| Basic Information | |
|---|---|
| Family ID | F080359 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVYSVSPFDLD |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 28.70 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.17 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.609 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (11.304 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.435 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.087 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.77% β-sheet: 0.00% Coil/Unstructured: 71.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF02678 | Pirin | 21.74 |
| PF02578 | Cu-oxidase_4 | 20.00 |
| PF07228 | SpoIIE | 6.09 |
| PF03989 | DNA_gyraseA_C | 5.22 |
| PF00293 | NUDIX | 4.35 |
| PF01266 | DAO | 4.35 |
| PF00271 | Helicase_C | 3.48 |
| PF05960 | DUF885 | 3.48 |
| PF04264 | YceI | 2.61 |
| PF01850 | PIN | 2.61 |
| PF07311 | Dodecin | 1.74 |
| PF10026 | DUF2268 | 0.87 |
| PF00543 | P-II | 0.87 |
| PF01380 | SIS | 0.87 |
| PF06262 | Zincin_1 | 0.87 |
| PF04185 | Phosphoesterase | 0.87 |
| PF00857 | Isochorismatase | 0.87 |
| PF00881 | Nitroreductase | 0.87 |
| PF05176 | ATP-synt_10 | 0.87 |
| PF03572 | Peptidase_S41 | 0.87 |
| PF00440 | TetR_N | 0.87 |
| PF07498 | Rho_N | 0.87 |
| PF01979 | Amidohydro_1 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 21.74 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 20.00 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 5.22 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 3.48 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 2.61 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.74 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.87 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.87 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.61 % |
| Unclassified | root | N/A | 17.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10514830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300004080|Ga0062385_10408648 | Not Available | 813 | Open in IMG/M |
| 3300004092|Ga0062389_101895218 | Not Available | 774 | Open in IMG/M |
| 3300004152|Ga0062386_100367168 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300005178|Ga0066688_10600893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300005181|Ga0066678_10385746 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005353|Ga0070669_100576872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300005454|Ga0066687_10556428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300005456|Ga0070678_100070375 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
| 3300005518|Ga0070699_100105082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2477 | Open in IMG/M |
| 3300005546|Ga0070696_101600888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300006057|Ga0075026_100430703 | Not Available | 747 | Open in IMG/M |
| 3300006059|Ga0075017_100115221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1885 | Open in IMG/M |
| 3300006162|Ga0075030_100125719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2083 | Open in IMG/M |
| 3300006174|Ga0075014_100077910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1497 | Open in IMG/M |
| 3300006176|Ga0070765_101075262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300006176|Ga0070765_102289288 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006237|Ga0097621_101482560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300009038|Ga0099829_10015824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5043 | Open in IMG/M |
| 3300009500|Ga0116229_10242182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1537 | Open in IMG/M |
| 3300009520|Ga0116214_1087614 | Not Available | 1141 | Open in IMG/M |
| 3300009521|Ga0116222_1113986 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300009547|Ga0116136_1193188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300009629|Ga0116119_1164273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 554 | Open in IMG/M |
