NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080426

Metagenome Family F080426

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080426
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 45 residues
Representative Sequence MPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEP
Number of Associated Samples 80
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.39 %
% of genes near scaffold ends (potentially truncated) 93.04 %
% of genes from short scaffolds (< 2000 bps) 93.04 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.174 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.217 % of family members)
Environment Ontology (ENVO) Unclassified
(46.087 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(65.217 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 58.11%    β-sheet: 0.00%    Coil/Unstructured: 41.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF04392ABC_sub_bind 5.22
PF04519Bactofilin 3.48
PF06411HdeA 2.61
PF03401TctC 1.74
PF00550PP-binding 1.74
PF13505OMP_b-brl 0.87
PF05532CsbD 0.87
PF01381HTH_3 0.87
PF12599DUF3768 0.87
PF04226Transgly_assoc 0.87
PF01068DNA_ligase_A_M 0.87
PF13385Laminin_G_3 0.87
PF13271DUF4062 0.87
PF04347FliO 0.87
PF04542Sigma70_r2 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 5.22
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 3.48
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.74
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.87
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.87
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.87
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.87
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.87
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.87
COG3190Flagellar biogenesis protein FliOCell motility [N] 0.87
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.87
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.17 %
UnclassifiedrootN/A7.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10177813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10028317All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10105551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300000956|JGI10216J12902_110183583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300000956|JGI10216J12902_112063482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300005174|Ga0066680_10785620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300005332|Ga0066388_101796471Not Available1090Open in IMG/M
3300005332|Ga0066388_106347287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae596Open in IMG/M
3300005332|Ga0066388_107599818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300005434|Ga0070709_10833002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300005439|Ga0070711_100030761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3557Open in IMG/M
3300005445|Ga0070708_100461356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1198Open in IMG/M
3300005445|Ga0070708_101356786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300005471|Ga0070698_101751772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300005559|Ga0066700_10738161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300005713|Ga0066905_101895139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300005764|Ga0066903_100548552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1981Open in IMG/M
3300005764|Ga0066903_103411501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium857Open in IMG/M
3300005764|Ga0066903_104882930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium712Open in IMG/M
3300005764|Ga0066903_108502440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300005983|Ga0081540_1253186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300006173|Ga0070716_100128195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1600Open in IMG/M
