NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080287

Metagenome / Metatranscriptome Family F080287

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080287
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 46 residues
Representative Sequence DAVNVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARIDF
Number of Associated Samples 90
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.80 %
% of genes near scaffold ends (potentially truncated) 90.43 %
% of genes from short scaffolds (< 2000 bps) 86.96 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.304 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(15.652 % of family members)
Environment Ontology (ENVO) Unclassified
(25.217 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.174 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00753Lactamase_B 6.09
PF13620CarboxypepD_reg 4.35
PF02518HATPase_c 3.48
PF08669GCV_T_C 1.74
PF01011PQQ 1.74
PF12704MacB_PCD 1.74
PF10518TAT_signal 1.74
PF00109ketoacyl-synt 0.87
PF05685Uma2 0.87
PF03328HpcH_HpaI 0.87
PF03713DUF305 0.87
PF13899Thioredoxin_7 0.87
PF14534DUF4440 0.87
PF10282Lactonase 0.87
PF05198IF3_N 0.87
PF13366PDDEXK_3 0.87
PF13442Cytochrome_CBB3 0.87
PF07593UnbV_ASPIC 0.87
PF03683UPF0175 0.87
PF01068DNA_ligase_A_M 0.87
PF01425Amidase 0.87
PF12034DUF3520 0.87
PF14559TPR_19 0.87
PF03473MOSC 0.87
PF02566OsmC 0.87
PF03712Cu2_monoox_C 0.87
PF12796Ank_2 0.87
PF00578AhpC-TSA 0.87
PF05598DUF772 0.87
PF16811TAtT 0.87
PF00034Cytochrom_C 0.87
PF03969AFG1_ATPase 0.87
PF04299FMN_bind_2 0.87
PF13432TPR_16 0.87
PF0563523S_rRNA_IVP 0.87
PF07729FCD 0.87
PF13191AAA_16 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.87
COG0290Translation initiation factor IF-3Translation, ribosomal structure and biogenesis [J] 0.87
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.87
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.87
COG1485Cell division protein ZapE (Z ring-associated ATPase), AFG1 superfamilyCell cycle control, cell division, chromosome partitioning [D] 0.87
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.87
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.87
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.87
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.87
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.87
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.87
COG2886Predicted antitoxin, contains HTH domainGeneral function prediction only [R] 0.87
COG3544Uncharacterized conserved protein, DUF305 familyFunction unknown [S] 0.87
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.87
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.30 %
UnclassifiedrootN/A8.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_109530751All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300000789|JGI1027J11758_12913506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga → Chitinophaga pinensis2198Open in IMG/M
3300003267|soilL1_10085952All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300003321|soilH1_10213176All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300004139|Ga0058897_11147909All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2620Open in IMG/M
3300004463|Ga0063356_100720660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1376Open in IMG/M
3300004463|Ga0063356_100926255All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1234Open in IMG/M