| 3300009643|Ga0116110_1302146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 508 | Open in IMG/M |
| 3300009646|Ga0116132_1192472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 619 | Open in IMG/M |
| 3300009839|Ga0116223_10388747 | Not Available | 822 | Open in IMG/M |
| 3300010373|Ga0134128_10642443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1180 | Open in IMG/M |
| 3300010379|Ga0136449_101461682 | Not Available | 1050 | Open in IMG/M |
| 3300010396|Ga0134126_11620859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300011269|Ga0137392_10184048 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300011271|Ga0137393_10151167 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300012351|Ga0137386_11170081 | Not Available | 540 | Open in IMG/M |
| 3300012362|Ga0137361_11212440 | Not Available | 677 | Open in IMG/M |
| 3300012917|Ga0137395_11063035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012944|Ga0137410_10175939 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300012951|Ga0164300_10200791 | Not Available | 977 | Open in IMG/M |
| 3300014162|Ga0181538_10178548 | Not Available | 1203 | Open in IMG/M |
| 3300014164|Ga0181532_10619959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 586 | Open in IMG/M |
| 3300014164|Ga0181532_10733721 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 531 | Open in IMG/M |
| 3300014326|Ga0157380_11894629 | Not Available | 657 | Open in IMG/M |
| 3300014491|Ga0182014_10411902 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300015087|Ga0167637_1016665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300017822|Ga0187802_10247347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300017823|Ga0187818_10121132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300017938|Ga0187854_10500262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300017940|Ga0187853_10277107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300017943|Ga0187819_10539478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300018002|Ga0187868_1070595 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300018006|Ga0187804_10032380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1972 | Open in IMG/M |
| 3300018013|Ga0187873_1362074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 529 | Open in IMG/M |
| 3300018016|Ga0187880_1052344 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300018022|Ga0187864_10424114 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 569 | Open in IMG/M |
| 3300018026|Ga0187857_10387532 | Not Available | 631 | Open in IMG/M |
| 3300018030|Ga0187869_10327515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300018033|Ga0187867_10256421 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300018034|Ga0187863_10403960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300018037|Ga0187883_10572477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300018038|Ga0187855_10516990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300018040|Ga0187862_10675863 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300018085|Ga0187772_11364859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300018086|Ga0187769_10192121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300018090|Ga0187770_11187411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300019787|Ga0182031_1179318 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300020061|Ga0193716_1004907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7147 | Open in IMG/M |
| 3300020580|Ga0210403_11492166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300020582|Ga0210395_10286789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 1238 | Open in IMG/M |
| 3300020582|Ga0210395_10426205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300021178|Ga0210408_10061471 | All Organisms → cellular organisms → Bacteria | 2934 | Open in IMG/M |