3300006846|Ga0075430_100909346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium725Open in IMG/M
3300006847|Ga0075431_100390695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1394Open in IMG/M
3300006904|Ga0075424_100912922Not Available937Open in IMG/M
3300009012|Ga0066710_102850131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300009100|Ga0075418_12471388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300010043|Ga0126380_11995923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300010046|Ga0126384_11762847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300010358|Ga0126370_10549703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7986Open in IMG/M
3300010360|Ga0126372_10907086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium884Open in IMG/M
3300010360|Ga0126372_12753315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300010361|Ga0126378_10717026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1111Open in IMG/M
3300010366|Ga0126379_10026473All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Kriegella → Kriegella aquimaris4454Open in IMG/M
3300010366|Ga0126379_13590014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300010371|Ga0134125_12911025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300010398|Ga0126383_10934062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium954Open in IMG/M
3300010398|Ga0126383_11486133Not Available767Open in IMG/M
3300010398|Ga0126383_12071041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300012951|Ga0164300_10121170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1182Open in IMG/M
3300012957|Ga0164303_11293923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300012960|Ga0164301_11512294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300012977|Ga0134087_10842058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300012984|Ga0164309_10198940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1377Open in IMG/M
3300012987|Ga0164307_11734985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300015264|Ga0137403_10881872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium745Open in IMG/M
3300016270|Ga0182036_10791205All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300016294|Ga0182041_11812033All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300016341|Ga0182035_11507417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300016371|Ga0182034_10186499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1593Open in IMG/M
3300016371|Ga0182034_12000471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300016387|Ga0182040_10608274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium885Open in IMG/M
3300016387|Ga0182040_10789395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium782Open in IMG/M
3300016387|Ga0182040_11128037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium658Open in IMG/M
3300016422|Ga0182039_10784818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium845Open in IMG/M
3300016422|Ga0182039_12092434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300016445|Ga0182038_10204868All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300018028|Ga0184608_10126596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1087Open in IMG/M
3300018468|Ga0066662_11308387Not Available743Open in IMG/M
3300020580|Ga0210403_10787507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300021168|Ga0210406_10394441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F81110Open in IMG/M
3300021405|Ga0210387_10396944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F81222Open in IMG/M
3300021478|Ga0210402_10799617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium868Open in IMG/M
