| Basic Information | |
|---|---|
| Family ID | F080353 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 39 residues |
| Representative Sequence | ELDLDGEMAACARLVAARARPAPAVLADDRTDLWSLVRR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 99.13 % |
| % of genes from short scaffolds (< 2000 bps) | 93.91 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.261 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.565 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.826 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.087 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 78.26 |
| PF13439 | Glyco_transf_4 | 4.35 |
| PF01810 | LysE | 2.61 |
| PF01242 | PTPS | 1.74 |
| PF00534 | Glycos_transf_1 | 1.74 |
| PF03176 | MMPL | 1.74 |
| PF13551 | HTH_29 | 0.87 |
| PF13459 | Fer4_15 | 0.87 |
| PF08659 | KR | 0.87 |
| PF13565 | HTH_32 | 0.87 |
| PF00456 | Transketolase_N | 0.87 |
| PF01227 | GTP_cyclohydroI | 0.87 |
| PF14759 | Reductase_C | 0.87 |
| PF00440 | TetR_N | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.74 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.74 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.74 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.26 % |
| Unclassified | root | N/A | 1.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10238071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 732 | Open in IMG/M |
| 3300004635|Ga0062388_102003631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300005332|Ga0066388_105885223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300005459|Ga0068867_100981090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 765 | Open in IMG/M |
| 3300005471|Ga0070698_101552433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
| 3300005554|Ga0066661_10545611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
| 3300005558|Ga0066698_10878453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300005591|Ga0070761_11084585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300005764|Ga0066903_102005091 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300005764|Ga0066903_103019504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 911 | Open in IMG/M |
| 3300005764|Ga0066903_103806014 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005841|Ga0068863_101578550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
| 3300005844|Ga0068862_102526526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
| 3300006028|Ga0070717_10795555 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300006052|Ga0075029_100945242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
| 3300006059|Ga0075017_100342667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1111 | Open in IMG/M |
| 3300006174|Ga0075014_100235413 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006175|Ga0070712_100856569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 782 | Open in IMG/M |
| 3300006791|Ga0066653_10690422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300006904|Ga0075424_102517253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300009089|Ga0099828_10050143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3462 | Open in IMG/M |
| 3300009521|Ga0116222_1216748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
| 3300009545|Ga0105237_11422292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
| 3300009824|Ga0116219_10081925 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300010046|Ga0126384_12313696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
| 3300010048|Ga0126373_12407806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300010048|Ga0126373_12519450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
| 3300010341|Ga0074045_10253830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1162 | Open in IMG/M |
