| Basic Information | |
|---|---|
| Family ID | F080315 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MPNDEHVAMLARGAAAWNEWRADRDETPDLSRAGLRGL |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.78 % |
| % of genes near scaffold ends (potentially truncated) | 98.26 % |
| % of genes from short scaffolds (< 2000 bps) | 90.43 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.435 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.391 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.913 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.652 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00805 | Pentapeptide | 87.83 |
| PF00111 | Fer2 | 1.74 |
| PF07505 | DUF5131 | 0.87 |
| PF00106 | adh_short | 0.87 |
| PF07690 | MFS_1 | 0.87 |
| PF00496 | SBP_bac_5 | 0.87 |
| PF00296 | Bac_luciferase | 0.87 |
| PF01527 | HTH_Tnp_1 | 0.87 |
| PF00166 | Cpn10 | 0.87 |
| PF01850 | PIN | 0.87 |
| PF13817 | DDE_Tnp_IS66_C | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 87.83 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.87 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.43 % |
| Unclassified | root | N/A | 29.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_107989729 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300004082|Ga0062384_100269830 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300004092|Ga0062389_101882648 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300005332|Ga0066388_105869141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300005555|Ga0066692_10963724 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300006046|Ga0066652_101919604 | Not Available | 530 | Open in IMG/M |
| 3300006175|Ga0070712_100530712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 990 | Open in IMG/M |
| 3300006175|Ga0070712_100792673 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300006175|Ga0070712_101280477 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300007265|Ga0099794_10280626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300009088|Ga0099830_11465031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300009089|Ga0099828_11363040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300009137|Ga0066709_102871045 | Not Available | 637 | Open in IMG/M |
| 3300009143|Ga0099792_10249928 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300010048|Ga0126373_10559580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1192 | Open in IMG/M |
| 3300010358|Ga0126370_12336092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300010359|Ga0126376_10194725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1673 | Open in IMG/M |
| 3300010359|Ga0126376_13218363 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010361|Ga0126378_11046847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300010376|Ga0126381_100776170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1375 | Open in IMG/M |
| 3300010376|Ga0126381_102871106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300010376|Ga0126381_104287449 | Not Available | 552 | Open in IMG/M |