3300021479|Ga0210410_10918468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300026550|Ga0209474_10739356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300027909|Ga0209382_11147780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium799Open in IMG/M
3300027909|Ga0209382_12115001Not Available535Open in IMG/M
3300028717|Ga0307298_10072264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300028755|Ga0307316_10311689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300028778|Ga0307288_10145939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium888Open in IMG/M
3300028784|Ga0307282_10028383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2401Open in IMG/M
3300028884|Ga0307308_10224672All Organisms → cellular organisms → Bacteria → Proteobacteria900Open in IMG/M
3300031200|Ga0307496_10014412All Organisms → cellular organisms → Bacteria → Proteobacteria1070Open in IMG/M
3300031545|Ga0318541_10172714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1191Open in IMG/M
3300031564|Ga0318573_10188447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1091Open in IMG/M
3300031573|Ga0310915_10049759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2701Open in IMG/M
3300031573|Ga0310915_10052748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2631Open in IMG/M
3300031573|Ga0310915_10156430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1578Open in IMG/M
3300031640|Ga0318555_10321907All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300031719|Ga0306917_10293030All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300031719|Ga0306917_10365498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1123Open in IMG/M
3300031719|Ga0306917_10784482All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300031719|Ga0306917_11212805All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031744|Ga0306918_10200951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1502Open in IMG/M
3300031744|Ga0306918_10231411Not Available1404Open in IMG/M
3300031744|Ga0306918_10355146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1137Open in IMG/M
3300031744|Ga0306918_10484331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium968Open in IMG/M
3300031771|Ga0318546_10026843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3384Open in IMG/M
3300031771|Ga0318546_11115586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300031782|Ga0318552_10231396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium937Open in IMG/M
3300031792|Ga0318529_10028833Not Available2284Open in IMG/M
3300031797|Ga0318550_10527316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300031805|Ga0318497_10871312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300031832|Ga0318499_10184316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300031833|Ga0310917_10771975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300031879|Ga0306919_10029433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3443Open in IMG/M
3300031879|Ga0306919_10122206All Organisms → cellular organisms → Bacteria → Proteobacteria1865Open in IMG/M
3300031879|Ga0306919_10280438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1260Open in IMG/M
3300031910|Ga0306923_11065077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium873Open in IMG/M
3300031910|Ga0306923_11453484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium719Open in IMG/M
3300031910|Ga0306923_12142305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300031912|Ga0306921_10483127All Organisms → cellular organisms → Bacteria → Proteobacteria1441Open in IMG/M
3300031912|Ga0306921_10679362All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300031912|Ga0306921_11548727Not Available722Open in IMG/M
3300031941|Ga0310912_11268981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300031942|Ga0310916_10488165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1049Open in IMG/M
3300031946|Ga0310910_10156177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1748Open in IMG/M
