| Basic Information | |
|---|---|
| Family ID | F080357 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LQNDLHNALQKASPTLNDGRFSIGKIEAIRDEKGNVVAYEVEIRH |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.87 % |
| % of genes from short scaffolds (< 2000 bps) | 0.87 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.130 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.391 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.739 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.957 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.18% β-sheet: 24.66% Coil/Unstructured: 56.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF03548 | LolA | 29.57 |
| PF17131 | LolA_like | 16.52 |
| PF01740 | STAS | 8.70 |
| PF01035 | DNA_binding_1 | 6.09 |
| PF12833 | HTH_18 | 3.48 |
| PF00892 | EamA | 1.74 |
| PF04307 | YdjM | 0.87 |
| PF07690 | MFS_1 | 0.87 |
| PF14200 | RicinB_lectin_2 | 0.87 |
| PF13419 | HAD_2 | 0.87 |
| PF07238 | PilZ | 0.87 |
| PF01979 | Amidohydro_1 | 0.87 |
| PF03734 | YkuD | 0.87 |
| PF10633 | NPCBM_assoc | 0.87 |
| PF02321 | OEP | 0.87 |
| PF13602 | ADH_zinc_N_2 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 29.57 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 6.09 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 6.09 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.87 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.13 % |
| All Organisms | root | All Organisms | 0.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300012971|Ga0126369_11707344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.09% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.35% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.74% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.74% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.87% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.87% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.87% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12650J13346_10026152 | 3300001159 | Forest Soil | PERTPALQNELHNALQKAGAGLQDGRFSIGKIEALRDASGNVIAFQVEISH* |
| JGIcombinedJ26739_1012442662 | 3300002245 | Forest Soil | ELHNALQKAQPKLGDGHFAIGKIEAIRDEAGNVVAYEVQISH* |
| JGI25612J43240_10215941 | 3300002886 | Grasslands Soil | ALQNDLHNVLQKAGPGLQDGRFAIGKIEPLRDASGNVIAYQVEIKH* |
| JGI25616J43925_100111005 | 3300002917 | Grasslands Soil | LQNDLHNVLQKAGPGLQDGRFAIGKIEPLRDASGNVIAYQVEIKH* |
| Ga0062384_1003017382 | 3300004082 | Bog Forest Soil | ALQNDLHNALQKANPALSDGRFSIGKIEPIRDESGTVIAYQVEISH* |
| Ga0062389_1046446471 | 3300004092 | Bog Forest Soil | LHNALQKSRKELSDGRFAIGTIEAVRDDQGIVIAYKVEIRH* |
| Ga0070709_113800121 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PPEKTPALQNELHQALRKALPDLRNVRFSIVNIDAVRDEEGTVIAYQVEISR* |