| 3300021403|Ga0210397_10679684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300021432|Ga0210384_10351377 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300021478|Ga0210402_10988645 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300021478|Ga0210402_11080363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300021479|Ga0210410_10354798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
| 3300022840|Ga0224549_1062577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300023090|Ga0224558_1106724 | Not Available | 967 | Open in IMG/M |
| 3300023090|Ga0224558_1116036 | Not Available | 908 | Open in IMG/M |
| 3300025434|Ga0208690_1073230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300025923|Ga0207681_10626894 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025934|Ga0207686_11759792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300026023|Ga0207677_11791076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300026217|Ga0209871_1070395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300026281|Ga0209863_10022350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1939 | Open in IMG/M |
| 3300026294|Ga0209839_10227484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300026508|Ga0257161_1084437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300026547|Ga0209156_10142975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300026551|Ga0209648_10450778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300026557|Ga0179587_10023899 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
| 3300026998|Ga0208369_1024940 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027565|Ga0209219_1079853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300027854|Ga0209517_10341765 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300027875|Ga0209283_10700788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 632 | Open in IMG/M |
| 3300027895|Ga0209624_10422966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300027903|Ga0209488_10647388 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300027986|Ga0209168_10233260 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300028776|Ga0302303_10331306 | Not Available | 510 | Open in IMG/M |
| 3300028800|Ga0265338_10892108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300028828|Ga0307312_11060948 | Not Available | 536 | Open in IMG/M |
| 3300029817|Ga0247275_1181443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300029915|Ga0311358_11002765 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 574 | Open in IMG/M |
| 3300030041|Ga0302274_10093336 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300030058|Ga0302179_10198511 | Not Available | 886 | Open in IMG/M |
| 3300030494|Ga0310037_10205702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300030503|Ga0311370_10721691 | Not Available | 1165 | Open in IMG/M |
| 3300030520|Ga0311372_12926458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300030617|Ga0311356_11864678 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300030618|Ga0311354_10159755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2451 | Open in IMG/M |
| 3300030618|Ga0311354_10820841 | Not Available | 875 | Open in IMG/M |
| 3300030706|Ga0310039_10163136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 895 | Open in IMG/M |
| 3300031234|Ga0302325_11454318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300031616|Ga0307508_10683876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300031754|Ga0307475_10282628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300031754|Ga0307475_10558801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300032892|Ga0335081_11770801 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032954|Ga0335083_10793069 | Not Available | 760 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.70% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.35% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.48% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.61% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.87% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.87% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.87% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.87% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105148301 | 3300001593 | Forest Soil | MAQVRQGALEFQRQLSAALPNLSELKVYSVSPFDLDERRRA |