3300031946|Ga0310910_10458684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1011Open in IMG/M
3300031947|Ga0310909_10153203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1896Open in IMG/M
3300031947|Ga0310909_11115959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300032039|Ga0318559_10374417Not Available663Open in IMG/M
3300032090|Ga0318518_10308229All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300032261|Ga0306920_100575110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1668Open in IMG/M
3300033289|Ga0310914_10195099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1806Open in IMG/M
3300033289|Ga0310914_10470478All Organisms → cellular organisms → Bacteria1137Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.22%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.35%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.87%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1017781323300000597Forest SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEP
AF_2010_repII_A001DRAFT_1002831733300000793Forest SoilMPRKCICVALVAIFALAASRSAQAQMTLDVTKVNCDQ
AF_2010_repII_A001DRAFT_1010555123300000793Forest SoilMSRKCVCVALVAIFALGASRSAQAQVTIDVTKVNCDQFVHHKIS
JGI10216J12902_11018358313300000956SoilMPRKCICVALVAVFALAASRSARAQVTVDVTKINCDQFVHHKISEPRLI
JGI10216J12902_11206348213300000956SoilMSRKCVCVALVAILALAASRSAQAQVTVDVTKINCDQFVHHKISEPRL
Ga0066680_1078562023300005174SoilMPRKCVCIALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIA
Ga0066388_10179647133300005332Tropical Forest SoilMPRKCVYVALVAILALVASRSAQAQMTLDVAKVNCGQFVH
Ga0066388_10634728723300005332Tropical Forest SoilMLRQCVCVALIAIAAHAASRSAHGQVTVDVTKVNCDQFVHHKISEPRLIAAW
Ga0066388_10759981813300005332Tropical Forest SoilMPRKCACVALVAIFALSASPSAQAQVTVDVTKVNCGQFVHHKI
Ga0070709_1083300213300005434Corn, Switchgrass And Miscanthus RhizosphereMPRKCVCVALVTVFALAASPSGHAQVTVDVTKVNCDQFVH
Ga0070711_10003076193300005439Corn, Switchgrass And Miscanthus RhizosphereMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAWL
Ga0070708_10046135613300005445Corn, Switchgrass And Miscanthus RhizosphereMPRKCACVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEP
Ga0070708_10135678613300005445Corn, Switchgrass And Miscanthus RhizosphereMPRKCVGFALVAIFALAASRSGHAQVTVDVTKVNCDQFVHHKI
Ga0070698_10175177213300005471Corn, Switchgrass And Miscanthus RhizosphereMPRNSVCVALVAIFALAASGSAQAQMTLDVTKVNCDQFVHHKISEPRLIAAWLTIVPSATTE*
Ga0066700_1073816123300005559SoilMARKHVFIALVAVFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAW
Ga0066905_10189513913300005713Tropical Forest SoilMPRKCVCVALVAVFALAASRSAHAQVTVDVTKVNCDQFVHHKISE
Ga0066903_10054855213300005764Tropical Forest SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRL
Ga0066903_10341150113300005764Tropical Forest SoilMPWKCACIALVAIFALGASRSAQAQVTIDVKKVDCEIRASQNQ*
Ga0066903_10488293023300005764Tropical Forest SoilMPRKCFSIALIAVFALWASRFAQAQVTIDVTKVNCDQFVHHK
Ga0066903_10850244023300005764Tropical Forest SoilMPRKCVCIALLAIFALGASRSAQAQVTIDVTKVNCDQFVHHKIS
Ga0081540_125318623300005983Tabebuia Heterophylla RhizosphereMPRKCVCVALVAIFALAASRSAQAQTTLDVTKVNCDQFVHHKISEPRLIAA
Ga0070716_10012819513300006173Corn, Switchgrass And Miscanthus RhizosphereMPRKCVCVALVAVFALAASPSAHAQMTVDVTKVNCDQFVHHKI
Ga0075430_10090934613300006846Populus RhizosphereMQRKCVSVVFVAILALATYGSAEAQVTVDVTKINCDQFVHH
Ga0075431_10039069533300006847Populus RhizosphereMPRKCLCVVLVAVFALAASQAAQAQVTLDVTKVNCDQFVHHKISEPRLI
Ga0075424_10091292233300006904Populus RhizosphereMARKCVCIALVAIFALAASRSAQAQVTVDVTKVNCDQF
Ga0066710_10285013123300009012Grasslands SoilMPRKCICVALVAVFALAASRSARAQVTVDVTKINCDQFVHHKI
Ga0075418_1247138813300009100Populus RhizosphereMPPNCVCVALVTVFALAASPSGHAQVTVEVTKVNCDQFVHHKISEPRLIAAWL
Ga0126380_1199592313300010043Tropical Forest SoilMQGKCVCVALLAIFASRPVQAQMTLDVTKVNCDQFVHHKISEPRLI