3300004633|Ga0066395_10553750All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005338|Ga0068868_100348553All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300005338|Ga0068868_100775598All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005445|Ga0070708_101976533All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005544|Ga0070686_100544112All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005556|Ga0066707_10431262All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300005563|Ga0068855_100841856All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300005577|Ga0068857_100696687All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300005607|Ga0070740_10228510All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300005719|Ga0068861_101915290All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300005764|Ga0066903_101298220All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300005764|Ga0066903_102643367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae973Open in IMG/M
3300005764|Ga0066903_103772373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300005764|Ga0066903_105660007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300005764|Ga0066903_107937280All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005841|Ga0068863_100652787All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300006034|Ga0066656_10142914All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300006049|Ga0075417_10286367All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300006175|Ga0070712_102048508All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300006806|Ga0079220_10258283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1048Open in IMG/M
3300006844|Ga0075428_100178619All Organisms → cellular organisms → Bacteria2298Open in IMG/M
3300006852|Ga0075433_11670217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300006852|Ga0075433_11719158All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006871|Ga0075434_102221499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia552Open in IMG/M
3300006904|Ga0075424_101956416All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300006954|Ga0079219_10157946All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300009012|Ga0066710_101676564All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300009090|Ga0099827_10302247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_101354Open in IMG/M
3300009093|Ga0105240_10430674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1480Open in IMG/M
3300009093|Ga0105240_10758436All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300009094|Ga0111539_12740114All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300009100|Ga0075418_12235205All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300009162|Ga0075423_13046761All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009176|Ga0105242_11783516All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300009551|Ga0105238_10995462All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300010043|Ga0126380_10272748All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300010043|Ga0126380_10729307All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300010301|Ga0134070_10412864All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010304|Ga0134088_10008322All Organisms → cellular organisms → Bacteria → Acidobacteria4389Open in IMG/M
3300010304|Ga0134088_10369264All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300010358|Ga0126370_10191505All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300010359|Ga0126376_13007638All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300010360|Ga0126372_10921546All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300010360|Ga0126372_11275801All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300010361|Ga0126378_10493315All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300010361|Ga0126378_10824614All Organisms → cellular organisms → Bacteria → Acidobacteria1036Open in IMG/M
3300010361|Ga0126378_11019066All Organisms → cellular organisms → Bacteria → Acidobacteria931Open in IMG/M
3300010361|Ga0126378_13381781Not Available507Open in IMG/M
3300010362|Ga0126377_13065724All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010366|Ga0126379_13000000All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010398|Ga0126383_10191840All Organisms → cellular organisms → Bacteria1953Open in IMG/M