| Ga0062385_104086481 | 3300004080 | Bog Forest Soil | MAYRVVSFTMAQVRQGALGFQRSLSAVLREHPEIKVYSVSPFDLDERRR |
| Ga0062389_1018952181 | 3300004092 | Bog Forest Soil | MSYHVVALTMAQVRQGGLDFQRALGTALREAREIRVYSASPFDLEER |
| Ga0062386_1003671681 | 3300004152 | Bog Forest Soil | MSYHVVAFTMAQVRQGALEFQRQLSAVLRESRDLKVYSASPFDLEE |
| Ga0066688_106008931 | 3300005178 | Soil | GALAFQRRLGAILRESKDLKVYSASPFDLDERRRLRERFG* |
| Ga0066678_103857461 | 3300005181 | Soil | MPYHVVSFTMAQVRQGALGFQRQLSAALRESSQLKVYSVSPFDLDERRRIKD |
| Ga0070669_1005768721 | 3300005353 | Switchgrass Rhizosphere | MSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPFDLDARR |
| Ga0066687_105564281 | 3300005454 | Soil | MAQVRQGALGFQRELSAILRERPDLKVYSVSPFDLDERRRFKDRF |
| Ga0070678_1000703752 | 3300005456 | Miscanthus Rhizosphere | MSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPFDLDARRRFRER |
| Ga0070699_1001050821 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYHVVAFTMAQVRQGALEFQRQLGATVDKVKDLKVYSASPFDLDE |
| Ga0070696_1016008882 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MAYHVVALTMAQVRLGALAFQRQLSAALAESRDLKVYSVSPFALDERRRFKD |
| Ga0075026_1004307032 | 3300006057 | Watersheds | MPYHVVALTMNQVRQGGLAFQRELGAILRDSSDVKVYSCSPFDLEERRRMK |
| Ga0075017_1001152211 | 3300006059 | Watersheds | MSYHVVALSMAQVRQGALEFQRQLGAALRDVTDLKVYSPSPFDL |
| Ga0075030_1001257194 | 3300006162 | Watersheds | MPYHVVAFTMAQVRQGALAFQRQLSAALRESKDLKVYSVSPFDLEERRRF |
| Ga0075014_1000779101 | 3300006174 | Watersheds | MPYHVVAFTMAQVRQGALAFQRELSAALRESKDLKVYSVSPFDLEERRRF |
| Ga0070765_1010752621 | 3300006176 | Soil | MSYHVVAFTLAQVRQGSLAFQRQLSGILRDSTEIKVYSASPF |
| Ga0070765_1022892882 | 3300006176 | Soil | MAEVRQGALGFQRDLSAILRENAEIKVYSVSPFDLDERRRFKDRFGG |
| Ga0097621_1014825602 | 3300006237 | Miscanthus Rhizosphere | MPYHVVAFTMAEVRQGALSFQRELSAALRESKDLKVYSVSPFDLD |
| Ga0099829_100158246 | 3300009038 | Vadose Zone Soil | MPYHVVALTMTQVRQGGLAFQRELGAMLRDSSDVKVYSCSPFDLEERRRIK |
| Ga0116229_102421822 | 3300009500 | Host-Associated | MAQVRAGGLDFQRALGTALRESREIKVYSASPFDLEERRRVKD |
| Ga0116214_10876142 | 3300009520 | Peatlands Soil | MPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVYSVSPFDLDERRRAKDR |
| Ga0116222_11139861 | 3300009521 | Peatlands Soil | MAQVRHGALDFQRELGAVLRDAPNLKVYSASPFDLD |
| Ga0116136_11931882 | 3300009547 | Peatland | MPYRVVSFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPFDLDERRR |
| Ga0116119_11642731 | 3300009629 | Peatland | MPYRVVSFTMAQVRQGALDFQRQLSAVLRECAEIKVYSVSPFDLD |
| Ga0116110_13021462 | 3300009643 | Peatland | MAYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPF |
| Ga0116132_11924722 | 3300009646 | Peatland | MPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVYSVSPFDLDERRRAK |
| Ga0116223_103887472 | 3300009839 | Peatlands Soil | MPYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPFDL |
| Ga0134128_106424431 | 3300010373 | Terrestrial Soil | MAYHVVALTMAQVRLGALAFQRQLSAALAESRDLKVYSVSPFALDERRRFK |
| Ga0136449_1014616822 | 3300010379 | Peatlands Soil | MPYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPFDLDE |
| Ga0134126_116208592 | 3300010396 | Terrestrial Soil | MPYHVVAFTMAQVRQGALEFQRLLGTALRESRELKVY |
| Ga0137392_101840481 | 3300011269 | Vadose Zone Soil | MPFRVVSFTMAQVRQGALGFQRELSAILRERPDIKVYS |
| Ga0137393_101511671 | 3300011271 | Vadose Zone Soil | MPYHVLALTMAQVRQGGLEFQRRLGPIVRDVKDVKVYS |
| Ga0137386_111700811 | 3300012351 | Vadose Zone Soil | MPYRVVSFTMAQVRQGALGFQRELSAILRERPDIKVYSVSPFDLDERRR |
| Ga0137361_112124402 | 3300012362 | Vadose Zone Soil | MPYRVVSFTMAQVRQGALGFQRELSAILRERPDLKVYSVSPFDLDERRRFKD |