| 3300010398|Ga0126383_12359846 | Not Available | 617 | Open in IMG/M |
| 3300011120|Ga0150983_10569356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300011271|Ga0137393_11710047 | Not Available | 518 | Open in IMG/M |
| 3300012582|Ga0137358_10368762 | Not Available | 972 | Open in IMG/M |
| 3300012685|Ga0137397_10830357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300012922|Ga0137394_10352616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1256 | Open in IMG/M |
| 3300012923|Ga0137359_11292544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300012927|Ga0137416_12208579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300012971|Ga0126369_10651010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1128 | Open in IMG/M |
| 3300012984|Ga0164309_11571375 | Not Available | 563 | Open in IMG/M |
| 3300016341|Ga0182035_10214543 | Not Available | 1532 | Open in IMG/M |
| 3300016341|Ga0182035_11780659 | Not Available | 557 | Open in IMG/M |
| 3300016371|Ga0182034_10029544 | All Organisms → cellular organisms → Bacteria | 3403 | Open in IMG/M |
| 3300016422|Ga0182039_10888258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300016445|Ga0182038_10808296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300020579|Ga0210407_10847545 | Not Available | 703 | Open in IMG/M |
| 3300020580|Ga0210403_10610169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300020580|Ga0210403_11028143 | Not Available | 643 | Open in IMG/M |
| 3300020582|Ga0210395_10969784 | Not Available | 630 | Open in IMG/M |
| 3300021088|Ga0210404_10292310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300021168|Ga0210406_10875456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300021178|Ga0210408_11231941 | Not Available | 570 | Open in IMG/M |
| 3300021180|Ga0210396_11009551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300021403|Ga0210397_11124994 | Not Available | 610 | Open in IMG/M |
| 3300021405|Ga0210387_10766516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300021405|Ga0210387_10929019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300021406|Ga0210386_11259918 | Not Available | 624 | Open in IMG/M |
| 3300021432|Ga0210384_11625844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300021478|Ga0210402_10384080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300021479|Ga0210410_11739313 | Not Available | 517 | Open in IMG/M |
| 3300021560|Ga0126371_13857809 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021560|Ga0126371_13943912 | Not Available | 500 | Open in IMG/M |
| 3300022724|Ga0242665_10117362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300025898|Ga0207692_10196607 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300025898|Ga0207692_11113743 | Not Available | 523 | Open in IMG/M |
| 3300025906|Ga0207699_11112390 | Not Available | 585 | Open in IMG/M |
| 3300025910|Ga0207684_10693021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300025915|Ga0207693_10534303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 915 | Open in IMG/M |
| 3300025939|Ga0207665_10030378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3569 | Open in IMG/M |