| Ga0070710_113023942 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | QNELHQALQRALPDLRNGRFSITNIEAVRDEKGTVIAYEVEIHR* |
| Ga0070699_1007063112 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LQNELHQALQRALPDLRNGRFSITKIEAVRDENGNVIAYEVEIHR* |
| Ga0066691_105140601 | 3300005586 | Soil | TPALQNDLHNALQNAGQGLQDGRFSIGKIEPLRDAGGNVIAYQVEIKH* |
| Ga0075023_1000500063 | 3300006041 | Watersheds | QNELHQALRRALPDLRNGRFSITNIEAVRDETGTVIAYEVEIHR* |
| Ga0075028_1008629072 | 3300006050 | Watersheds | HNALRKARPDLKDGGFSILKIEAIRDEKGNVIAYQVEIRH* |
| Ga0075019_103572771 | 3300006086 | Watersheds | NDLHNVLQKAGEGLQDGRFAIGKIEAVRDEQGNVIAYQVEIKH* |
| Ga0075030_1006270011 | 3300006162 | Watersheds | ARPDLHDGRFSIGTIEPQRDEKGNVVAYEVTIRH* |
| Ga0075030_1007111642 | 3300006162 | Watersheds | HNALQKAGAGLQDGRFSIGKIEALRDASGNVIAYQVEIKH* |
| Ga0075014_1001702442 | 3300006174 | Watersheds | EQTPALQNDLHNALKKALPDLRNGRFSITKIEPVRDEAGTVIAYQVEIHR* |
| Ga0099793_100256434 | 3300007258 | Vadose Zone Soil | AGPGLQAGRFAIGKIEPLRDAGGNVIAYQVEIKH* |
| Ga0099830_110146161 | 3300009088 | Vadose Zone Soil | PPAQTPALENDLHNALQKSLPDLRYGRFAIAKIEAERDAQGTVIAYQVEIHR* |
| Ga0099830_110705941 | 3300009088 | Vadose Zone Soil | RTPQLQSDLHNALQKAQDELRNGRFSIAKIEPERDEHGTVVAYRVEISRK* |
| Ga0116225_15496931 | 3300009524 | Peatlands Soil | LHNALQKARPDLHDGRFSIGTIEPQRDEKGNVVAYEVTIRH* |
| Ga0116216_100389141 | 3300009698 | Peatlands Soil | LQKARPDLHDGRFSIGTIEPQRDEKGNVVAYEVTIRH* |
| Ga0126373_105234401 | 3300010048 | Tropical Forest Soil | LHNVLQKAGAGLQDGRFAIGKIEPLRDENGNVTAYQVEIKH* |
| Ga0074045_107260801 | 3300010341 | Bog Forest Soil | NALQKARPDLHDGRFSIVTIEPVRDEKGNVTAYEVTIHR* |
| Ga0074044_105214221 | 3300010343 | Bog Forest Soil | DLHNALQKARPDLHDGRFSIGTIEPQRDEKGNVVAYEVTIRH* |
| Ga0126376_129637501 | 3300010359 | Tropical Forest Soil | QTPALQNDLHNALQKALPALRNGRFSITKIEPVRDEQGTVGAYEVEIRH* |
| Ga0126383_110656181 | 3300010398 | Tropical Forest Soil | TPELQNDLHNALQRAGSGLQDGRFAIGKIEALRDEHGNVIAYQVEIKH* |
| Ga0153990_10273863 | 3300012169 | Attine Ant Fungus Gardens | PALQNELHQALQRALPDLRNGRFSITNIEAVRNEKGTVIAYEVEIRR* |
| Ga0137399_103049141 | 3300012203 | Vadose Zone Soil | DLHQALQRALPDLRNGRFSISNIEAVRDEKGTVIAYQVEIRR* |
| Ga0137360_112886322 | 3300012361 | Vadose Zone Soil | QRGLLDLRYRRFSITNIEAVRDDKRTVIAYQVEIRR* |
| Ga0137397_100482201 | 3300012685 | Vadose Zone Soil | TPALQNELHQALQRGLQDLRDGRFSITNIEAVRNEKGTVIAYQVEIHR* |
| Ga0137397_103210951 | 3300012685 | Vadose Zone Soil | TPALQNELHQALQRGLQDLRDGRFSITNIEAVRNEKGTVIAYQVEIRR* |
| Ga0137396_100716381 | 3300012918 | Vadose Zone Soil | QALQRRLQDLRDGRFSITKIEAVRNEKGTVIAYQVEIRR* |
| Ga0137394_101864513 | 3300012922 | Vadose Zone Soil | QALQRGLQDLRDGRFSITNIEAVRNEKGTVIAYQVEIRR* |
