| Basic Information | |
|---|---|
| Family ID | F080308 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 46 residues |
| Representative Sequence | RANLLQTLVSFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.65 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.130 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.739 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.304 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.174 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 0.00% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01243 | Putative_PNPOx | 7.83 |
| PF01757 | Acyl_transf_3 | 6.96 |
| PF12071 | DUF3551 | 3.48 |
| PF03062 | MBOAT | 3.48 |
| PF02518 | HATPase_c | 3.48 |
| PF02371 | Transposase_20 | 1.74 |
| PF00753 | Lactamase_B | 1.74 |
| PF16363 | GDP_Man_Dehyd | 0.87 |
| PF03775 | MinC_C | 0.87 |
| PF01041 | DegT_DnrJ_EryC1 | 0.87 |
| PF13628 | DUF4142 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.74 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.87 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.87 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.87 |
| COG0850 | Septum site-determining protein MinC | Cell cycle control, cell division, chromosome partitioning [D] | 0.87 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.87 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.13 % |
| Unclassified | root | N/A | 0.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11489774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1049843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 655 | Open in IMG/M |
| 3300001431|F14TB_100149812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 686 | Open in IMG/M |
| 3300004643|Ga0062591_102490111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300005093|Ga0062594_101906838 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005345|Ga0070692_10916804 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005367|Ga0070667_101982739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300005456|Ga0070678_100971093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300005548|Ga0070665_102038193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 579 | Open in IMG/M |
| 3300005614|Ga0068856_100284452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1670 | Open in IMG/M |
| 3300005615|Ga0070702_100801561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300005617|Ga0068859_100311641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1667 | Open in IMG/M |
| 3300005764|Ga0066903_105982613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 637 | Open in IMG/M |
| 3300005981|Ga0081538_10071704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1904 | Open in IMG/M |
| 3300006038|Ga0075365_10728451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300006175|Ga0070712_100780179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 819 | Open in IMG/M |
| 3300006178|Ga0075367_10672447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 658 | Open in IMG/M |
| 3300006237|Ga0097621_100854317 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300006237|Ga0097621_101025355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 773 | Open in IMG/M |
| 3300006358|Ga0068871_100578349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
| 3300006797|Ga0066659_10434068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300006844|Ga0075428_100655407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1119 | Open in IMG/M |
| 3300006845|Ga0075421_100020087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8395 | Open in IMG/M |