| 3300010358|Ga0126370_11070901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum → Ferrimicrobium acidiphilum DSM 19497 | 741 | Open in IMG/M |
| 3300010358|Ga0126370_11243802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
| 3300010360|Ga0126372_11800004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
| 3300010376|Ga0126381_103153351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
| 3300010376|Ga0126381_104821989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300010396|Ga0134126_11726956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
| 3300010400|Ga0134122_13154355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300011119|Ga0105246_11558942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
| 3300011271|Ga0137393_10127041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2109 | Open in IMG/M |
| 3300011271|Ga0137393_10393511 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300012198|Ga0137364_10864390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
| 3300012208|Ga0137376_10806164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 808 | Open in IMG/M |
| 3300012356|Ga0137371_10298603 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300012356|Ga0137371_11443544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300012359|Ga0137385_11105521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
| 3300012361|Ga0137360_11805762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300012912|Ga0157306_10484683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
| 3300012923|Ga0137359_11262352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300012957|Ga0164303_11418931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300012989|Ga0164305_11382122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 619 | Open in IMG/M |
| 3300015374|Ga0132255_102934285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
| 3300016270|Ga0182036_10921085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 717 | Open in IMG/M |
| 3300016270|Ga0182036_11444491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300017972|Ga0187781_10647932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 762 | Open in IMG/M |
| 3300018060|Ga0187765_10268879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1011 | Open in IMG/M |
| 3300018085|Ga0187772_10574066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
| 3300020581|Ga0210399_11341913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300021170|Ga0210400_10648055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 870 | Open in IMG/M |
| 3300021180|Ga0210396_10711728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 867 | Open in IMG/M |
| 3300021377|Ga0213874_10211104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 702 | Open in IMG/M |
| 3300021403|Ga0210397_10441750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 978 | Open in IMG/M |
| 3300021405|Ga0210387_11354883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300021432|Ga0210384_11839721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300021445|Ga0182009_10349772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 755 | Open in IMG/M |
| 3300021560|Ga0126371_13444046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300022724|Ga0242665_10243746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 609 | Open in IMG/M |
| 3300025625|Ga0208219_1058371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 939 | Open in IMG/M |
| 3300025915|Ga0207693_10335988 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300025922|Ga0207646_10620572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 970 | Open in IMG/M |
| 3300025931|Ga0207644_10722313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 831 | Open in IMG/M |
| 3300025941|Ga0207711_10832399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 859 | Open in IMG/M |