| 3300026547|Ga0209156_10130865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1225 | Open in IMG/M |
| 3300026547|Ga0209156_10476817 | Not Available | 515 | Open in IMG/M |
| 3300026551|Ga0209648_10221776 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300026557|Ga0179587_10516449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300027537|Ga0209419_1099213 | Not Available | 580 | Open in IMG/M |
| 3300027674|Ga0209118_1185561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300027684|Ga0209626_1172592 | Not Available | 573 | Open in IMG/M |
| 3300027737|Ga0209038_10008690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2985 | Open in IMG/M |
| 3300027829|Ga0209773_10467429 | Not Available | 520 | Open in IMG/M |
| 3300027884|Ga0209275_10319369 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300028906|Ga0308309_10828832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300028906|Ga0308309_11009464 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300028906|Ga0308309_11236746 | Not Available | 643 | Open in IMG/M |
| 3300029636|Ga0222749_10554756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300031231|Ga0170824_109247236 | All Organisms → cellular organisms → Bacteria | 3469 | Open in IMG/M |
| 3300031561|Ga0318528_10088611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1612 | Open in IMG/M |
| 3300031640|Ga0318555_10049380 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
| 3300031679|Ga0318561_10052572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2043 | Open in IMG/M |
| 3300031680|Ga0318574_10345167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 868 | Open in IMG/M |
| 3300031708|Ga0310686_116619851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300031719|Ga0306917_10056986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2654 | Open in IMG/M |
| 3300031744|Ga0306918_10266103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1312 | Open in IMG/M |
| 3300031747|Ga0318502_10774570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300031748|Ga0318492_10184670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300031754|Ga0307475_10285272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1325 | Open in IMG/M |
| 3300031768|Ga0318509_10863187 | Not Available | 500 | Open in IMG/M |
| 3300031769|Ga0318526_10247241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300031780|Ga0318508_1136970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300031781|Ga0318547_10603294 | Not Available | 681 | Open in IMG/M |
| 3300031781|Ga0318547_10890727 | Not Available | 555 | Open in IMG/M |
| 3300031792|Ga0318529_10229691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 862 | Open in IMG/M |
| 3300031796|Ga0318576_10501692 | Not Available | 572 | Open in IMG/M |
| 3300031798|Ga0318523_10347784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300031823|Ga0307478_11288411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300031859|Ga0318527_10015506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2618 | Open in IMG/M |