3300010398|Ga0126383_12141513All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300010403|Ga0134123_12011212All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300010403|Ga0134123_12551372All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012212|Ga0150985_117445719All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300012212|Ga0150985_119656740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1013Open in IMG/M
3300012469|Ga0150984_119258902All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300012683|Ga0137398_10816014All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia652Open in IMG/M
3300012944|Ga0137410_10079987All Organisms → cellular organisms → Bacteria → Acidobacteria2388Open in IMG/M
3300012971|Ga0126369_10489163All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300012972|Ga0134077_10550878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300013306|Ga0163162_13147609All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300013308|Ga0157375_10186092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae2230Open in IMG/M
3300014969|Ga0157376_11702045All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300015201|Ga0173478_10740016All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300015373|Ga0132257_101733567All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300015374|Ga0132255_100931011All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300015374|Ga0132255_101721327All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300016319|Ga0182033_12174937All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300018431|Ga0066655_11281623All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300018433|Ga0066667_11424174All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium609Open in IMG/M
3300021404|Ga0210389_11020022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300021475|Ga0210392_10803992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300025165|Ga0209108_10493282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300025324|Ga0209640_10503881All Organisms → cellular organisms → Bacteria → Acidobacteria987Open in IMG/M
3300025901|Ga0207688_10668293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300025908|Ga0207643_11004506All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300025916|Ga0207663_10405188All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1044Open in IMG/M
3300025923|Ga0207681_10920179All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300025923|Ga0207681_11690636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300025924|Ga0207694_11132497All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia662Open in IMG/M
3300025930|Ga0207701_10947134All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300025933|Ga0207706_10094772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2626Open in IMG/M
3300025944|Ga0207661_10555963All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300025949|Ga0207667_11418194All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300025960|Ga0207651_12087360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae509Open in IMG/M
3300026023|Ga0207677_10212533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1546Open in IMG/M
3300026075|Ga0207708_10174056All Organisms → cellular organisms → Bacteria → Acidobacteria1706Open in IMG/M
3300026075|Ga0207708_10758013All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300026326|Ga0209801_1116715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_101146Open in IMG/M
3300027706|Ga0209581_1147470All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300027748|Ga0209689_1133291All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300027873|Ga0209814_10372665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300027873|Ga0209814_10469506All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300027882|Ga0209590_10176502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_101340Open in IMG/M
