQETTGQKPSICPSVQSVRENADTNGAPSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0306919_1133925223300031879SoilTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDAQIGTNRGSQDDFPELPTSLRRVPVTRGPPPAHGLPGDSLDRADGRTQVIEEEEEASEWTL
Ga0306925_1025027513300031890SoilKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDAQIGTNRGSQDDFPELPTSLRRVPVTRGPPPAHGLPGDSLDRADGRTQVIEEEEEASEWTL
Ga0306925_1073199333300031890SoilNNRTKNSICPSVQSVRENADTNGARASVPAQTDRTDRQTPAQATEEARQSDALDLSSDLSRGDRRTDCRQIAAINQPAAPDDFPELPTFLRRMPVSRGPAPAHGPPGDSPVGADGRTLIEEEEASEWTL
Ga0318551_1034275313300031896SoilPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTPAQATEEVRQSNALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTFLRRVPATRGPAPALGPPGDSLARADGRTQVIEEEEESEWTL
Ga0318520_1014072113300031897SoilSVRSSKVVTDPETEAPSAQTQETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALEPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318520_1057164723300031897SoilDYVSPPDDLPPANPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0306923_1082954213300031910SoilSKVLTDLETEAPSAQTQETTGQKTSICPSVQSVRENADTNGARSSVPARTDRTDRQTSAQATVEARQSGALDLSGDLSRGDRKTNCRQIAAINQPAAPDDFPELPTFLRRVPVTRGPAPAHGLPGDSLDGAAGRTQVIEEEEAQWTL
Ga0310912_1007020753300031941SoilQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0310916_1004990783300031942SoilTTSICPSVQSVRETAETNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDAQIGTNRGSQDDFPELPTSLRRVPVTRGPPPAHGLPGDSLDRADGRTQVIEEEEEASEWTL
Ga0310916_1066255413300031942SoilYVSPPDDLPPANPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPELPAFLRRVPVTSGPPPALGPPGDSLDGADGRTQVIEEEEAGEWTL
Ga0310916_1123982223300031942SoilPRQSVASVRSSKVLTDPETEAPSAQTQETTGQKPSICPSVQSVRENPDTNGARASVPAQTDRTDRQTGAQVTEQSTELAAADLSRDLSRGDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0310913_1062383223300031945SoilVQSVRENADTNGAHASVPAQTDRTDRQTLAQAPAEARQSGALDLSGDQSRGDRKTDRRQSAATNQPAAPDDFPKLPTFLRRVPVTGGPAPALGPPGDSLDRADGRTQVIEDEEEREWTL
Ga0310910_1059468523300031946SoilKVLTDLETEAPSAQTQETTGQKPSICPSVQSVRENADTNGARASVPAQTDRTDRQTPAQATEEARQSDALDLSSDLSRGDRRTDCRQIAAINQPAAPDDFPELPTFLRRMPVSRGPAPAHGPPGDSPVGADGRTLIEEEEASEWTL
Ga0310909_1040301423300031947SoilLYAHLDYVSPPDDLPPANPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0310909_1122448123300031947SoilHASVPAQTDRTDRQTLAQAPAEARQSGALDLSGDQSRGDRKTDRRQSAATNQPAAPDDFPKLPTFLRRVPVTGGPAPALGPPGDSLDRADGRTQVIEDEEEREWTL
Ga0306926_1280269223300031954SoilTQETTGQKTSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDAQIGTNRGSQDDFPELPTSLRRVPVTRGPPPAHGLPGDSLDRADGRTQVIEEEEEASEWTL
Ga0306922_1041939323300032001SoilVPAQTDRTDRQTPAQATEEARQSDALDLSSDLSRGDRRTDCRQIAAINQPAAPDDFPELPTFLRRMPVSRGPAPAHGPPGDSPVGADGRTLIEEEEASEWTL
Ga0318569_1028430213300032010SoilQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318569_1043168223300032010SoilSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0310911_1011082843300032035SoilNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318559_1019973233300032039SoilSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318559_1052411923300032039SoilRQSVASVRSSKVLTDPETEAPSAQTQETTGQKPSICPSVQSVRENPDTNGARASVPAQTDRTDRQTGAQVTEQSTELAAADLSRDLSRDDRDGQIGTNRGAQDDFPELPAFLRRVPVTRGPAPALGPPGDSLNRADGRTQVIEEEETGEWTL
Ga0318545_1027512823300032042SoilLPPANPPSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318556_1044808323300032043SoilTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318558_1048135923300032044SoilRETDAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318575_1036546523300032055SoilSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318533_1102090923300032059SoilPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRGDRKTDCRQIAVINQPAAPDDFPKLPTSLRRVPDTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0318533_1118844913300032059SoilRQSVASVRSSKVLTDLETEPPSAQTQETTGQKGSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQVTEQSTELAAADLSRDLSRDDRDGQIGTNRGAQDDFPELPAFLRRVPVTRGPAPALGPPGDSLNRADGRTQVIEEEETGEWTL
Ga0318504_1013298413300032063SoilPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318513_1023768513300032065SoilNADANGARSSVPAQTDRTDRQTPAQAAEEARQSGVLDLSDDLSRGDRKTDCGQIAAIKQSAAADEFPELPTFLRRVPATRGPAPALGPPGDSLDRADGRTQVIEEEESEWTL
Ga0306924_1046986043300032076SoilAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318518_1004182253300032090SoilTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318577_1014865833300032091SoilSKNKQSKRVAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPDLPAFLRRVPDTRGPAPALGPPGDSLDGADGRTQVIEEEEEEASEWTL
Ga0318577_1020170613300032091SoilSVPAQTDRTDRQTPAQAAEEARQSGVLDLSDDLSRGDRKTDCGQIAAIKQSAAADEFPELPTFLRRVPATRGPAPALGPPGDSLDRADGRTQVIEEETGEWTL
Ga0318577_1021978213300032091SoilASVRSSKVLTDRETDAPSAQTQETTGQKPSICPSVQSVRENADTNGARSSVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPTSLRRVSVTPGPAPALGPPGDSLDRADGRTQVIEEEEGQWTL
Ga0318540_1036596423300032094SoilCPSVQSVRENADTNGARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRDDRDAQIGTNRGSQDDFPELPTSLRRVPVTRGPPPAHGLPGDSLDRADGRTQVIEEEEEASEWTL
Ga0306920_10254175423300032261SoilAPRQSVASVRSSKVLTDLETEAPPAQTPETTGQKPSICPSVQSVRENADTNGAHASVPAQTDRTDRQTGAQITEQPTELAASDLSRNLSRDDRDGQIGTNRGSQDDFPELPAFLRRVPVTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0310914_1097169623300033289SoilQETTGQKTSICPSVQSVRENADTNGAHASVPAQTDRTDRQTLAQAPAEARQSGALDLSGDQSRGDRKTDRRQSAATNQPAAPDDFPKLPTFLRRVPVTGGPAPALGPPGDSLDRADGRTQVIEDEEEREWTL
Ga0310914_1176181013300033289SoilARSSVPAQTDRTDRQTGAQVTEQPTELAASDLSRNLSRGDRKTDCRQIAVINQPAAPDDFPKLPTSLRRVPDTRGPAPALGPSGDSLDGADGRTQVIEEEETGEWTL
Ga0318519_1094179123300033290SoilETTGQKPSICPSVQSVRENADTNGARASVPAQTDRTDRQTPAQATAEARPSGALDLSGDLSRGDRKTDCRQIAAINQPAAPDDFPELPPFLRRVSVTPDLRQDRADGRTQVIEDEEASEWTL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.