| 3300006847|Ga0075431_100335604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1522 | Open in IMG/M |
| 3300006852|Ga0075433_11938776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 505 | Open in IMG/M |
| 3300006853|Ga0075420_100957778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300006854|Ga0075425_102307976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300006903|Ga0075426_10905375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300006904|Ga0075424_102783234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 510 | Open in IMG/M |
| 3300009011|Ga0105251_10234249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 827 | Open in IMG/M |
| 3300009090|Ga0099827_10569230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 976 | Open in IMG/M |
| 3300009100|Ga0075418_10017471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7924 | Open in IMG/M |
| 3300009101|Ga0105247_11475242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300009101|Ga0105247_11485759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300009147|Ga0114129_10746402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1253 | Open in IMG/M |
| 3300009147|Ga0114129_12290798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 648 | Open in IMG/M |
| 3300009147|Ga0114129_13490808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300009156|Ga0111538_11820281 | Not Available | 766 | Open in IMG/M |
| 3300009176|Ga0105242_10362328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1342 | Open in IMG/M |
| 3300009545|Ga0105237_12725691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300009553|Ga0105249_11020207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 896 | Open in IMG/M |
| 3300010043|Ga0126380_10003780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6212 | Open in IMG/M |
| 3300010043|Ga0126380_10996592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300010046|Ga0126384_10987241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 766 | Open in IMG/M |
| 3300010047|Ga0126382_12158189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 535 | Open in IMG/M |
| 3300010397|Ga0134124_12895786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300010400|Ga0134122_10325125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1330 | Open in IMG/M |
| 3300012198|Ga0137364_10086223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2182 | Open in IMG/M |
| 3300012212|Ga0150985_106591734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300012212|Ga0150985_107754212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 845 | Open in IMG/M |
| 3300012212|Ga0150985_118268483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 676 | Open in IMG/M |
| 3300012212|Ga0150985_122898715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 591 | Open in IMG/M |
| 3300012357|Ga0137384_11198333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 604 | Open in IMG/M |
| 3300012469|Ga0150984_103787146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300012904|Ga0157282_10317301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 555 | Open in IMG/M |
| 3300012910|Ga0157308_10199651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 674 | Open in IMG/M |
| 3300012916|Ga0157310_10256132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 665 | Open in IMG/M |
| 3300012924|Ga0137413_10923714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 679 | Open in IMG/M |
| 3300012927|Ga0137416_10594858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 963 | Open in IMG/M |