| 3300026306|Ga0209468_1191120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300026356|Ga0257150_1053482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300027173|Ga0208097_1008390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 1105 | Open in IMG/M |
| 3300027795|Ga0209139_10275745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
| 3300027817|Ga0209112_10324689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300027875|Ga0209283_10367811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 941 | Open in IMG/M |
| 3300028379|Ga0268266_10041840 | All Organisms → cellular organisms → Bacteria | 3912 | Open in IMG/M |
| 3300028784|Ga0307282_10498423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300028906|Ga0308309_10052551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2947 | Open in IMG/M |
| 3300028906|Ga0308309_11340381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300030706|Ga0310039_10216878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 748 | Open in IMG/M |
| 3300031543|Ga0318516_10502898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
| 3300031546|Ga0318538_10471991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 680 | Open in IMG/M |
| 3300031549|Ga0318571_10150933 | Not Available | 803 | Open in IMG/M |
| 3300031572|Ga0318515_10363200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 776 | Open in IMG/M |
| 3300031640|Ga0318555_10766653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
| 3300031679|Ga0318561_10495826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 672 | Open in IMG/M |
| 3300031719|Ga0306917_10417142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Ea1.12 | 1049 | Open in IMG/M |
| 3300031751|Ga0318494_10176626 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300031779|Ga0318566_10083312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 1557 | Open in IMG/M |
| 3300031781|Ga0318547_11019672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300031782|Ga0318552_10051905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 1945 | Open in IMG/M |
| 3300031792|Ga0318529_10116789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinoalloteichus | 1213 | Open in IMG/M |
| 3300031793|Ga0318548_10504741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300031796|Ga0318576_10476749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300031797|Ga0318550_10627706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300031805|Ga0318497_10316084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 871 | Open in IMG/M |
| 3300031890|Ga0306925_10244205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 1935 | Open in IMG/M |
| 3300031897|Ga0318520_10097877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 1642 | Open in IMG/M |
| 3300031897|Ga0318520_10520760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300032009|Ga0318563_10583264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300032035|Ga0310911_10194941 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300032039|Ga0318559_10512662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
| 3300032052|Ga0318506_10445997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300032063|Ga0318504_10024203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2341 | Open in IMG/M |
| 3300032063|Ga0318504_10056299 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300032068|Ga0318553_10399462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
| 3300032076|Ga0306924_10088480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3483 | Open in IMG/M |
| 3300032089|Ga0318525_10022257 | All Organisms → cellular organisms → Bacteria | 3020 | Open in IMG/M |
| 3300032261|Ga0306920_103522891 | Not Available | 578 | Open in IMG/M |