| 3300031890|Ga0306925_10956580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300031890|Ga0306925_11314135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300031890|Ga0306925_11580653 | Not Available | 638 | Open in IMG/M |
| 3300031897|Ga0318520_10967200 | Not Available | 537 | Open in IMG/M |
| 3300031910|Ga0306923_10563794 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300031941|Ga0310912_10605278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300031947|Ga0310909_10034570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3778 | Open in IMG/M |
| 3300031981|Ga0318531_10008400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3770 | Open in IMG/M |
| 3300032001|Ga0306922_11862427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300032010|Ga0318569_10164648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1024 | Open in IMG/M |
| 3300032043|Ga0318556_10428420 | Not Available | 692 | Open in IMG/M |
| 3300032043|Ga0318556_10644497 | Not Available | 552 | Open in IMG/M |
| 3300032051|Ga0318532_10162355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300032055|Ga0318575_10421003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300032076|Ga0306924_10351761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1689 | Open in IMG/M |
| 3300032089|Ga0318525_10064895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1828 | Open in IMG/M |
| 3300032094|Ga0318540_10441504 | Not Available | 629 | Open in IMG/M |
| 3300032174|Ga0307470_11439258 | Not Available | 570 | Open in IMG/M |
| 3300032180|Ga0307471_101817037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1079897291 | 3300000955 | Soil | MTKDEYVAALGRGAASWNAWRAEHDEVPDLSSAALRGLDR |
| Ga0062384_1002698301 | 3300004082 | Bog Forest Soil | MPKDEHVAMLGRGAAAWNAWRAENDETPDLSRAGLRGLDLSGF |
| Ga0062389_1018826482 | 3300004092 | Bog Forest Soil | MPKDEHVAVLGRGAAAWNAWRVENDETPDLSRAALRGLDLS |
| Ga0066388_1058691412 | 3300005332 | Tropical Forest Soil | MPKDELVALLGQGAAAWNAWRAAHDETPDLSRTGFRGLNLN |
| Ga0066692_109637241 | 3300005555 | Soil | MLARGAAVWNEWRATHDEMPNLSRAGLRGIDLSGFDLSRTDLRDA |
| Ga0066652_1019196041 | 3300006046 | Soil | MKDEYVGLLGRGFGTWNAWRAEHDEVPDLSSANLRALDLSGFDLS |
| Ga0070712_1005307121 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDEHVARLGHGAAAWDEWRAKLDETPDLSRAGLRGLDLSGF |
| Ga0070712_1007926731 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDEHVAMLARGAEVWNGWRADYDKTPDLSRAGLRGVDLSGFDLSG |
| Ga0070712_1012804772 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MANDEHVAMLGHGAAVWNEWRAKSHDTPNLSGAGLR |
| Ga0099794_102806261 | 3300007265 | Vadose Zone Soil | MPNDEHVAMLGRGAAVWNEWRAKFPVAPDLSRAGLRG |
| Ga0099830_114650311 | 3300009088 | Vadose Zone Soil | MPKDEHVAVLGRGAAVWSAWPAENDEVPDLSRAGLRGLDLTGF |
| Ga0099828_113630401 | 3300009089 | Vadose Zone Soil | MPNDDHVAMLGRGADVWNEWRAKHDHAPDLSGAGLRGL |
| Ga0066709_1028710451 | 3300009137 | Grasslands Soil | MPKNEHVALLGRGAAAWNEWRAGHGKMPDLSRAALRGRDLSGFDLSRRDRG |
| Ga0099792_102499281 | 3300009143 | Vadose Zone Soil | VPNDDHVAMLGRGAAVWNEWRAKHDDAPDLSGAGLRGLD |
| Ga0126373_105595801 | 3300010048 | Tropical Forest Soil | MPSDEHVALLRKGTGAWNAWRNERDEAPDLSRAGLRGLDLSG |