| 3300012957|Ga0164303_10431836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 823 | Open in IMG/M |
| 3300012961|Ga0164302_10230532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1162 | Open in IMG/M |
| 3300012988|Ga0164306_10814163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300012989|Ga0164305_10116222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1752 | Open in IMG/M |
| 3300012989|Ga0164305_10456006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 994 | Open in IMG/M |
| 3300013297|Ga0157378_10366081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1412 | Open in IMG/M |
| 3300014745|Ga0157377_10245385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1158 | Open in IMG/M |
| 3300014745|Ga0157377_10944964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300015371|Ga0132258_12438723 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300015371|Ga0132258_13505594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1075 | Open in IMG/M |
| 3300015372|Ga0132256_102680293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300015373|Ga0132257_102858674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300016387|Ga0182040_10618801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300016387|Ga0182040_10786455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 783 | Open in IMG/M |
| 3300016404|Ga0182037_10304910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300018027|Ga0184605_10007105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 4149 | Open in IMG/M |
| 3300018054|Ga0184621_10072220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1188 | Open in IMG/M |
| 3300018072|Ga0184635_10086716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1231 | Open in IMG/M |
| 3300018081|Ga0184625_10047702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2138 | Open in IMG/M |
| 3300018469|Ga0190270_10344037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1352 | Open in IMG/M |
| 3300018476|Ga0190274_11373889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 795 | Open in IMG/M |
| 3300019875|Ga0193701_1028677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1142 | Open in IMG/M |
| 3300020000|Ga0193692_1008098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2635 | Open in IMG/M |
| 3300021082|Ga0210380_10103307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1261 | Open in IMG/M |
| 3300021082|Ga0210380_10310465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300021968|Ga0193698_1034261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300025932|Ga0207690_11277707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300025937|Ga0207669_11839956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 517 | Open in IMG/M |
| 3300025945|Ga0207679_10780525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 870 | Open in IMG/M |
| 3300025945|Ga0207679_11847943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 551 | Open in IMG/M |
| 3300025986|Ga0207658_11816665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300026121|Ga0207683_10283418 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300027633|Ga0208988_1080483 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300027669|Ga0208981_1022164 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300027909|Ga0209382_10177516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2453 | Open in IMG/M |
| 3300028379|Ga0268266_11409244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 672 | Open in IMG/M |