| 3300032897|Ga0335071_11311411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
| 3300032898|Ga0335072_11023182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 755 | Open in IMG/M |
| 3300032898|Ga0335072_11314906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300033134|Ga0335073_10306770 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
| 3300033134|Ga0335073_10852692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 968 | Open in IMG/M |
| 3300033289|Ga0310914_10694974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 913 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.87% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_102380712 | 3300001867 | Forest Soil | ELDLDGEMAACARLVAARARPAPAVLADDRADLWSLA* |
| Ga0062388_1020036312 | 3300004635 | Bog Forest Soil | DPELDLDGEMAACGRLVSERAQPAPAVLADDRTDLWSLARR* |
| Ga0066388_1058852231 | 3300005332 | Tropical Forest Soil | ELDLDGEMAACARLVSARARAAPGVLANERTDLWSLALKAGS* |
| Ga0068867_1009810902 | 3300005459 | Miscanthus Rhizosphere | GDPELDHDSEMAACVRLVAARARPARGVLADEHTDLWSLA* |
| Ga0070698_1015524332 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LHGEMAACARMVAARARPAPAVLADDRTDLWSLAGGEASS* |
| Ga0066661_105456112 | 3300005554 | Soil | DLDGEMAAAARLVSTRARPSPAVLADDQTDLWSLTS* |
| Ga0066698_108784532 | 3300005558 | Soil | LDGEMAACARLVSARARPAPAVLADDRTDLWSLS* |
| Ga0070761_110845852 | 3300005591 | Soil | DGEMAACARLVSARARPAPAVLADDRTDLWSLARG* |
| Ga0066903_1020050913 | 3300005764 | Tropical Forest Soil | DSEMAACARLVSARARPDPAALADERTDLRSLAVP* |
| Ga0066903_1030195042 | 3300005764 | Tropical Forest Soil | DSEMAACARLVSARARLDPQTLGDERASLWSLGGADTPP* |
| Ga0066903_1038060142 | 3300005764 | Tropical Forest Soil | GDPEFDTDGEMAACARLVGESAHPEPARLADDAVDLWSLLGD* |
| Ga0068863_1015785501 | 3300005841 | Switchgrass Rhizosphere | ELDADGEMAACAQLVGRRARPASAALADEAVDLWSLAG* |
| Ga0068862_1025265261 | 3300005844 | Switchgrass Rhizosphere | GDPELDLDSEMAACARLVSAQARLAPAVLADDRTDLWSLVRP* |
| Ga0070717_107955552 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ELDVDGEMAACARLVSARSRPDPAVLADERTDLWSLAAG* |
| Ga0075029_1009452421 | 3300006052 | Watersheds | ELDTDGEMAACGRLVSMQARPTPAVLSDEKTDLWSLARP* |
| Ga0075017_1003426671 | 3300006059 | Watersheds | PELDTDSEMAACARLVAARARPAPGQLADERVDLWSLVR* |
| Ga0075014_1002354131 | 3300006174 | Watersheds | DGEMAACARLVAVQARPAPGVLADEHTDLWSLAVQ* |
| Ga0070712_1008565691 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DGEMAACARLVSARVRAAPGVLADDRTDLWSLAPKPGS* |
| Ga0066653_106904222 | 3300006791 | Soil | GDPEQDTDQEMAACARLVAKQARPAGGQLADERVDLWSLAG* |
| Ga0075424_1025172532 | 3300006904 | Populus Rhizosphere | DGEMAACARLVSVQARPAPAVLADDRTDLWSLARAGASP* |
| Ga0099828_100501431 | 3300009089 | Vadose Zone Soil | DPELDLDGEMAACARLVAVRACPAPGVLSDERTDLWSLGQG* |
| Ga0116222_12167481 | 3300009521 | Peatlands Soil | LDGEMAACARLVAARARSAPATLSDDHTDLWSLAGAKASDS* |
| Ga0105237_114222922 | 3300009545 | Corn Rhizosphere | LGGEMAACVRLVSARARVAPGVLADDRADLWSLALKPGS* |
| Ga0116219_100819253 | 3300009824 | Peatlands Soil | DGEMAACARLVSEQARPAPGVLADDRTDLWSLARR* |
| Ga0126384_123136962 | 3300010046 | Tropical Forest Soil | GDPELDRDSEMAACVRLVAARARPARGVLADEHTDLWSLA* |
| Ga0126373_124078062 | 3300010048 | Tropical Forest Soil | PELDQDSEMAACARLVARRAKPARGVLSDEQADLWSLGS* |
| Ga0126373_125194501 | 3300010048 | Tropical Forest Soil | DPELDLDGEMAACARLVSARARAAPGVLADDRTDLWSLALKAGS* |
| Ga0074045_102538303 | 3300010341 | Bog Forest Soil | DGEMAACARLVAVRARPAPGVLADEHTDLWSLAPSS* |
| Ga0126370_110709011 | 3300010358 | Tropical Forest Soil | DGEMAACARLVASRARPTAARLADDRADLWSLIGQHGEG* |
| Ga0126370_112438022 | 3300010358 | Tropical Forest Soil | DPELDLDGEMAACARLVAAQARPAADVLADDRSDLWSLAQR* |
| Ga0126372_118000042 | 3300010360 | Tropical Forest Soil | GEMAACARLVAARARPAANVLADDRRDLWSLAQR* |
| Ga0126381_1031533512 | 3300010376 | Tropical Forest Soil | GEMAACARLVSVQARPAPAVLSDERTDLWSLAGSGAPS* |