| Ga0137416_102508743 | 3300012927 | Vadose Zone Soil | ALQNDLHQALQRALPDLRNGRFSISNIEAVRDEKGTVIAYTVEIRR* |
| Ga0137404_107099222 | 3300012929 | Vadose Zone Soil | QTPALQNELHQALQRGLQDLRDGRFSITNIEAVRNEKGTVIAYQVEIRR* |
| Ga0137407_112827102 | 3300012930 | Vadose Zone Soil | HNVLQKAGPGLQDGRFAIGKIEPLRDASGNVIAYQVEIKH* |
| Ga0137410_105539562 | 3300012944 | Vadose Zone Soil | HQALQRGLQDLRDGRFSITNIEAVRNEKGTVIAYQVEIRR* |
| Ga0126369_117073441 | 3300012971 | Tropical Forest Soil | PPERTPELQNDLHNVLQKAGPGLQDGRFAIGKIEPLRDENGNVIAYQVEIKH* |
| Ga0167650_10186513 | 3300015203 | Glacier Forefield Soil | QNELHNALRKAQPKLGDGHFAIGKIQPIRDEAGNVVAYEVEIRH* |
| Ga0137409_109146491 | 3300015245 | Vadose Zone Soil | QNAGQGLQDGRFSIGKIEPLRDAGGNVIAYQVEIKH* |
| Ga0182033_103437872 | 3300016319 | Soil | LQNDLHNALQKSRTDLGDGRFSIGKIEAIRDAEGNVIAYQVEIHH |
| Ga0182033_106310301 | 3300016319 | Soil | LHNVLQKAGAGLQDGRFAIGKIEPLRDENGNVTAYQVEIKH |
| Ga0182035_103117681 | 3300016341 | Soil | RTPQLQNDLHNVLQKASHDLSDGRFAISRIEPVRDENGNVVAYQVRIRH |
| Ga0187802_102892362 | 3300017822 | Freshwater Sediment | RARPDLNDGHFSIGKIEPIRDAQGNVIAYEVEIHR |
| Ga0187801_100039111 | 3300017933 | Freshwater Sediment | NDLHNALQKSSPALHDGRFSIGRIEPIRSEDGTVIAYQVEISH |
| Ga0187785_101149011 | 3300017947 | Tropical Peatland | LHTALQKSRKDLSDGGFSIRKIEAIRDEQGNVIAYQVEIRH |
| Ga0187781_103216643 | 3300017972 | Tropical Peatland | LHNALQKSRPDLHDGRFSIGTIEAQRDEKGNVVAYEVTIRH |
| Ga0187780_106968691 | 3300017973 | Tropical Peatland | TPALQNDLHNALQKARPDLHDGRFSIGTIEPQRDEKANVVAYEVTIRH |
| Ga0187777_105528222 | 3300017974 | Tropical Peatland | HTVLQKSRKDLSDGGFSIRRIEAIRDEKGNVIAYDVEIRH |
| Ga0187822_102630602 | 3300017994 | Freshwater Sediment | ALSNDLHNALQKARLDLRDGRFSIGKIEAIRDEKGTVIAYQVEIRR |
| Ga0187816_102598601 | 3300017995 | Freshwater Sediment | ALQKARPDLHDGRFSIITIEPLRDEKGNVVAYEVTIRH |
| Ga0187815_102209631 | 3300018001 | Freshwater Sediment | PERTPALQNDLHNALQKSNPALNDGRFSIGKIEPIRDESGTVIAYQVEIRH |
| Ga0187804_102996511 | 3300018006 | Freshwater Sediment | MQQARPDLNDGHFSIGKIEAIRDAEGNVIAYQVEIHR |
| Ga0187804_104973492 | 3300018006 | Freshwater Sediment | LHNALQKARPDLHDGRFSIITIEPLRDEKGNVVAYEVTIRH |
| Ga0187869_103352682 | 3300018030 | Peatland | LQNDLHNALQKARPDLHDGRFSIVTIEPVRDEKGNVTAYEVTIHR |
| Ga0187862_105189291 | 3300018040 | Peatland | TARPDLHDGRFSIGTIEPQRDEKGNVVAYEVTIRH |
| Ga0187771_104920801 | 3300018088 | Tropical Peatland | NVMKKARPDLSDGRFSIGKIEAIRDAEGNVIAYRVEIHR |
| Ga0182028_10571981 | 3300019788 | Fen | DLLHNALQKARPDLHDGRFSIGTIEPQRDEKGNVVAYEVTIRH |
| Ga0179590_10048784 | 3300020140 | Vadose Zone Soil | PALQNELHQALQRRLQDLRDGRFSITKIEAVRNEKGTVIAYQVEIRR |
| Ga0179592_101263001 | 3300020199 | Vadose Zone Soil | QKAGPGLQDGRFAIGKIEPLRDASGNVIAYQVEIKH |