| 3300028587|Ga0247828_10953695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300028708|Ga0307295_10168570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300028710|Ga0307322_10134707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300028719|Ga0307301_10151032 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300028755|Ga0307316_10025438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1911 | Open in IMG/M |
| 3300028790|Ga0307283_10225285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 544 | Open in IMG/M |
| 3300028796|Ga0307287_10275849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 636 | Open in IMG/M |
| 3300028796|Ga0307287_10378692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 533 | Open in IMG/M |
| 3300028802|Ga0307503_10377644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 734 | Open in IMG/M |
| 3300028814|Ga0307302_10078083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1565 | Open in IMG/M |
| 3300028824|Ga0307310_10034341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2052 | Open in IMG/M |
| 3300028875|Ga0307289_10065355 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300031455|Ga0307505_10088676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1382 | Open in IMG/M |
| 3300031858|Ga0310892_11378644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 506 | Open in IMG/M |
| 3300031859|Ga0318527_10494345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 522 | Open in IMG/M |
| 3300031910|Ga0306923_10508872 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300031912|Ga0306921_10171268 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
| 3300032012|Ga0310902_10141137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1351 | Open in IMG/M |
| 3300032211|Ga0310896_10272246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300033551|Ga0247830_10401902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1066 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.35% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_114897742 | 3300000890 | Soil | APARLPRANLLQTLVSFDGALDARIEFHFGLFADNTCRLRDGLDNKALGL* |
| AP72_2010_repI_A001DRAFT_10498431 | 3300000893 | Forest Soil | RLTRANLFQTLMSFDGTVDARIEFRFGLFADNTCRLRDGIDNKALGL* |
| F14TB_1001498121 | 3300001431 | Soil | NLFQTLMSFDRTVDARIEFRFGLFADNSCRLRDGLDNKALGL* |
| Ga0062591_1024901111 | 3300004643 | Soil | PARLTRANLLQTLVSFDGALDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0062594_1019068381 | 3300005093 | Soil | QTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGF* |
| Ga0070692_109168042 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PVRLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGF* |
| Ga0070667_1019827392 | 3300005367 | Switchgrass Rhizosphere | IRANLMQTLISFDRTLDARLEFRFGLFADNTCRLRDGLDNKALALQ* |
| Ga0070678_1009710931 | 3300005456 | Miscanthus Rhizosphere | PARLTRANLFQTLVSFDGELDARLEFRFGLFADNKCRIRDGQDNKALGL* |
| Ga0070665_1020381932 | 3300005548 | Switchgrass Rhizosphere | QTLVSFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0068856_1002844523 | 3300005614 | Corn Rhizosphere | FDGALDARLEFHFGLFADNTCRLRDGLDNKALGL* |
| Ga0070702_1008015611 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MMVALALFPCLAQTLVSFDGTLDARLEFRFGLFAENKCRLRDGRDNKALGL* |
| Ga0068859_1003116411 | 3300005617 | Switchgrass Rhizosphere | LTRANLLQTLVSFDGALDARIEFHFGLFADNTCRLRDGLDNKALGL* |
| Ga0066903_1059826132 | 3300005764 | Tropical Forest Soil | RLARANLFQTLLSFDRAVDARIEFRFGLFADNTCRLRDGLDNKALGL* |
| Ga0081538_100717043 | 3300005981 | Tabebuia Heterophylla Rhizosphere | LVSFDRTLDARLEFRFGLFADNACRLRDGLDNKALGL* |