| Ga0126381_1048219891 | 3300010376 | Tropical Forest Soil | DPELDLDGEMAACARLVAARARPAADVLADDRSDLWSLA* |
| Ga0134126_117269562 | 3300010396 | Terrestrial Soil | DSEMAACARLVAERARAAPAVLADDRTDLWSLADAEAPS* |
| Ga0134122_131543552 | 3300010400 | Terrestrial Soil | GDPELDEDSEMAACARLVGAQARPEAAQLADEGVDLWSLPA* |
| Ga0105246_115589422 | 3300011119 | Miscanthus Rhizosphere | EDGEMAACARMVAQRATPTAAQLVDENTDLWSLVER* |
| Ga0137393_101270412 | 3300011271 | Vadose Zone Soil | ELDLDGEMAACARLVARRARPARRMLADEQADLWSLC* |
| Ga0137393_103935113 | 3300011271 | Vadose Zone Soil | DLDSEMAACARLVAQRIRPAPGRLADERVDLWSLAT* |
| Ga0137364_108643901 | 3300012198 | Vadose Zone Soil | SEMAACTRLVAARARPARGVLADEHADLWSLVTH* |
| Ga0137376_108061642 | 3300012208 | Vadose Zone Soil | MAACTRLVAARARPARGVLADEHADLWSLANDGRA* |
| Ga0137371_102986031 | 3300012356 | Vadose Zone Soil | LDLDGEMAACARLVSARARPAPAVLADDRTDLWSLS* |
| Ga0137371_114435442 | 3300012356 | Vadose Zone Soil | GEMAACARLVSARARPAPAVLADDRTDLWSLADAEASS* |
| Ga0137385_111055212 | 3300012359 | Vadose Zone Soil | DLDGEMAACAPLVAARARTAPAVLADDRTDLWSLARR* |
| Ga0137360_118057622 | 3300012361 | Vadose Zone Soil | DLGGEMAACACLVAARARPAPAVLADDRTDLWSLTGR* |
| Ga0157306_104846831 | 3300012912 | Soil | TDGEMAACARLVASRARPDTGQLADEDVDLWSLAQ* |
| Ga0137359_112623521 | 3300012923 | Vadose Zone Soil | PELDADQEMAACARLVAARARPAGAQLADERVDLWSLAG* |
| Ga0164303_114189312 | 3300012957 | Soil | DPEADPDSEMAACARLVAMQARPAGDQLADEGVDLWSLGQ* |
| Ga0164305_113821221 | 3300012989 | Soil | TDGEMAACAQLVGRRARPASAALADEAVDLWSLAG* |
| Ga0132255_1029342851 | 3300015374 | Arabidopsis Rhizosphere | DEDGEMAACARLVAQQAAPAPARLADDDVDLWSLVR* |
| Ga0182036_109210851 | 3300016270 | Soil | DSEMAACARLVSARARPAPAVLADERTDLWSLSRR |
| Ga0182036_114444911 | 3300016270 | Soil | PELDLDDEMAACVHLVSARARPAPAVLADDRTDLWALGRR |
| Ga0187781_106479321 | 3300017972 | Tropical Peatland | DPELDLDGEMAAAARLVAARARPAPALLADDRTDLWSL |
| Ga0187765_102688791 | 3300018060 | Tropical Peatland | ELDLDGEMAACARLVAARARPAPAVLADDRTDLWSLVRR |
| Ga0187772_105740662 | 3300018085 | Tropical Peatland | DLDGEMAACARLVSARARPAPAVLADDRTDLAGLGG |
| Ga0210399_113419132 | 3300020581 | Soil | DGEMAACARLVAARARPAAAVLADDRTDLRSLGQT |
| Ga0210400_106480551 | 3300021170 | Soil | DGEMAACARLVSARARPDPTVLADDSTDLWSLLAG |
| Ga0210396_107117281 | 3300021180 | Soil | GGDPELDLDGEMAAAARLVSTRARPSPAVLADDRTDLWSLTS |
| Ga0213874_102111042 | 3300021377 | Plant Roots | LDLDGEMAACARLISEQAGPARAVLADEHTDLWSLGRS |
| Ga0210397_104417501 | 3300021403 | Soil | PELDLDGEMAAAGRLVAGRARPARDRLADEQTDLWSLPASA |
| Ga0210387_113548832 | 3300021405 | Soil | LDGEMAACGRLVSEQARPAPAVLADDRTDLWSLARR |
| Ga0210384_118397211 | 3300021432 | Soil | ELDLDGEMAACASLVSARARPAPAALASDRTDLWSLAQP |
| Ga0182009_103497722 | 3300021445 | Soil | PELDHDSEMAACTRLVAARARPAHGVLADEHTDLWSLA |
| Ga0126371_134440461 | 3300021560 | Tropical Forest Soil | VDKDGEMAACARLVAARAKPTPAMLADDSIDLWDLGGR |
| Ga0242665_102437461 | 3300022724 | Soil | GDPELDLDGEMAAAARLVSTQARPSPAVLADDRTDLWSLTS |
| Ga0208219_10583712 | 3300025625 | Arctic Peat Soil | KLDRDSEMAASARLVAGRARPARGVLADERTNLWSLPVTG |
| Ga0207693_103359883 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DGEMAACARLVSARVRAAPGVLADDRTDLWSLAPKPGS |
| Ga0207646_106205721 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DPELDRDSEMAACARLVAVRARPARGLLADEHADLWSLAYGA |
| Ga0207644_107223131 | 3300025931 | Switchgrass Rhizosphere | GDPELDADGEMAACAQLVGRRARPAPAALADEAVDLWSLAG |
| Ga0207711_108323992 | 3300025941 | Switchgrass Rhizosphere | LDLDSEMAACARLVSAQARLAPAVLADDRTDLWSLVRP |
| Ga0209468_11911202 | 3300026306 | Soil | QDTDQEMAACARLVAKQARPAGGQLADERVDLWSLAG |
| Ga0257150_10534822 | 3300026356 | Soil | GGDPELDLDGEMAACGRLVSERARPAPAVLADDRTDLWSLARR |
| Ga0208097_10083904 | 3300027173 | Forest Soil | DPELDLDGEMAACARLVAVSARPAPGVLADEHTDLWSLSTTG |