| Ga0179592_102520191 | 3300020199 | Vadose Zone Soil | TRTPALQNDLHNVLQHAGPGLQDGRFAIGKIEPVRDASGNVIAYQVEIKH |
| Ga0210399_100711311 | 3300020581 | Soil | EQTPALQNDLHNALKKALPDLRNGRFSIVRIEPVRDEAGTVIAYQVEIHR |
| Ga0210395_104973902 | 3300020582 | Soil | QTPALQNDLHNALKKALPDLGNGRFSITKIEPVRDEAGTVIAYQVEIHR |
| Ga0210395_106173682 | 3300020582 | Soil | LQNELHNALQKAGAGLQDGRFSIGKIEALRDAGGNVIAYQVEIKH |
| Ga0179596_103011551 | 3300021086 | Vadose Zone Soil | QNELHQALQRALPDLHNGRFSITNIEAVRDERGTVIAYEVEIHR |
| Ga0210393_111331411 | 3300021401 | Soil | QALRRALPDLRNGRFSITKIEAVRNADGTVIAYEVEIHR |
| Ga0210397_101076671 | 3300021403 | Soil | PALQNDLHSALQKAQPELNDGRFSIGNIEPIRDEKGNVVAYRVAIRH |
| Ga0210386_103922481 | 3300021406 | Soil | LQNDLHNALQNAGAGLQDGRFAIGKIEALRDASGKVIAYQVEIKH |
| Ga0210384_102329423 | 3300021432 | Soil | NELHQALQRALPDLHNGRFSIAKIEAVRDEGGTVIAYEVEIRR |
| Ga0210410_106493691 | 3300021479 | Soil | ELHNALQKAGAGLQDGRFSIGKIEALRDASGNVIAYQVEIKH |
| Ga0126371_134691272 | 3300021560 | Tropical Forest Soil | LQKASHDLSDGRFAISRIEPVRDENGNVVAYQVRIRH |
| Ga0247678_10271532 | 3300024325 | Soil | ALQNAGAGLQDGRFAIGKIEPVRDASGNVIAYQVEIKH |
| Ga0208323_10361831 | 3300025439 | Peatland | ERTPALQNDLHNALQKARPDLHDGRFSIGTIEPQRDEKGNVVAYEVTIRH |
| Ga0208478_10713371 | 3300025475 | Arctic Peat Soil | DLHNVLQKSLPELHDGRFSIGSIEAQRDDKGNVVAYQVEIRH |
| Ga0207700_111014472 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QNDLHSALQKAQPELNDGRFSIGNIEPIRDEKGNVVAYRVAIRH |
| Ga0207664_108980191 | 3300025929 | Agricultural Soil | ALQNDLHSALQKAQPELNDGRFSIGNIEPIRDEKVNVVAYRVAIRH |
| Ga0207665_106947352 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LQNELHQALRKALPDLRNVRFSIVNIDAVRDEEGTVIAYQVEISR |
| Ga0209240_11204562 | 3300026304 | Grasslands Soil | ALQRALPDLHNGRFSITNIEAVRDERGTVIAYEVEIHR |
| Ga0257153_10940711 | 3300026490 | Soil | ALQNDLHNVLQKAGQGLQDGRFAIGKIEPVRDAGGNVIAYQVEIKH |
| Ga0207760_1114581 | 3300026845 | Tropical Forest Soil | VLQKAGPDLSDGRFAISRIEPIRDENGNVVAYQVQIRH |
| Ga0207781_10183813 | 3300026890 | Tropical Forest Soil | DLHNALQKANPDLSDGRFAISRIEPVRDENGNVVAYQVQVRH |
| Ga0207817_10102613 | 3300026979 | Tropical Forest Soil | PERTPQLQNDLHNALQKANPDLSDGRFAISRIEPVRDENGNVVAYQVQVRH |
| Ga0209004_10822272 | 3300027376 | Forest Soil | LQKARSDLHDGRFAIGKIEAIRDETGTVIAYQVEIRH |
| Ga0209421_10363152 | 3300027432 | Forest Soil | LVRCTPSHNALQKASPTLNDGRFSIGKIEAIRDEKGNVVAYEVEIRH |
| Ga0209421_10452971 | 3300027432 | Forest Soil | LQNDLHNALQKASPTLNDGRFSIGKIEAIRDEKGNVVAYEVEIRH |
| Ga0209528_11295272 | 3300027610 | Forest Soil | EQAPALANDLHNALQRALPDLHNGHFSITRIVAVRDAEGTVVAYEVDIHR |
| Ga0209422_10487292 | 3300027629 | Forest Soil | NALQKAGAGLQDGRFSIGKIEALRDASGNVIAFQVEISH |