| Ga0126370_123360921 | 3300010358 | Tropical Forest Soil | MPNAEHVAVLRRGAAAWNAWRAESSEAPDLSQAGLR |
| Ga0126376_101947253 | 3300010359 | Tropical Forest Soil | MPKDEHVAVLGRGAAVWNAWRAEQDEVPDLSQAGLRGFDLTGF |
| Ga0126376_132183632 | 3300010359 | Tropical Forest Soil | MLRRGAAAWNAWRAENRETPDLPLAGLRGLDLSGFDLSQVDL |
| Ga0126378_110468471 | 3300010361 | Tropical Forest Soil | MANVDHVELLRRGAAVWNVWRADHDVIPDLSEASLRGLD |
| Ga0126381_1007761702 | 3300010376 | Tropical Forest Soil | MPNANQIDVLRRGAAAWNAWRAEQDVTPDLSGAGLR |
| Ga0126381_1028711061 | 3300010376 | Tropical Forest Soil | MPNDEHVAMLRRGAAAWNAWRAENRETPDLPLAGLRGL |
| Ga0126381_1042874492 | 3300010376 | Tropical Forest Soil | MPNDDHVALLKRGAAAWNAWRAEHDEAPDLSRAGL |
| Ga0126383_123598461 | 3300010398 | Tropical Forest Soil | MPKDEHVVVLGHGAAVWNAWRAEHDEVPDLSQAALRG |
| Ga0150983_105693562 | 3300011120 | Forest Soil | MPKDEHVAVLGRGAAVWNTWRAEHDEVPDLSRAALRGLDL |
| Ga0137393_117100472 | 3300011271 | Vadose Zone Soil | MPNDEDLAMLGCGAAAWNAWRAEHDEAPDLSQAALRG |
| Ga0137358_103687621 | 3300012582 | Vadose Zone Soil | MANDEHVAMLARGAAVWDKWRADRDETLDLSRASLRG |
| Ga0137397_108303572 | 3300012685 | Vadose Zone Soil | MPKDEHVALLGRGAAVWNAWRTAHDEVPDLSRAGLRGLDLS |
| Ga0137394_103526161 | 3300012922 | Vadose Zone Soil | MPKDEHIAVLGRSAAVWNAWRAEHSEVPDLSRAAL |
| Ga0137359_112925441 | 3300012923 | Vadose Zone Soil | MPKDEHVAVLGRGAAVWNAWRAEHDQVLDLSRAALRG |
| Ga0137416_122085791 | 3300012927 | Vadose Zone Soil | MPNDEHVAMLGHGAAAWNERRPKHHETPDLSGAGLIWGRPA |
| Ga0126369_106510102 | 3300012971 | Tropical Forest Soil | MPKDEHVAVLARGAAASNAWRAEHDEAPDLSQAALRG |
| Ga0164309_115713751 | 3300012984 | Soil | MPNDEHVAMLARGAEVWNAWRADHDESPDLSRAGLR |
| Ga0182035_102145433 | 3300016341 | Soil | MPNDEHVALLVQGATAWNEWRAKFDGTLDLSRAGL |
| Ga0182035_117806591 | 3300016341 | Soil | MLGRGAAAWNAWRAEQDETPDLPRAGLRGLDLSGFDL |
| Ga0182034_100295441 | 3300016371 | Soil | MADDELLAALQRGAAAWNARRAEHAEAPDLSGASLRGLDL |
| Ga0182039_108882581 | 3300016422 | Soil | MPKDEHVAVLARGAAAWSAWRAKRNEAPDLSQAALRG |
| Ga0182038_108082961 | 3300016445 | Soil | MPNDEHVILLRRGADAWSSWRAERDDTPDLSQASLRGLDLSGFDFTRAD |
| Ga0210407_108475452 | 3300020579 | Soil | MPNDEHVVMLAREAAAWNEWRADHDETPDLSRLACEGSI |
| Ga0210403_106101692 | 3300020580 | Soil | MATDEHVAMLARGAEVWNGWRADHNETPDLSRAGLRGLD |
| Ga0210403_110281431 | 3300020580 | Soil | MPNDEHVAMLARGAAAWNEWRADRDETPDLSRAGLRGL |
| Ga0210395_109697841 | 3300020582 | Soil | MPNDEHVARLGHGAAAWDEWRAKLDETPDLSRAGLRGLDLSG |
| Ga0210404_102923101 | 3300021088 | Soil | MPNDEHVAMLAWGAEVWNGWRADHDETPELSRAGVRGCDLSGFDLSSADL |
| Ga0210406_108754562 | 3300021168 | Soil | MANDEHVAMLARGAAASNEWRANRDETPDLSRAGLRGLDLSGFD |
| Ga0210408_112319412 | 3300021178 | Soil | MPKDEHVAVLGRGAAVWNAWRAEHDEVPDLSRAGLRGL |
| Ga0210396_110095511 | 3300021180 | Soil | MANDEHVAMLGRGATVWNEWRATHDEMPDLSRAGLRGLD |
| Ga0210397_111249941 | 3300021403 | Soil | MPNDEHVAMLARGAAAWNEWRADRDETPDLSRAGL |
| Ga0210387_107665161 | 3300021405 | Soil | MPNDEHVAMLARGTAVWNEWRAKSHDTPNLSGAGLR |
| Ga0210387_109290191 | 3300021405 | Soil | MANDEHVSVLGRGAAAWNEWRADRDEMPDLSRAGL |