3300027907|Ga0207428_10885899All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300031231|Ga0170824_116511245All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031720|Ga0307469_11558396All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium634Open in IMG/M
3300031965|Ga0326597_10835878Not Available950Open in IMG/M
3300032001|Ga0306922_10693141All Organisms → cellular organisms → Bacteria → Acidobacteria1073Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere15.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.74%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.74%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.87%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.87%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009793Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10953075123300000559SoilGEAKSFKMRADVVNIWNTPQWGNPNSDINSSSFGRITTATGARSFIVNARVSF*
JGI1027J11758_1291350633300000789SoilLNKPQWGTPNTNINGTTFGRITSVVGNVQRLVTLNARIDF*
soilL1_1008595213300003267Sugarcane Root And Bulk SoilMRADVVNILNTPQWANPNMDINSGSFGRITSATGTRTVTLNARIDF*
soilH1_1021317613300003321Sugarcane Root And Bulk SoilRADAVNVLNRAQWGNPSTNLNGTTFGRITSVVGNIQRVVTLNARIDF*
Ga0058897_1114790913300004139Forest SoilGFLNKPIWGNPVTDINSATFGRITNASGARTVTLNARVDF*
Ga0063356_10072066023300004463Arabidopsis Thaliana RhizosphereADAINILNKPQWGLPSTNINSTTFGRITTATGSRTVLVNARVDF*
Ga0063356_10092625513300004463Arabidopsis Thaliana RhizosphereTIRGDVVNILNSPQWGNPNTDINSSSFGRITSATGTRTVTMNARIEF*
Ga0066395_1055375023300004633Tropical Forest SoilFTLRVDAVNILNITQWGNPNVQVNGATFGRITTVVGANNPQRTVTLNARFDF*
Ga0068868_10034855323300005338Miscanthus RhizosphereLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF*
Ga0068868_10077559823300005338Miscanthus RhizosphereADAVNVLNKPIWGNPNTDINSNSFGRITTAVGSRTVTISGRVDF*
Ga0070708_10197653323300005445Corn, Switchgrass And Miscanthus RhizosphereTIFTMRADAINLLNKPQWGLPDTNINSGTFGRITTATGSRTILLNARVDF*
Ga0070686_10054411223300005544Switchgrass RhizosphereSIRADAVNFLNTPVWGNPTTNINSTNFGKITTAGGARTITLSARIDF*
Ga0066707_1043126213300005556SoilDAINVLNRPNWGAPSTNVNSASFGRITTATGNRTITFNARLDF*
Ga0068855_10084185613300005563Corn RhizosphereRTKMTVRADIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNLRIDF*
Ga0068857_10069668713300005577Corn RhizosphereKTFTLRADVVNVLNKPQWNNPNTNINGATFGRITTVVGNAQRLVTFNARIDF*
Ga0070740_1022851023300005607Surface SoilKPQWGNPNTNINSTSFGRITTATGSRTVVVNGRFDF*
Ga0068861_10191529013300005719Switchgrass RhizosphereDAINMLNKAQWGPPDTNINSGTFGRITTATGSRTILLNARVDF*
Ga0066903_10129822013300005764Tropical Forest SoilDAVNVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARLDF*
Ga0066903_10264336723300005764Tropical Forest SoilIKENVRFTMRVDAINALNRPQWGNPNTDYNSAAFGRITDATGARTITFNSRIDF*
Ga0066903_10377237313300005764Tropical Forest SoilDAVNFLNKPMWADPVTDINSTTFGRITSAGGARMVTLNARVDF*
Ga0066903_10566000723300005764Tropical Forest SoilDAVNVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARIDF*
Ga0066903_10793728013300005764Tropical Forest SoilAVNVLNRPMWDIPNTDINSANFGRITTATGTRTIVINARVDF*
Ga0068863_10065278733300005841Switchgrass RhizosphereIRADAVNFLNTPVWGNPTTNINSTNFGKITTAGGARTITISARIDF*
Ga0066656_1014291413300006034SoilKSFTIRADAVNVLNRPVWGNPNTDINSNGFGRITTATGSRTITVGARVDF*
Ga0075417_1028636713300006049Populus RhizosphereNPSVNVNGSTFGRITTVVGNAPFQRQVTLTARIDF*
Ga0075417_1029746133300006049Populus RhizosphereVQVTEGIRFTIRADAINILNKPQWGAPITDINNPDFGLITQATGSRTITINARIDF*
Ga0070712_10204850823300006175Corn, Switchgrass And Miscanthus RhizosphereADAVNVLNKPQWGNPNTSINGTTFGRITAAGGARTVTLNARIDF*
Ga0079220_1025828323300006806Agricultural SoilVFRFRETKTFTVRADAINLLNKPQWGLPNTSINSTSFGQITTATGTRTITFNARIDF*
Ga0075428_10017861913300006844Populus RhizosphereNKPQWGNPNTNINGTTFGRITSVVGNAQRLVTLNARIDF*
Ga0075433_1147045623300006852Populus RhizospherePVWDNPNTDINSTTFGRITQHPTTTTGARTITINVRIDF*