| Ga0075365_107284511 | 3300006038 | Populus Endosphere | LVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0070712_1007801792 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | APARLTRANLLQTLVSFDGALDARLEFHFGLFADNTCRLRDGLDNKALGL* |
| Ga0075367_106724472 | 3300006178 | Populus Endosphere | ANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0097621_1008543171 | 3300006237 | Miscanthus Rhizosphere | LTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGF* |
| Ga0097621_1010253552 | 3300006237 | Miscanthus Rhizosphere | RANLLQTLVSFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0068871_1005783492 | 3300006358 | Miscanthus Rhizosphere | SPARLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0066659_104340682 | 3300006797 | Soil | ARANLFQTLMSFDRMVDARIEFSFGLFADNRCRLRDGLDNKALGL* |
| Ga0075428_1006554071 | 3300006844 | Populus Rhizosphere | RANLFQTLMSFDRTIDARIEFRFGLFADNSCRLRDGLDNKALGL* |
| Ga0075421_1000200876 | 3300006845 | Populus Rhizosphere | LFQTLMSFDRTIDARIEFRFGLFADNSCRLRDGLDNKALGL* |
| Ga0075431_1003356042 | 3300006847 | Populus Rhizosphere | NRAPVRLTRANLFQTLMSFDGTVDARIEFHFGLFSDNKCRLRDGLDNKALGL* |
| Ga0075433_119387762 | 3300006852 | Populus Rhizosphere | LARANLFQTLLSFDRAVDARLEFRFGLFADNTCRLRDGLDNKALGL* |
| Ga0075420_1009577781 | 3300006853 | Populus Rhizosphere | QTLMSFDGTVDARIEFHFGLFSDNKCRLRDGLDNKALGL* |
| Ga0075425_1023079762 | 3300006854 | Populus Rhizosphere | AAPVRLIRANLMQTLISFDRTLDARLEFRFGLFADNTCRLRDGLDNKALALQ* |
| Ga0075426_109053752 | 3300006903 | Populus Rhizosphere | LIRANLMQTLISFDRTLDARLEFRFGLFADNTCRLRDGLDNKALALQ* |
| Ga0075424_1027832341 | 3300006904 | Populus Rhizosphere | TRANLLQTLVSFDGALDARIEFHFGLFADNTCRLRDGLDNKALGL* |
| Ga0105251_102342492 | 3300009011 | Switchgrass Rhizosphere | APARLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0099827_105692301 | 3300009090 | Vadose Zone Soil | NLFQTLLSFDRAVDARLEFRFGLFADNTCRIRDGLDNKALGL* |
| Ga0075418_100174711 | 3300009100 | Populus Rhizosphere | RLSRANLFQTLMSFDRTIDARIEFRFGLFADNSCRLRDGLDNKALGL* |
| Ga0105247_114752422 | 3300009101 | Switchgrass Rhizosphere | LIRANLFQTLVSFDGELDARLEFRFGLFADNKCRIRDGQDNKALGL* |
| Ga0105247_114857592 | 3300009101 | Switchgrass Rhizosphere | ARLTRANLLQTLVSFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0114129_107464021 | 3300009147 | Populus Rhizosphere | SRANLFQTLMSFDRTIDARIEFRFGLFADNSCRLRDGLDNKALGL* |
| Ga0114129_122907981 | 3300009147 | Populus Rhizosphere | MQTLMSFDRTVDAHIEFRFGLFADNSCRLQDGLDNKALGL* |
| Ga0114129_134908082 | 3300009147 | Populus Rhizosphere | VVNGAPVRLTRVNLFQTLISFVGSLDARVEFRFGLFADNKCRLMDWSDNRKLGL* |
| Ga0111538_118202811 | 3300009156 | Populus Rhizosphere | LMQTLLSFDGVLDARIEFQFGLFGDNNCRKRDGSDNKAIGVGHPTTGIH* |
| Ga0105242_103623281 | 3300009176 | Miscanthus Rhizosphere | INGSPVRLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGF* |
| Ga0105237_127256912 | 3300009545 | Corn Rhizosphere | VRLIRANLMQTLISFDRTLDARLEFRFGLFADNTCRLRDGLDNKALALQ* |
| Ga0105249_110202072 | 3300009553 | Switchgrass Rhizosphere | DRTLDARLEFRFGLFADNTCRLRDGLDNKALALQ* |
| Ga0126380_100037807 | 3300010043 | Tropical Forest Soil | FDRAVDARIEFRFGLFADNTCRLRDGLDNKALGL* |
| Ga0126380_109965922 | 3300010043 | Tropical Forest Soil | MSFDRAVDARIEFQFGLFANNACRRRDGLDNKALGL* |
| Ga0126384_109872412 | 3300010046 | Tropical Forest Soil | SFDGTVDARIEFRFGLFADNTCRLRDGLDNKALGL* |
| Ga0126382_121581891 | 3300010047 | Tropical Forest Soil | ARANLFQTLLSFDRAVDARIEFRFGLFADNTCRLRDGLDNKALGL* |
| Ga0134124_128957862 | 3300010397 | Terrestrial Soil | VNAAPVRLIRANLMQTLISFDRTLDARLEFRFGLFADNTCRLRDGLDNKALALQ* |