| Ga0137395_110630351 | 3300012917 | Vadose Zone Soil | MPYRVVSFTMAQVRQGALGFQRELSAILRERPDIKVYSVSPFALDE |
| Ga0137410_101759391 | 3300012944 | Vadose Zone Soil | MPYHVVAFTMAQVRQGALAFQRQLSAALHESRDLKVYSVSPFDLEE |
| Ga0164300_102007912 | 3300012951 | Soil | MSYHVVALTLAQVRQGALGFQRQLGAAVRDASGVRV |
| Ga0181538_101785481 | 3300014162 | Bog | MPYRVISFTMAQVRQGAPGFQRQLSAVLRERAEIKVYSV |
| Ga0181532_106199591 | 3300014164 | Bog | MPYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPFDLDER |
| Ga0181532_107337211 | 3300014164 | Bog | MPYRVISFTMAQVRQGALGFQRQLSAVLRERAEIKV |
| Ga0157380_118946291 | 3300014326 | Switchgrass Rhizosphere | MSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYS |
| Ga0182014_104119022 | 3300014491 | Bog | MSYRVISFTMAQVRQGALGFQRRLSAVLRERAEIKVYSV |
| Ga0167637_10166651 | 3300015087 | Glacier Forefield Soil | MAQVRQGALAFQRQLSAALRESRDLKVYSVSPFDLE |
| Ga0187802_102473471 | 3300017822 | Freshwater Sediment | MAEVRQGALDFQRELGAVLRDAPNLKVYSASPFDLDERRRAKDR |
| Ga0187818_101211322 | 3300017823 | Freshwater Sediment | MPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVYSVSPFDLD |
| Ga0187854_105002621 | 3300017938 | Peatland | MTLQPMSYRVVAFTMAQVRQGALGFQRQLGATLREHVE |
| Ga0187853_102771071 | 3300017940 | Peatland | MTLQPMSYRVVAFTMAQVRQGALGFQRQLGATLREHVEIKVYSVSPFD |
| Ga0187819_105394782 | 3300017943 | Freshwater Sediment | MPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVY |
| Ga0187868_10705951 | 3300018002 | Peatland | MAQVRQGALDFQRQLSAALRECAEIKVYSVSPFDLDERRRFK |
| Ga0187804_100323801 | 3300018006 | Freshwater Sediment | MAQVRQGALGFQRQLSAVLREQAEIKVYSVSPFDLDERR |
| Ga0187873_13620742 | 3300018013 | Peatland | MSYHVVALTMVQVRQGALDFQRDLGAVLRDAPELKVYSASPFDLEERRRV |
| Ga0187880_10523441 | 3300018016 | Peatland | MTLQPMSYRVVAFTMAQVRQGALGFQRQLGATLREHVEIKVYSV |
| Ga0187864_104241141 | 3300018022 | Peatland | MPYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVY |
| Ga0187857_103875321 | 3300018026 | Peatland | MPYHVVAFTMAQVRQGALGFQRQLSAVLREHAEIK |
| Ga0187869_103275152 | 3300018030 | Peatland | MSYRVVAFTMAQVRQGALGFQRQLGAMLRAHVEIKVYSV |
| Ga0187867_102564213 | 3300018033 | Peatland | MSYHVVALTMAQVRQGALDFQRDLGAVLRDAPELKVYSASPFDLEERRRVK |
| Ga0187863_104039601 | 3300018034 | Peatland | MSYHVVALTMAQVRQGALDFQRDLGAVLRDAPELKVY |
| Ga0187883_105724772 | 3300018037 | Peatland | MAYRVVSLTMAQVRQGALVFQRELGAVLREHLEIKVYSVSPFDLDER |
| Ga0187855_105169902 | 3300018038 | Peatland | MPYQVIAFTMAQVRQGALSFQRELSAVLRENPEIKVYSASPFD |
| Ga0187862_106758631 | 3300018040 | Peatland | MSYRVVAFTMAQVRQGALGFQRQLSAVLREHPEIK |
| Ga0187772_113648592 | 3300018085 | Tropical Peatland | MTYRVIAFTMNQVRQGALEFQRRLSVIVREYPEIKVYGVSPFDLE |
| Ga0187769_101921211 | 3300018086 | Tropical Peatland | MPYRVVALTMAQVRQGALGFQRQLSALLREHAEIKVYSVSPFDLDERR |
| Ga0187770_111874112 | 3300018090 | Tropical Peatland | MPYRVVAFTMAQVRQGALGFQRQLSALLREHAEIKVYAVSPFDLEE |
| Ga0182031_11793182 | 3300019787 | Bog | MAYRVIAFTMAQVRQGALNFQRELTAVLRERPEIKVYSANPFDLDERRRARD |
| Ga0193716_10049078 | 3300020061 | Soil | MPYHVVAFTMAQVRQGALEFQRLLGTAVRESRDLKVYSVSPFDL |
| Ga0210403_114921662 | 3300020580 | Soil | MPYHVVAFTMAQVRQGALAFQRQLSAALRESRDLK |
| Ga0210395_102867891 | 3300020582 | Soil | MSYHVVAFTMAEVRQGALDFQRELGAVLRDAPNLKVYSASPFDL |
| Ga0210395_104262051 | 3300020582 | Soil | MSYHVVALTMAQVRQGALDFQRELGSVLKDAPELKVYS |
| Ga0210408_100614716 | 3300021178 | Soil | MPYHVVAFTMAQVRQGALAFQRQLSAALRESRDLKVYSVSP |
| Ga0210397_106796841 | 3300021403 | Soil | MPYHVLPLTMMQVRKGALAFQRELGAAVRESSPLKVYSVSPFDL |
| Ga0210384_103513771 | 3300021432 | Soil | MSYHVLPLTMMQVRKGALAFQRELGAAVRESSPLKVYSVSPFDL |
| Ga0210402_109886452 | 3300021478 | Soil | MSYHVVAFTMAQVRQGALKFQRELSAVLSNAPELKVYSASPFDLD |
| Ga0210402_110803631 | 3300021478 | Soil | MSYHVVALTMAQVRQGALQFQRELGAALHEGSNLKVYSASPFD |
| Ga0210410_103547981 | 3300021479 | Soil | MPYRVVSFTMAQVRQGALGFQRELSVVLRERPDIKVYSVSPFDLDERRRFK |