Ga0075433_1167021713300006852Populus RhizosphereIRADAVNALNRPIWGNPNTNINSANFGRITTATGARTITISARLDF*
Ga0075433_1171915813300006852Populus RhizosphereMIRADAVNVLNHTVWGPPNPDINSASFGRITTATGARRIT
Ga0075434_10222149923300006871Populus RhizosphereMALTKKVRISEGKTFSLRADAANVLNKPIWGNPNTNINSTSFGRITTATGART
Ga0075424_10195641613300006904Populus RhizosphereLNKPQWGNPTLDINSLNFGRITTAAGSRTFTVNARVNF*
Ga0079219_1015794613300006954Agricultural SoilTITERTKVTLRADVINLLNKPQWGNPVTDINSASFGRINSATGNRTVTFNLRIDF*
Ga0075435_10148700123300007076Populus RhizosphereDNPNTDINSTSFGRITQHPLNTTGARTITINARIDF*
Ga0066710_10167656413300009012Grasslands SoilESKTFTLRADVVNVLNRPQWGDPNTNINGSTFGRITTVVGNAQRLVTLNARIDF
Ga0099827_1030224723300009090Vadose Zone SoilSEKTIFTLRADAINVLNKPQWGLPNTNINSAMFGRITTAMGSRMILLNGRVDF*
Ga0105240_1043067433300009093Corn RhizosphereADVINLLNIPQSGNPTTDINSASFGRINSATGNRTVTFNLRIDF*
Ga0105240_1075843623300009093Corn RhizosphereKPQWGNPTTDINSASFGRINTATGNRTITLNVRVDF*
Ga0111539_1274011413300009094Populus RhizosphereTSFTLRADAVNVLNKPQWGNPNMNINSASFGRITTATGARQITINLRLDF*
Ga0075418_1083456213300009100Populus RhizosphereWDDPETDINSANFGRITDVRNGTTRTITINARIDF*
Ga0075418_1223520513300009100Populus RhizosphereQKRVQVREGTSFTLRADAVNVLNKPQWGNPNMNINSASFGRITTATGARQITINLRLDF*
Ga0111538_1202122623300009156Populus RhizosphereWDNPNTDINSASFGRITQHPTNTTGARTITINARIDF*
Ga0075423_1206659423300009162Populus RhizospherePGRLGLDMALMKRVQVTEGIRFTIRADAINILNKPQWGAPITDINNPDFGLITQATGSRTITINARIDF*
Ga0075423_1304676123300009162Populus RhizosphereMAESRTIEIRADAVNALNRPVWGNPNLNINSANFGRITTATGARSITINLRVDF*
Ga0105242_1178351623300009176Miscanthus RhizosphereADVINLMNKPQWGNPVTDINSASFGRINTATGNRTVTFNVRLDF*
Ga0105238_1099546213300009551Corn RhizosphereTVRADIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF*
Ga0105077_11540223300009793Groundwater SandLNRPIWDNPNTDINSASFGRITGHPANTGARTITINARIDF*
Ga0126380_1027274813300010043Tropical Forest SoilAVNVLNRPVWDNPNTDINSASFGRITQHPMNPTITGARTITINARIDF*
Ga0126380_1072930713300010043Tropical Forest SoilSEGKTFTLRADAVNVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARIDF*
Ga0126382_1103429823300010047Tropical Forest SoilDSPTAANMDINSNSFGRITTATGSRTITINARIDF*
Ga0134070_1041286413300010301Grasslands SoilNRPIWGNPNMNINSATFGRITTATGNRTITFNARIDF*
Ga0134088_1000832263300010304Grasslands SoilGENKLFTLRTDAINVLNRPIWGNPNMNINSATFGRITTALGNRTITFNARVDF*
Ga0134088_1036926423300010304Grasslands SoilLNHPVWGDPNTDINSSLFGRITTATGSRTITLNARIDF*
Ga0126370_1019150533300010358Tropical Forest SoilQISVFNKPQWGLPNTYINLATFGRITTATGARTVTLNARVDF*
Ga0126376_1300763813300010359Tropical Forest SoilFTLRADAVNVLNKAQFGNPNVDINNVNFGRITTSSGNRMITFNARIDF*
Ga0126372_1092154613300010360Tropical Forest SoilLGIDAANVLNKPQWGNPSVNVNGSTFGRITTVVGNAPFQRQVTLTARIDF*
Ga0126372_1127580113300010360Tropical Forest SoilPQWGNPNVYINGSTFGRITTVVGDQQRLVTLNARIDF*
Ga0126378_1049331523300010361Tropical Forest SoilLNKPQWGNPSVNVNGSTFGRITTVVGNAPFQRQVILTARIDF*
Ga0126378_1082461433300010361Tropical Forest SoilPIFGNPNTNINSTSFGRITGLSTIGYPSRLVVLQGRLYF*
Ga0126378_1101906623300010361Tropical Forest SoilTIRADAVNVLNRPIWDIPNTDINADNFGRITTATGTRTIVINARVDF*
Ga0126378_1338178123300010361Tropical Forest SoilVLNKPQWGNPNMDINGTTFGRITTATGNRMVTLNARIDF*
Ga0126377_1306572413300010362Tropical Forest SoilKPQWGNPSVNVNGATFGRITTVVGNVQRLVTLNARIDF*
Ga0126379_1300000013300010366Tropical Forest SoilNRTQWGNPSTNINGTTFGRITSATGARTVTLNARIDF*
Ga0126383_1019184013300010398Tropical Forest SoilKTQWGNPSANVNGTTFGNITSVIGNVGRLVTLNARIDF*
Ga0126383_1214151313300010398Tropical Forest SoilAIRADAVNILNKPIWGNPSTNFNGANFGRITTAGGSRTVTLEGRIDF*
Ga0134123_1201121223300010403Terrestrial SoilLQKRVQVREGTSFTLRADAVNVLNKPQWGSPNMNINSASFGRITTATGARQITINLRLDF
Ga0134123_1255137223300010403Terrestrial SoilEGKTFAIRADAVNILNRPVWGNPSTNFNGANFGRITTAGGNRTVTLEARIDF*
Ga0150985_11744571933300012212Avena Fatua RhizosphereRADIINVLNKPQWGNPVTDINSASFGRINAATGNRTVTFNARIDF*
Ga0150985_11965674033300012212Avena Fatua RhizosphereLNKPQWGLPNTNINSTTFGRITTATGSRTILMNARVDF*