| Ga0134122_103251253 | 3300010400 | Terrestrial Soil | VNSSPARLTRANLLHTLVSFEGTLDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0137364_100862231 | 3300012198 | Vadose Zone Soil | LMSFDRMVDARIEFRFGLFADNSCRLRDGLDNKALGL* |
| Ga0150985_1065917342 | 3300012212 | Avena Fatua Rhizosphere | VVNSSPARLTRANLLQTLVSFEGELDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0150985_1077542123 | 3300012212 | Avena Fatua Rhizosphere | VVNSSPARLTRANLLQTLVSFEGELDARLEFHFGLFADNKCRIRDGQDNKALGF* |
| Ga0150985_1182684831 | 3300012212 | Avena Fatua Rhizosphere | VNSSPARLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0150985_1228987152 | 3300012212 | Avena Fatua Rhizosphere | SFEGALDARLEFHFGLFADNKCRLRDGQDNKALGF* |
| Ga0137384_111983332 | 3300012357 | Vadose Zone Soil | FDRTVDARIEFRFGLFADNSCRRQDGLDNKALGL* |
| Ga0150984_1037871461 | 3300012469 | Avena Fatua Rhizosphere | RANLLQTLVSFEGELDARLEFHFGLFADNKCRLRDGQDNKALGF* |
| Ga0157282_103173012 | 3300012904 | Soil | SPARLTRANLLQTLVSFDGALDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0157308_101996511 | 3300012910 | Soil | RANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0157310_102561322 | 3300012916 | Soil | VNAAPARLTRANLLQTLVSFDGALDARIEFHFGLFADNTCRLRDGRDNKALGL* |
| Ga0137413_109237142 | 3300012924 | Vadose Zone Soil | FQTLLSFDRTVDARIEFHFGLFADNKCRIRDGLDNKSLGLPISQ* |
| Ga0137416_105948582 | 3300012927 | Vadose Zone Soil | QTLLSFDRAVDARLEFRFGLFADNTCRIRDGLDNKALGL* |
| Ga0164303_104318362 | 3300012957 | Soil | ANLMQTLVSFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0164302_102305322 | 3300012961 | Soil | SFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0164306_108141631 | 3300012988 | Soil | RLTRANLLQTLVSFEGVLDARLEFRFGLFADNKCRLRDGQDNKTLGF* |
| Ga0164305_101162223 | 3300012989 | Soil | VSFDGALDARLEFHFGLFADNKCRLRDGQDNKALGF* |
| Ga0164305_104560061 | 3300012989 | Soil | SSPARLTRANLLQTLVSFEGVLDARLEFRFGLFADNKCRLRDGQDNKTLGF* |
| Ga0157378_103660811 | 3300013297 | Miscanthus Rhizosphere | SSPARLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0157377_102453851 | 3300014745 | Miscanthus Rhizosphere | NLLQTLVSFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL* |
| Ga0157377_109449642 | 3300014745 | Miscanthus Rhizosphere | SFDGALDARLEFRFGLFADNKCRIRDGQDNKALGL* |
| Ga0132258_124387231 | 3300015371 | Arabidopsis Rhizosphere | VVNSSPARLTRAKLLQTLVSFEGALDARLEFRFGLFADNKCRLRDGQDNKTLGF* |
| Ga0132258_135055942 | 3300015371 | Arabidopsis Rhizosphere | VTNGAAVQLRRANLIQTRMSFRGTVDADIEFRFGLFADNKCRLRDGADNKALGL* |
| Ga0132256_1026802932 | 3300015372 | Arabidopsis Rhizosphere | VNSSPARLTRANLLQTLVSFDGALDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0132257_1028586742 | 3300015373 | Arabidopsis Rhizosphere | NSSPARLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGL* |
| Ga0182040_106188011 | 3300016387 | Soil | NGAPVRLTRVNLVQTLLSFDGKIDARIEFRFGLFADNMCRLRDGLDNRALGL |
| Ga0182040_107864552 | 3300016387 | Soil | RANLFQTLMSFDRAVDARIEFHFELFTNNACRLRDGLDNKALGL |
| Ga0182037_103049104 | 3300016404 | Soil | VVVNGAAARLTRANLFQTLMSFDRAVDARIEFRFGLFGDNACRVRDGLDNKALGL |
| Ga0184605_100071058 | 3300018027 | Groundwater Sediment | QTLLSFDGTVDARIEFHFGLFADNKCRIRDGLDNKSLGLPISQ |
| Ga0184621_100722201 | 3300018054 | Groundwater Sediment | ARLTRANLLQTLVSFEGELDARLEFHFGLFADNKCRLRDGQDNKSLGL |
| Ga0184635_100867161 | 3300018072 | Groundwater Sediment | DGTVDARIEFNFGLFAYNKCRIRDGLDNKSLGLPNTQ |
| Ga0184625_100477021 | 3300018081 | Groundwater Sediment | AARLSRANLFQTLLSFDGTVDARIEFHFGLFADNKCRIRDGLDNKSLGLPNTQ |
| Ga0190270_103440371 | 3300018469 | Soil | NNSPARLTRANLLQTLVSFEGALHARLEFQFGLFADNKCRLRDGQDYKALGF |