| Ga0210386_112599182 | 3300021406 | Soil | MPNDEHVAMLARGAAAWNEWRADRDETPDLSRAGLVYAGL |
| Ga0210384_116258442 | 3300021432 | Soil | MPKDEHVAVLGRGAAVWNAWRAEHDESPDLSRAGLRG |
| Ga0210402_103840804 | 3300021478 | Soil | MPKDEHIAVLGRGAAAWNAWRAEHDEAPDLSRAPLR |
| Ga0210410_117393132 | 3300021479 | Soil | MPNDEHVAMLARGTAVWNEWRAKSHDTPNLSGAGLRGLDLSGF |
| Ga0126371_138578092 | 3300021560 | Tropical Forest Soil | MPSDEHVALIRKGATAWNVWRNERDEAPDLSRAGLRGLDLSGFNLSRADLQ |
| Ga0126371_139439122 | 3300021560 | Tropical Forest Soil | MSNDDHVGLLKRGAAAWNAWRGEHDEAPDLSRAGL |
| Ga0242665_101173622 | 3300022724 | Soil | MPKDEHVAVLGRGAAVWNAWRAEHDESPDLSRAGLRGLDL |
| Ga0207692_101966071 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNHEHVAMLARGTAAWNEWRADRDETPDLSRAGLRG |
| Ga0207692_111137431 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MANDEHVAMLGRGAKVRNDWPATHDEMPNLSRAGLRGLDLSGFDVSRA |
| Ga0207699_111123902 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MANDEHVAMLGRGAAAWNEWRTDRDKTPDLSRAGLR |
| Ga0207684_106930211 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKDEYVGLLGLGIAAWNAWRAEHDEVPDLSSANLR |
| Ga0207693_105343032 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDEPIAILARGAAAWNAWRADRDETPDLSRAGLRG |
| Ga0207665_100303781 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MANDEHVAMLGRGAKVRNDWPATHDEMPNLSRAGLRGLDLSGFDVSRADLRG |
| Ga0209156_101308652 | 3300026547 | Soil | MANDEHVTMLGRGVTMWNEWRATHEEMPDLSRAGL |
| Ga0209156_104768172 | 3300026547 | Soil | MPKDEHVAVLGRGATVWNAWRAEHDQVPDLSRAALRG |
| Ga0209648_102217763 | 3300026551 | Grasslands Soil | MPNDEHVAMLARGAAAWNEWRAKDDEAPDLSRAGLRGLDL |
| Ga0179587_105164491 | 3300026557 | Vadose Zone Soil | MPNDEHVAMLGRGAAVWNEWRAKFPVASELSRAGLRGLDLSGYDL |
| Ga0209419_10992132 | 3300027537 | Forest Soil | MPNDEHVVMLGRGATVWNEWRATHDEMPDLSRAGLRGLDLSGF |
| Ga0209118_11855612 | 3300027674 | Forest Soil | MPNDDHVAMLGRGAAVWNEGRAKHDDAPDLSGAGLRGLDLSGFDLSR |
| Ga0209626_11725922 | 3300027684 | Forest Soil | MPNDEQVAMLGRGAAVWNAWRAEHDEAPDLSRAAL |
| Ga0209038_100086905 | 3300027737 | Bog Forest Soil | MPKDEHVAMLGRGAAAWNARRAEKGETPDLSRAGLRGLDLSGFD |
| Ga0209773_104674291 | 3300027829 | Bog Forest Soil | MPNDEHVVMLARGAAAWNEWRADRDETPDLSRAGLRGL |
| Ga0209275_103193693 | 3300027884 | Soil | MPNDEHVAMLARGAEVWNGWRADHDETPDLSRAGV |
| Ga0308309_108288321 | 3300028906 | Soil | MPNDEHVAMLARGAAAWNEWRAKDDEAPDLSRAGLRGLD |
| Ga0308309_110094641 | 3300028906 | Soil | MPNDEHVAMLARGAEVWNEWRAEQDERADLSLASLRGLDLRGFCLS |
| Ga0308309_112367462 | 3300028906 | Soil | MANDEHVVMLARGAEVWNGWRADHNETPDLSRAGLRGLEL |
| Ga0222749_105547562 | 3300029636 | Soil | MPKDEHVAVLGLGAAAWKAWRAEHDEVPDLSRAGLRGLDL |
| Ga0170824_1092472361 | 3300031231 | Forest Soil | MPKDEHIAVLSRGAATWSAWRAEHSEVPDLSRGALRGL |
| Ga0318528_100886111 | 3300031561 | Soil | MPNDEHVILLRRGADAWNSWRAERDDTPDLSQASLR |
| Ga0318555_100493801 | 3300031640 | Soil | MSNDEHLAVLRRGVAAWDAWRAQHDDAPDLSRAGLRGLD |
| Ga0318561_100525725 | 3300031679 | Soil | MPDDEHVAVLRRGAAEWNAWRAEHDQTPDLSRAGLRG |
| Ga0318574_103451671 | 3300031680 | Soil | MSNDEHLMLLRRGADEWNSWRAERDDTPDLSQAGLRGLDLSGF |