| Ga0208988_11712241 | 3300027633 | Forest Soil | ELHQALQRRLQDLRDGRFSITKIEAVRNEKGTVIAYQVEIHR |
| Ga0209736_10296743 | 3300027660 | Forest Soil | LQNELHNALQKAQPKLGDGHFAIGKIEAIRDEAGNVVAYEVQISH |
| Ga0209074_101487591 | 3300027787 | Agricultural Soil | APPERTPQLQNQLHGALQKTLPDLRGGRFEISKIEAVRDELGTVIAYQVTIRRK |
| Ga0209283_107823372 | 3300027875 | Vadose Zone Soil | GLQNDLHSALQKARPELNNGHFAIGTIEPLRDAEGNVIAYQVEIRH |
| Ga0209006_107497492 | 3300027908 | Forest Soil | MAPPEQTPALQNDLHNALQKALPDLRNGRFSITKIEPVRDEAGTVIAYQVEVHR |
| Ga0209698_106652991 | 3300027911 | Watersheds | HNALQKAGAGLQDGRFSIGKIEALRDASGNVIAYQVEIKH |
| Ga0222749_103320891 | 3300029636 | Soil | PERTPALQNDLHSALQKAQPELNDGRFSIGNLEPIRDEKGNVVAYRVAIRH |
| Ga0073994_122587112 | 3300030991 | Soil | PPEQTPALQNELHQALQRALPDLRNGRFSITKIEAVRDENGTVIAYQVEIRR |
| Ga0307468_1021830172 | 3300031740 | Hardwood Forest Soil | LHQALQRRLQDLRDGRFSITKIEAVRNEKGTVIAYEVEIRR |
| Ga0307468_1022958782 | 3300031740 | Hardwood Forest Soil | LRKALPDLRNVRFSITNIEPVRDEEGTVIAYQVEIRR |
| Ga0307475_105177091 | 3300031754 | Hardwood Forest Soil | LQNDLHNALKKALPELRNGRFSISKIEAVRDEAGTVIAYQVEIRR |
| Ga0307478_108310661 | 3300031823 | Hardwood Forest Soil | LQNELHQALRRALPDLRDGRFSITKIEAVRDEQGTVIAYEVEIHR |
| Ga0310917_109426581 | 3300031833 | Soil | LHNALQKANPDLSDGRFAISRIEPVRDENGNVVAYQVHVRH |
| Ga0318520_104382781 | 3300031897 | Soil | TPALQNELHNALQKAQPELNDGRFSIGKIEPLRDDKGNVVAYQVELRH |
| Ga0306923_122352541 | 3300031910 | Soil | HNVLQRASHDLSDGRFAISRIEPVRDENGNVVAYQVRIRH |
| Ga0306921_108042123 | 3300031912 | Soil | ERTPQLQNDLHNVLQKASHDLSDGRFAISRIEPVRDENGNVVAYQVRIRH |
| Ga0310913_109126332 | 3300031945 | Soil | RTPQLQNDLHNVLQRASHDLSDGRFAISRIEPVRDENGNVVAYQVRIRH |
| Ga0310911_107464472 | 3300032035 | Soil | PQLQNDLHNVLQKASHDLSDGRFAISRIEPVRDENGNVVAYQVRIRH |
| Ga0318524_106741921 | 3300032067 | Soil | SNLLHTALQKLSPDLRDGAFSIRRIEAIRDEKGNVIAYQVEIRH |
| Ga0306924_125669491 | 3300032076 | Soil | QLQNDLHNALQKANPDLGDGRFAISRIEALRDESGNVVAYRVDIRH |
| Ga0318540_104504661 | 3300032094 | Soil | NALQKANPDLSDGRFAISRIEPVRDENGNVVAYQVHVRH |
| Ga0318540_105090302 | 3300032094 | Soil | PELQNDLHNALQKAGSGLQDGRFAIGKIEALRDEQGNVIAYQVEIKH |
| Ga0307472_1004619061 | 3300032205 | Hardwood Forest Soil | DLHSALQKAQPELNDGRFSIGNIEPIRDEKGNVVAYRVAIRH |
| Ga0306920_1008162103 | 3300032261 | Soil | RTPELQNDLHNALQKAGSGLQDGRFAIGKIEALRDEQGNVIAYQVEIKH |
| Ga0335079_100357891 | 3300032783 | Soil | KSLPELNHARFEILKIEPQRNDQGNVVAYQVTIRKK |
| Ga0310914_104133123 | 3300033289 | Soil | QKAQPELNDGRFSIGKIEPLRDDKGNVVAYQVELRH |
| Ga0326727_103369963 | 3300033405 | Peat Soil | ALQKTSTALRDGRFSIGKIEPIRDESGTVIAYEVEIRH |
| Ga0326724_0532826_459_584 | 3300034091 | Peat Soil | LHNALQKARPDLHDGRFSIGTIEPQRDEKGNVVAYEVTIRH |
| ⦗Top⦘ |