| Ga0190274_113738892 | 3300018476 | Soil | LTRANLLQTLLSFEGMLDARLEFHFGLFADNKCRLRDGLDNKALGL |
| Ga0193701_10286771 | 3300019875 | Soil | LFQTLMSFDRAVDARIEFQFGLFANNACRRRDGLDNKALGL |
| Ga0193692_10080984 | 3300020000 | Soil | NLFQTLLSFDGKVDARIEFHFGLFADNKCRIRDGLDNKILGLPISQ |
| Ga0210380_101033072 | 3300021082 | Groundwater Sediment | VSFDGTLDARLEFHFGLFADNKCCLRDGLDNKALGL |
| Ga0210380_103104651 | 3300021082 | Groundwater Sediment | NGAAARLSRANLFQTLMSFDRAVDARIEFQFGLFANNACRRRDGLDNKALGL |
| Ga0193698_10342612 | 3300021968 | Soil | LSRANLFQTLMSFDRAVDARIEFQFGLFANNACRRRDGLDNKALGL |
| Ga0207690_112777071 | 3300025932 | Corn Rhizosphere | QTLVSFDGALDARLEFHFGLFADNKCRLRDGQDNKALGL |
| Ga0207669_118399562 | 3300025937 | Miscanthus Rhizosphere | SFDGTLDARLEFHFGLFADNECRLRDGLDNKALGL |
| Ga0207679_107805252 | 3300025945 | Corn Rhizosphere | RLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGLDNKALGL |
| Ga0207679_118479432 | 3300025945 | Corn Rhizosphere | PARLTRANLLQTLVSFDGALDARIEFHFGLFADNTCRLRDGLDNKALGL |
| Ga0207658_118166651 | 3300025986 | Switchgrass Rhizosphere | RLIRANLMQTLISFDRTLDARLEFRFGLFADNTCRLRDGLDNKALALQ |
| Ga0207683_102834181 | 3300026121 | Miscanthus Rhizosphere | LTRANLLQTLVSFEGVLDARLEFRFGLFADNKCRLRDGQDNKTLGF |
| Ga0208988_10804832 | 3300027633 | Forest Soil | ANLMQTLMSFSGAIDARIELHFGLFADNSCRLRDARDNQALGLTSPH |
| Ga0208981_10221641 | 3300027669 | Forest Soil | RLRRANLTQTLMSFSGAIDARIELHFGLFADNSCRLRDARDNQALGLTSPH |
| Ga0209382_101775161 | 3300027909 | Populus Rhizosphere | FQTLMSFDRTIDARIEFRFGLFADNSCRLRDGLDNKALGL |
| Ga0268266_114092442 | 3300028379 | Switchgrass Rhizosphere | VVNGAPARLTRANLLQTLVSFDGTLDARLEFHFGLFADNKCRLRDGLDNKALGL |
| Ga0247828_109536951 | 3300028587 | Soil | SPARLTRANLLQTLVSFDGALDARLEFRFGLFADNKCRIRDGQDNKALGL |
| Ga0307295_101685702 | 3300028708 | Soil | NLLQTLVSFDGALDARLEFQFGLFADNTCRRRDGLDNKSLGL |
| Ga0307322_101347073 | 3300028710 | Soil | VIVNAAAARLSRANLFQTLMSFDRAVDARIEFQFGLFANNACRRRDGLDNKALGL |
| Ga0307301_101510322 | 3300028719 | Soil | LMQTLMSFSGAIDARIELHFGLFADNSCRLRDARDNQTLGLTSPH |
| Ga0307316_100254381 | 3300028755 | Soil | QTLLSFDGTVDARIEFLFGLFADNKCRIRDGLDNKSLGLPNTQ |
| Ga0307283_102252851 | 3300028790 | Soil | NGAPARLTRANLLQTLVSFAGALDARLEFHFGLFADNKCRLRDGLDNKALGL |
| Ga0307287_102758491 | 3300028796 | Soil | GTVDARIEFHFGLFADNKCRIRDGLDNKSLGLPNTQ |
| Ga0307287_103786921 | 3300028796 | Soil | LLSFEGTVDARIEFHFGLFADNKCRIRDGLDNKSLGLPISQ |
| Ga0307503_103776441 | 3300028802 | Soil | TRANFMQTLVSFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL |
| Ga0307302_100780831 | 3300028814 | Soil | GNAAAARLSRANLFQTLMSFDRAVDARIEFQFGLFANNACRRRDGLDNKALGL |
| Ga0307310_100343414 | 3300028824 | Soil | RANLFQTLMSFDRAVDARIEFQFGLFANNACRRRDGLDNKALGL |
| Ga0307289_100653551 | 3300028875 | Soil | APVRLRRANLMQTLMSFSGAIDARIELHFGLFADNSCRLRDARDNQTLGLTSPH |
| Ga0307505_100886761 | 3300031455 | Soil | TRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGL |
| Ga0310892_113786441 | 3300031858 | Soil | AAPARLTRANLLQTLVSFDGALDARLEFHFGLFADNTCRLRDGLDNKALGL |
| Ga0318527_104943451 | 3300031859 | Soil | RANLFQTLMSFDGTVDARIEFRFGLFADNTCRLRDGIDNKALGL |
| Ga0306923_105088721 | 3300031910 | Soil | TRVNLMQTLLSFDGKVDTRIEFRFGLFADNTCRLRDGLDNRALGL |
| Ga0306921_101712684 | 3300031912 | Soil | VNLMQTLLSFDGKIDARIEFRFGLFADNSCRLRDGLDNRALGL |
| Ga0310902_101411371 | 3300032012 | Soil | TRANLLQTLVSFEGTLDARLEFHFGLFADNKCRLRDGLDNKALGL |
| Ga0310896_102722462 | 3300032211 | Soil | QTLVSFEGALDARLEFHFGLFADNKCRLRDGQDNKALGF |
| Ga0247830_104019021 | 3300033551 | Soil | NGAPARLTRANLLQTLVSFEGALDARLEFHFGLFADNKCRLRDGLDNKALGL |
| ⦗Top⦘ |