| Ga0310686_1166198512 | 3300031708 | Soil | MPKDEHISVLGSGAAVWNEWRAKHDETPELSRAGL |
| Ga0306917_100569862 | 3300031719 | Soil | MANDEHVAMLGRGAAAWNEWRAKVDETPDLSRPVCAGSI |
| Ga0306918_102661033 | 3300031744 | Soil | MPNDEHLAVLQRGVAAWDAWRAEHDEAPDLSRAGLRGL |
| Ga0318502_107745702 | 3300031747 | Soil | MPNDEHVAMLGRGAAAWNAWRAEQDETPDLPRAGLR |
| Ga0318492_101846702 | 3300031748 | Soil | MPNEAHVAVLRRGAAAWNAWRTEHEEAPDLSRAGLR |
| Ga0307475_102852721 | 3300031754 | Hardwood Forest Soil | VPKNEHVALLGRGAAAWNAWRAENGEVPDLSRAAL |
| Ga0318509_108631871 | 3300031768 | Soil | MADDELLAALQRGAAAWNTRREEHDEAPDLSGAGLRGLDLSGFDLSRA |
| Ga0318526_102472412 | 3300031769 | Soil | MADDEHLAVLRRSAAAWNAWRATHDEGPDLSRAGL |
| Ga0318508_11369703 | 3300031780 | Soil | MPNDEHVALLRRGSAAWNAWRAEREETPDLSRAGLRG |
| Ga0318547_106032941 | 3300031781 | Soil | MPKDEHVAVLARGAAAWSAWRAKRNEAPDLSQAALRGL |
| Ga0318547_108907271 | 3300031781 | Soil | MSNDEHLMLLRRGADEWNSWRAERDDTPDLSQAGLRGLD |
| Ga0318529_102296911 | 3300031792 | Soil | MADDELLAALQRGAAAWNARRAERDEAPDLSGTGLRGLDLSGFDLSR |
| Ga0318576_105016921 | 3300031796 | Soil | MPNEAHVAVLRRGAAAWNAWRTEHEEAPDLSRAGLRGL |
| Ga0318523_103477842 | 3300031798 | Soil | MPNDEHLMLLRRGAGAWNSWRAERNETPDLSQAGLRGLDLSG |
| Ga0307478_112884111 | 3300031823 | Hardwood Forest Soil | MPNDEHVAMLARGAEVWNGWRADHDETPDLSRAGVRGCDLSGF |
| Ga0318527_100155061 | 3300031859 | Soil | MPDEEHLAVLRRGVAEWGDWRVEHDQAPDLSRASLRG |
| Ga0306925_109565801 | 3300031890 | Soil | MANDELLAALQRGAAAWNARRAEHDEAPDLSGASLRGLD |
| Ga0306925_113141351 | 3300031890 | Soil | MSNDEHVAMLGRGAAAWNKWRAEQDETPDLSRAGLRGL |
| Ga0306925_115806532 | 3300031890 | Soil | MPDDEHLAVLRRGAAVWNAWRTMHEEAPDLSRAGLRGLDL |
| Ga0318520_109672002 | 3300031897 | Soil | MLNDEHVAMLGRGAVAWNEWRADRDETPDVSRAGLRGLDLSGF |
| Ga0306923_105637941 | 3300031910 | Soil | MPNDDHVAMLGRGAAAWNAWRTAHRESPDLSRAGLRGLD |
| Ga0310912_106052781 | 3300031941 | Soil | MPNDEHVAMLGRGAAARNARCAERNETPDLPRAGLRGLDLSG |
| Ga0310909_100345701 | 3300031947 | Soil | MPNDEHVILLRRGADAWNSWRAERDDTPDLSQASLRGLDL |
| Ga0318531_100084005 | 3300031981 | Soil | MANDELLAALQRGAAAWNARRAEHDEAPDLSGASLRGLDLS |
| Ga0306922_118624271 | 3300032001 | Soil | MSNDEHVAMLGRGAAAWNKWRAEQDETPDLSRAGL |
| Ga0318569_101646481 | 3300032010 | Soil | MPNDDHVAMLGRGAAAWNAWRTAHRESPDLSRAGLRGLDL |
| Ga0318556_104284202 | 3300032043 | Soil | MPNDEHVILLRRGAGAWNSWRAERDERPDLSQAGLRGLDLSGYDLF |
| Ga0318556_106444971 | 3300032043 | Soil | MANDEHVILVQHGAGAWNSWRAERDERPDLSQAGLRGLDL |
| Ga0318532_101623552 | 3300032051 | Soil | MPNDEHLMLLRRGAGAWNSWRAERNETPDLSQAGLRGLDLSGYD |
| Ga0318575_104210032 | 3300032055 | Soil | MANDELLAALQRGAAAWNARRAERDEAPDLSGTGLRGLDLSGFD |
| Ga0306924_103517611 | 3300032076 | Soil | MPNADHIAVLERGAAIWNAWRTEQQETPDLSGVGLRG |
| Ga0318525_100648951 | 3300032089 | Soil | MADDEHLAVLRRSAAAWNAWRATHDEGPDLSRAGLRGLDL |
| Ga0318540_104415042 | 3300032094 | Soil | MPKDEHVAVLARGAAAWNAWRAKGDEAPDLSQAALR |
| Ga0307470_114392582 | 3300032174 | Hardwood Forest Soil | MPKDEHVAVLGRGAAVWNAWRAEHDEVPDLSLAGLRGLD |
| Ga0307471_1018170372 | 3300032180 | Hardwood Forest Soil | MTTDEHVALLGRGAAVWNEWRADRDETPDLSRAGRRGLDLSGFDL |
| ⦗Top⦘ |