Ga0126384_1176284713300010046Tropical Forest SoilMPRKCACVALVAIFALSASPSAQAQVTVDVTKVNCDQFV
Ga0126370_1054970313300010358Tropical Forest SoilMPRKCVCVALVAIFALSAARSTQAQVTVDVTKVNC
Ga0126372_1090708633300010360Tropical Forest SoilMPRKCVCVALVAFALAASRSAQAQVTVDVTKVNCDQFVHHKISE
Ga0126372_1275331513300010360Tropical Forest SoilMPRKCVRVALLAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEP
Ga0126378_1071702633300010361Tropical Forest SoilMPRKCVCVALVAIFALGAAGSAQAQVTVDVTKVNCDQFVHHKIS
Ga0126379_1002647363300010366Tropical Forest SoilMPRECVCVALVAIFALAASRSAQVQVTVDVTKVNCDQFVHHKISEPS*
Ga0126379_1359001413300010366Tropical Forest SoilMPRKCVCILLAIFALGASRSAQAQVTIDVTKVNCDQFVHHKISEPRLIAA
Ga0134125_1291102523300010371Terrestrial SoilMPRKCVCVALVAVFALAASPSAHAQMTVDVTKVNCDQFVHHKISE
Ga0126383_1093406213300010398Tropical Forest SoilMPLKCVCVAFVAIFVLAASRSAQAQMTLDVTKVNCDQFVHHKISEPRL
Ga0126383_1148613333300010398Tropical Forest SoilMPRSCVCVALVAIFALAASRSAQAQVTVDVTKVNC
Ga0126383_1207104123300010398Tropical Forest SoilMPRKCICVALVAIFALAASRSAQAQMTLDVTKVNCDQFVHHK
Ga0164300_1012117013300012951SoilMHKYVVLGSIFAFFASQSAQGQVTVDVTKINCDQFVHHKISEP
Ga0164303_1129392313300012957SoilMEGLMPRKFVCVALVAVFALAASRSTHAQVTVDVTKVNCDQFVHHKISEPRLIAAWL
Ga0164301_1151229413300012960SoilMPRKCVCVALVAIFALAASRSGHAQVTVDVTKVNCDQFVHHKISEP
Ga0134087_1084205813300012977Grasslands SoilVPRSVCVALVAIVALGASRSAKAQPTIDVTKVNCDQFVHHKISE
Ga0164309_1019894033300012984SoilMHKYVVLGSIFAFFASQSAQGQVTVDVTKMNCDQF
Ga0164307_1173498533300012987SoilLFEELRFLMEGFMPQKCVCVAFVTVVALAAPPSAHAQVTVDVTKVNCDQFVHHKISEPRLIAAWLRRLL*
Ga0137403_1088187223300015264Vadose Zone SoilMPRKCVCVALVAIFALGAFRSAQAQVTIDVTKVNCDQFVH
Ga0182036_1079120523300016270SoilMPRKYVCVALVATFALAASRSAQAQVTVDVTKVNCDQFVHH
Ga0182041_1181203313300016294SoilMPRKCVCVALVAIFALSASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAA
Ga0182035_1150741723300016341SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIA
Ga0182034_1018649933300016371SoilMPPNCVCVALVTVFALAASPSGHAQLTVDVTKVNCDQFVHHKISEPRLIAAWLTVTIMPNATTE
Ga0182034_1200047123300016371SoilMPRKCLCVALVTVFALAASPSGHAQVTVDVTKVNCDQFVHHKISEPRL
Ga0182040_1060827423300016387SoilMPRKCVCVALIAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPR
Ga0182040_1078939523300016387SoilMPRKCVCVALIATIFALAASRSAQAQVTVDVTKVNCDQFVHHK
Ga0182040_1112803713300016387SoilHGSGIALVAVFALAASRSVQAQMTVDVPKINCDKFVHNKISEPRLIAPWRSG
Ga0182039_1078481813300016422SoilMPPKCVCVALVTIFALAASQSAQAQVTVDVTKVNCDQFVHHKISEPR
Ga0182039_1209243413300016422SoilMPRKCLCVALVTVFALAASPSGHAQVTVDVTKVNCDQFVHHKISEPRLIAAW
Ga0182038_1020486823300016445SoilMPRKCVCVALVAIFALAALRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAWL
Ga0184608_1012659613300018028Groundwater SedimentMHKYVVLGSIFAFFASQSAQGQVTVDVTKINCDQFV
Ga0066662_1130838733300018468Grasslands SoilMPRKCVCVALVAIFALAASRSAQAQMTLDVTKVNCDQ
Ga0210403_1078750713300020580SoilMPRKCVCVALVTVFALAASPSGHAQVTVDVTKVNCDQ
Ga0210406_1039444113300021168SoilMPRKRVCVALVAVFALAASRSAHAQVTFDVTKVNCDQFVHHKISEPREGRDYLRAGV
Ga0210387_1039694423300021405SoilMPRKRVCVALVAVFALAASRSAHAQVTVDVTKVNCDQFVHHKISEPREGRDYLRGGV
Ga0210402_1079961713300021478SoilMPRKFVCVALVAVFALAASRSTHAQVTVDVTKVNCDQFVH
Ga0210410_1091846823300021479SoilMPRKCVCVALVAIFALAASRSAHAQVTVDVTKVNCDQFVHHKISEPREGRDYLRGGV
Ga0209474_1073935613300026550SoilVPRSVCVALVAIVALGASRSAQAQLTIDVTKVNCDQFVHHKISEPRLIAAWLSGY
Ga0209382_1114778013300027909Populus RhizosphereMPRKCVCVALVTVYALAASPSGHAQVTVEVTKVNCDQFVH
Ga0209382_1211500123300027909Populus RhizosphereMHPKCVVSGLILALFAALPARAQVTVDVSKINCDQFVHHKI
Ga0307298_1007226433300028717SoilMHKYVVLGSIFAFFASQSAQGQVTVDVTKINCDQFVHH
Ga0307316_1031168923300028755SoilMPRKCICVALVAIFALGASRFAQAQVTVDVTKVNCDQFVHHKISEPRLIAAWLSG
Ga0307288_1014593913300028778SoilMHKYVVLGSIFAFFASQSAQGQVTVDVTKINCDQFVHHKISEPSLIA
Ga0307282_1002838343300028784SoilMRRKRVCGALVAIFAIAASGIAQGQVTIDVTKVNCDQFVHHKISEP