| Ga0209139_102757452 | 3300027795 | Bog Forest Soil | DPEADSDSEMAACAKLVAIRAHPPASQLADDSVDLWSLAV |
| Ga0209112_103246891 | 3300027817 | Forest Soil | DLDGEMAACARLVAAQARPAPAVLADERTDLWSLGQR |
| Ga0209283_103678111 | 3300027875 | Vadose Zone Soil | DPELDLDGEMAACARLVAVRACPAPGVLSDERTDLWSLGQG |
| Ga0268266_100418401 | 3300028379 | Switchgrass Rhizosphere | DLDSEMAACARLVSAQARLAPAVLADDRTDLWSLVRP |
| Ga0307282_104984232 | 3300028784 | Soil | ELDRESEMAACAHLVAARARPARGVLADEHTDLWSLA |
| Ga0308309_100525514 | 3300028906 | Soil | GDPELDLDGEMAACSRLVAARAHPAPAVLADERTDLWSLTRG |
| Ga0308309_113403811 | 3300028906 | Soil | DPELDLDGEMAACSRLVAARARPAPAVLADERTDLWSLTRENNGS |
| Ga0310039_102168781 | 3300030706 | Peatlands Soil | DGEMAACARLVSEQARPAPGVLADDRTDLWSLARR |
| Ga0318516_105028982 | 3300031543 | Soil | LDLDGEMAACACLVSARARVAPGVLADDGTDLWSLARR |
| Ga0318538_104719911 | 3300031546 | Soil | AACARLVAARARPAAAALADERTDLWSLADAEAPP |
| Ga0318571_101509331 | 3300031549 | Soil | GDPELDLDSEMAACARLVSQRARLAPAALADDRTDLWSLG |
| Ga0318515_103632002 | 3300031572 | Soil | LDLDGEMAACARLVAARARPAPAVLADDSTDLWSLVRR |
| Ga0318555_107666531 | 3300031640 | Soil | PELDLDGEMAACARLVSARARPAPSVLADDRTDLWSLARA |
| Ga0318561_104958262 | 3300031679 | Soil | GDPELDLDGEMAASARLVSARARPAPAVLADEHTDLWSLGRR |
| Ga0306917_104171421 | 3300031719 | Soil | ELDLDDEMAACARLVSARAQAAPAVLADDRTDLWSLAPS |
| Ga0318494_101766263 | 3300031751 | Soil | ELDLDSEMAACARLVAARARPAAAALADERTDLWSLADAEAPP |
| Ga0318566_100833123 | 3300031779 | Soil | DPELDADSEMAACARLVAARARPAAAALADERTDLWSLADAEAPP |
| Ga0318547_110196721 | 3300031781 | Soil | PELDLDDEMAACGRLVSVRARPAPAMLADDRTDLWSLALTAGS |
| Ga0318552_100519051 | 3300031782 | Soil | ELDADSEMAACARLVAARARPAAAALADERTDLWSLADAEAPP |
| Ga0318529_101167893 | 3300031792 | Soil | ELDLDGEMAASARLVAARARPAPGVLADERADLWTLTRSL |
| Ga0318548_105047412 | 3300031793 | Soil | DPELDLDGEMAACACLVSARARVAPGVLADDGTDLWSLARR |
| Ga0318576_104767491 | 3300031796 | Soil | EMAASARLVAARARPAPAVLADDRTDLWSLAGAEAP |
| Ga0318550_106277061 | 3300031797 | Soil | DPELDLDGEMAACARLVAARARPAADVLADDRSDLWSLAQR |
| Ga0318497_103160842 | 3300031805 | Soil | LDTDSEMAACARLVGERAQPEPERLADEAADLWSLLG |
| Ga0306925_102442051 | 3300031890 | Soil | LDADSEMAACARLVAARARPAAAALADERTDLWSLADAEAPP |
| Ga0318520_100978771 | 3300031897 | Soil | DSEMAACARLVAARARPAAAALADERTDLWSLADAEAPP |
| Ga0318520_105207602 | 3300031897 | Soil | GDPELDLDSEMAACARLVSQRARLAPAVLADDRTDLWSLG |
| Ga0318563_105832641 | 3300032009 | Soil | DLDGEMAASASLVSAQARPAPAALADDRTDLWSLGHR |
| Ga0310911_101949413 | 3300032035 | Soil | DLDGEMAACARLVSARARAAPAVLADDRTDLWSLASKAGS |
| Ga0318559_105126622 | 3300032039 | Soil | GGDPELDLDGEMAACARLVAARARPAPGVLADDRTDLGGLVG |
| Ga0318506_104459971 | 3300032052 | Soil | DLDGEMAACAGLVSARARVAPAVLADDRTDLWSLGV |
| Ga0318504_100242034 | 3300032063 | Soil | DLDGEMAACARLVAARARPAPGVLADDRTDLGGLVG |
| Ga0318504_100562993 | 3300032063 | Soil | DLDGEMAACAGLVAAQARPAPALLSDESTDLRSLS |
| Ga0318553_103994621 | 3300032068 | Soil | LDLDGEMAACARLVAARARPAADVLADDRSDLWSLAQR |
| Ga0306924_100884806 | 3300032076 | Soil | ELATDGEMAAAASLVAARARPAPAALADDGTNLWSLGQR |
| Ga0318525_100222571 | 3300032089 | Soil | SEMAACARLVAARARPAAAALADERTDLWSLADAEAPP |
| Ga0306920_1035228911 | 3300032261 | Soil | GDPELDTDSEMAAGARLVATRARPAPGALADERTDLWSLVHDA |
| Ga0335071_113114113 | 3300032897 | Soil | LDLDSEMAACARLVSAQARPAPAVLEDERTDLWSLSRG |
| Ga0335072_110231822 | 3300032898 | Soil | DRDSEMAACTRLVAARARPAPGVLADENTDLWSLA |
| Ga0335072_113149061 | 3300032898 | Soil | PELDTDGEMAVCARLVSARARPAPAVLADEHTDLWSLS |
| Ga0335073_103067701 | 3300033134 | Soil | LDGEMAASARLVAAQARPAPAVLADEHTDLWSLTRAGTSS |
| Ga0335073_108526922 | 3300033134 | Soil | LDLDGELAACARLVAAQARPAPAVLADDRTDLWSLARG |
| Ga0310914_106949743 | 3300033289 | Soil | DPELDLDGEMAASARLVAARARPAPGVLADERADLWTLTRSL |
| ⦗Top⦘ |