| Ga0224549_10625771 | 3300022840 | Soil | VNAYRVVSFTMAQVRQGALGFQRELGAALREHPEIKVYSVSPF |
| Ga0224558_11067242 | 3300023090 | Soil | MAQVRQGALGFQRRLSAVLRERAEIKVYSVSPFDLDE |
| Ga0224558_11160361 | 3300023090 | Soil | MPYRVVSFTMAQVRQGALGFQRQLGAALRGNAEIKVYSVSP |
| Ga0208690_10732301 | 3300025434 | Peatland | MPYHVVAFTMSQVRQGALGFQRDLGAVVREQPDIKVYSASPFDL |
| Ga0207681_106268942 | 3300025923 | Switchgrass Rhizosphere | MSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPFDLDARRRFR |
| Ga0207686_117597922 | 3300025934 | Miscanthus Rhizosphere | MSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPFD |
| Ga0207677_117910762 | 3300026023 | Miscanthus Rhizosphere | MSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPF |
| Ga0209871_10703951 | 3300026217 | Permafrost Soil | MSYYVVAFTMAQVRQGALAFQRQLSAALRESRDLKVYSVSPFDL |
| Ga0209863_100223501 | 3300026281 | Prmafrost Soil | MAYHVVAFTMAQVRTGALDFQRLLSAVLREQKDIKVYQVSPFD |
| Ga0209839_102274841 | 3300026294 | Soil | MAYRVIAFTMAQVRQGALGFQRDLSSALQEHRDIKVYSVSP |
| Ga0257161_10844372 | 3300026508 | Soil | MAQVRQGALGFQRDLSAILRERPDIKVYSVSPFDLDERRRFKDRF |
| Ga0209156_101429752 | 3300026547 | Soil | MSYHVVAFTLAQVRQGALAFQRRLGAILRDSKDLKVYSASP |
| Ga0209648_104507781 | 3300026551 | Grasslands Soil | MPYRVVSFTMAQVRQGALGFQRQLSAVLREHAEIKVFSVNPFDL |
| Ga0179587_100238991 | 3300026557 | Vadose Zone Soil | MTYRVIAFTMAQVRQGALGFQRQLGTALRESPAIKVYSVSP |
| Ga0208369_10249401 | 3300026998 | Forest Soil | MAQVRQGALDFQRELGAVLRDAPELKVYSASPFDLDERRRAKDR |
| Ga0209219_10798532 | 3300027565 | Forest Soil | MPYHVAAFTMAQVRTGALEFQRQLGAIVRDVKDLKVYSASPF |
| Ga0209517_103417651 | 3300027854 | Peatlands Soil | MAQVRKGALEFQRQLSAVVPSAKEIKVYSASPFDL |
| Ga0209283_107007881 | 3300027875 | Vadose Zone Soil | MPYHVVSLTMTQVRRGGLAFQRELGAILRDSSDMK |
| Ga0209624_104229662 | 3300027895 | Forest Soil | RQGALEFQRQLSASLPGLKELKVYSASPFDLDERRRAKDRFVSACHI |
| Ga0209488_106473882 | 3300027903 | Vadose Zone Soil | MPYRVIAFTMAQVRQGSLGFHRDLAAILRENPEIKVYSASPFDLEER |
| Ga0209168_102332602 | 3300027986 | Surface Soil | MSYHVVAFTMAQVRQGALDFQRQLSAVLSEARELKVYSA |
| Ga0302303_103313061 | 3300028776 | Palsa | MLRLIQPMPYRVLSFTMAEVRQGALRFQRQLSAALREHAEIKVYSVSPFDLDERR |
| Ga0265338_108921081 | 3300028800 | Rhizosphere | MPYHVVAFTMAQVRQGALAFQRDLSAALRESKDLKVYSVSPFDLDERR |
| Ga0307312_110609481 | 3300028828 | Soil | MPYHVLALTMAQVRAGGLEFQRQLGPMVCEMRELKVYSASPFDLDE |
| Ga0247275_11814431 | 3300029817 | Soil | MTLQPMSYRVVAFTMAQVRQGALGFQRQLGATLREHVEIKVYSVSPFDLDE |
| Ga0311358_110027651 | 3300029915 | Bog | MSYRIVAYTMAQVRQGALNFQRDLSAVLTENPQIKVYSASPFDLEERRRLKDR |
| Ga0302274_100933363 | 3300030041 | Bog | MAQVRQGALNFQRDLSAVLSENPGIKVYSASPFDLEERRRL |
| Ga0302179_101985111 | 3300030058 | Palsa | MSYRVVSLTMAQVRQGALGFQRELGAVLVEHPEIKVYAVSPF |
| Ga0310037_102057022 | 3300030494 | Peatlands Soil | MSYHVVAFTMAQVRQGALEFQRQLSAILRESKELKVY |
| Ga0311370_107216911 | 3300030503 | Palsa | MLRLIQPMPYRVLSFTMAEVRQGALRFQRQLSDALREHAEIKVYSVSPFDLDELRR |
| Ga0311372_129264581 | 3300030520 | Palsa | MAQVRQGALGFQRELGAALREHPEIKVYSVSPFDLDER |
| Ga0311356_118646782 | 3300030617 | Palsa | MSYRVVSLTMAQVRQGALGFQRELGAVLVEHPEIKVYAVSPFDLEE |
| Ga0311354_101597551 | 3300030618 | Palsa | VNAYRVISFTMAQVRQGALGFQRELGAALREHPEIKVYSVS |
| Ga0311354_108208411 | 3300030618 | Palsa | MLRLIQPMPYRVLSFTMAEVRQGALRFQRQLSAALREH |
| Ga0310039_101631361 | 3300030706 | Peatlands Soil | MPYHVVAFTMAQVRQGALDFQRELGAVLRDAPNLKVYSASP |
| Ga0302325_114543181 | 3300031234 | Palsa | MAQVRQGALDFQRELGSVLSDAPQLKVYSASPFDLEERRRVKDRF |
| Ga0307508_106838762 | 3300031616 | Ectomycorrhiza | MAQVRQGGLNFQRELGALLGERPEIKVYSVSPFDLDE |
| Ga0307475_102826283 | 3300031754 | Hardwood Forest Soil | MSYHVVSFSMAQVRQGALGFERELSAILRERPDIKV |
| Ga0307475_105588013 | 3300031754 | Hardwood Forest Soil | MSYHVVALTLAQVRQGALAFQRELGDALRESKELKVYSA |
| Ga0335081_117708011 | 3300032892 | Soil | MPYHVLPLTMAQVRQGALAFQRQLSPAAPDGAELKVYSASPF |
| Ga0335083_107930691 | 3300032954 | Soil | MRYHVVALTLSQIRQGALAFQRQLSRTLPDGTELK |
| ⦗Top⦘ |