Ga0307308_1022467213300028884SoilMPRKCICVALVAIFALGASRFAQAQVTVDVTKVNC
Ga0307496_1001441213300031200SoilMPRKCVCVALVAIFALGATRFAQAQVTLDVTKVNCDQF
Ga0318541_1017271423300031545SoilMPRKCVCVALVAIFTLAASQSAQAQMTVDVTKVNCDQFVHHKISEPRLIAA
Ga0318573_1018844713300031564SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKIS
Ga0310915_1004975913300031573SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQ
Ga0310915_1005274813300031573SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVH
Ga0310915_1015643023300031573SoilMPRKCVCVALVAIFTLAASQSAQAQMTVDVTKVNCDQFVHHK
Ga0318555_1032190713300031640SoilMPRKCVCVALVAFFALAASRSAQAQVTVDVTKVNCDQFVHHKIS
Ga0306917_1029303013300031719SoilMPRKCVCVALVAIFALSASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAW
Ga0306917_1036549823300031719SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISE
Ga0306917_1078448213300031719SoilMPRKCVCIALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLI
Ga0306917_1121280513300031719SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLI
Ga0306918_1020095113300031744SoilMPRKCVCVALVAIFALSASRSAQAQVTVDVTKVNCDQFVHHKIS
Ga0306918_1023141113300031744SoilMPRKCVCVVLVAVFALAASRSVQAQMTVDVAKINC
Ga0306918_1035514613300031744SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLITAW
Ga0306918_1048433133300031744SoilMPRKYVCVALVATFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAW
Ga0318546_1002684393300031771SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNC
Ga0318546_1111558623300031771SoilMPRKCVCVALVAIFALAASRSAQAQVMVDVTKVNCDQFVHHKISEPRLIAAWL
Ga0318552_1023139633300031782SoilMPPKCVCVALVAIFALAASQSAQAQVTVDVTKVNCDQFVHHKISEPR
Ga0318529_1002883353300031792SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCD
Ga0318550_1052731623300031797SoilMPRKFVCAALVAVFALPASRSTHAQVTVDVTKVNCDQFVHHKIS
Ga0318497_1087131213300031805SoilMPPKCVCVALVAIFALAASQSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAW
Ga0318499_1018431613300031832SoilMPRKCVCIALVAIFALAASRSVQAQTTVDVAKVNCDQFVHHKISEPRLIAAWLS
Ga0310917_1077197523300031833SoilMPRKCVCVALIATIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAW
Ga0306919_1002943363300031879SoilMPRKCVCVALVAIFALAALRSAQAQVTVDVTKVNC
Ga0306919_1012220613300031879SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQF
Ga0306919_1028043813300031879SoilMPRKCVCVALVAIFALSASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIA
Ga0306923_1106507723300031910SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKI
Ga0306923_1145348413300031910SoilMPRKCVCVALVAIFALAALRSAQAQVTVDVTKVNCDQFVHHK
Ga0306923_1214230513300031910SoilMPRKCVCVALVAIFALAASRSAHAQMTVDVTKVNCDQFVHHK
Ga0306921_1048312733300031912SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHH
Ga0306921_1067936253300031912SoilMPRKYVCVALVATFALAASRSAQAQVTVDVTKVNCDQFVHHKISEP
Ga0306921_1154872713300031912SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAWLS
Ga0310912_1126898113300031941SoilMLRKCLYVALVAIFALAASRSAQAQMTVDVTKINCDQFVHHKSVSLGLSL
Ga0310916_1048816513300031942SoilMPPNCVCVALVTVFALAASPSGHAQLTVDVTKVNCDQFVHH
Ga0310910_1015617713300031946SoilMPRKCVCVALVAIFALSASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAWL
Ga0310910_1045868413300031946SoilMPRKCVCVALIAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAW
Ga0310909_1015320313300031947SoilMPRKCVCVALVAIFALSASRSAQAQVTVDVTKVNCDQFVHHKISEPRLI
Ga0310909_1111595923300031947SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFVHHKISESRPRLQKADL
Ga0318559_1037441713300032039SoilMPRKCVCVALIATIFALAASRSAQAQVTVDVTKVNCDQFV
Ga0318518_1030822913300032090SoilMPRKCVCVALVAFFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPR
Ga0306920_10057511033300032261SoilMPRKCVCVALIATIFALAASRSAQAQVTVDVTKVNCDQFVHHKISEPRLIAAWL
Ga0310914_1019509913300033289SoilMPRKCVCVALVAIFALSASRSAQAQVTVDVTKVNCDQFV
Ga0310914_1047047823300033289SoilMPRKCVCVALVAIFALAASRSAQAQVTVDVTKVNCDQFV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.