Ga0150984_11925890213300012469Avena Fatua RhizosphereADAINILNKPQWGLPNTNINSTTFGRITAATGSRAVLLGARVDF*
Ga0137398_1081601423300012683Vadose Zone SoilIGEGKSFTIRADAINALNRPVWGNPNTNINSTLFGRITSATGNRTITFSSRLDF*
Ga0137410_1007998723300012944Vadose Zone SoilAINVLNKPQWGLPNTNINSAMFGRITTATGSRMILLNGRVDF*
Ga0126369_1048916333300012971Tropical Forest SoilRTRLAARTTFTIRADAVNVLNRPMWDIPNTDINSDTFGRITTATGTRTIVINARVDF*
Ga0134077_1055087823300012972Grasslands SoilFTIRADAVNVLNRPIWDNPTAANMDINSPSFGRITTAGGARTITLNARIDF*
Ga0163162_1314760923300013306Switchgrass RhizosphereTERTKMTVRADVINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF*
Ga0157375_1018609233300013308Miscanthus RhizosphereRADVINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF*
Ga0157376_1170204513300014969Miscanthus RhizosphereTITERTKLTLRADIINLLNKPQWGNPTTDINSTSFGRINSATGNRTVTFNLRLDF*
Ga0173478_1074001623300015201SoilVNVLNKPQWNNPNTNINGATFGRITSVVGNQQRLVTFNARIDF*
Ga0132257_10173356723300015373Arabidopsis RhizosphereADAVNVLNRPIWDNPNTDINSATFGRITSATGTRTITMNARIDF*
Ga0132255_10093101123300015374Arabidopsis RhizosphereFTLRADAINILNKPQWGLPDTNINSTSFGRITTATGSRTILINARVDF*
Ga0132255_10172132713300015374Arabidopsis RhizosphereMTQFSNPNVNVNGATFGRITTVVGGNNPQRQVTLNARFDF*
Ga0182033_1217493723300016319SoilNKPQWGNPNTNINSTSFGRITTATGSRTVVLNGRLDF
Ga0066655_1128162313300018431Grasslands SoilRADVVNVLNKPQWGNPNTNINGSTFGRITTVVGNAQRLVTLNARIDF
Ga0066667_1142417413300018433Grasslands SoilFTLRADAINMLNKPQWGLPNTNINSSTFGRITTAMGSRTVVLNARVDF
Ga0210389_1102002213300021404SoilFNMAATKSVKISEGKTFTLRADAVNVLNKPQWGAPTASFNGTSFGRITSALGNRTVTLDARIDF
Ga0210392_1080399213300021475SoilRADAVNVLNRTQWGNPSTNVNGTTFGRITSVVGNVGRLVTLNARIEF
Ga0209108_1049328223300025165SoilLNTPQWGNPNTSIDSASFGRITSAGGTRSVTLSARFDF
Ga0209640_1050388113300025324SoilDLLNKPQWGNPNTDINSQNFGRITQSAGNRTITLTARFDF
Ga0207688_1066829313300025901Corn, Switchgrass And Miscanthus RhizosphereEGLSFTLRADAVNVLNKPQWGAPNMNINSSSFGRITTATGARTITINARVDF
Ga0207643_1100450623300025908Miscanthus RhizosphereKPQWGNPSTNFNGANFGRITTAIGSRTVTLEARIDF
Ga0207663_1040518813300025916Corn, Switchgrass And Miscanthus RhizosphereLLNKPQWGNPTTDINSASFGRINSASGNRTVTFNLRIDF
Ga0207681_1092017923300025923Switchgrass RhizosphereVLNTPVWGNPNTDINSNAFGRITTATGARTITLSGRIDF
Ga0207681_1169063623300025923Switchgrass RhizosphereARSFTIRADAVNVLNTPVWGNPNTDINSNSFGRITTATGARTVTVSARIDF
Ga0207694_1113249723300025924Corn RhizosphereLLNKPQWGNPVTDINSASFGRISAASGNRTVTFNARIDF
Ga0207701_1094713413300025930Corn, Switchgrass And Miscanthus RhizosphereRGDAVNVLNKPQWGAPNMNINSASFGRITTATGARTITINARIDF
Ga0207706_1009477213300025933Corn RhizosphereRADIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF
Ga0207661_1055596323300025944Corn RhizosphereTVRADIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF
Ga0207667_1141819413300025949Corn RhizosphereKTKVTLRADVINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNLRIDF
Ga0207651_1208736013300025960Switchgrass RhizosphereNAAAGKAFTLTERMKMTMRFDIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF
Ga0207677_1021253333300026023Miscanthus RhizosphereMTMRFDIINLLNKPQWGNPTTDINSASFGRINSATGNRTVTFNARIDF
Ga0207708_1017405623300026075Corn, Switchgrass And Miscanthus RhizosphereLCEQRFVEIRADAINALNRPVWGNPSTNINSANFGRITAASGARTITFSARVDF
Ga0207708_1075801313300026075Corn, Switchgrass And Miscanthus RhizosphereIRADAVNALNRPMWGTPNTNINSANFGRITTATGARTITFSARLDF
Ga0209801_111671523300026326SoilRISEKTIFTLRADAINVLNKPQWGLPNTNINSAMFGRITTAMGSRMILLNGRVDF
Ga0209581_114747023300027706Surface SoilKPQWGNPNTNINSTSFGRITTATGSRTVVVNGRFDF
Ga0209689_113329123300027748SoilRADAINLLNTPQWDIPNTDINSPSFGRITKERVPGSRTILLNARVDF
Ga0209814_1037266513300027873Populus RhizosphereNILNITQWSNPNVNVNGATFGRITTVVGANNPQRTVTLNARFDF
Ga0209814_1046950613300027873Populus RhizosphereADAINILNKPQWGAPITDINNPDFGLITQATGSRTITINARIDF
Ga0209590_1017650213300027882Vadose Zone SoilSFTLRGDAVNVLNKPQWGLPNTNINSAMFGRITTAMGSRMILLNGRVDF
Ga0207428_1088589913300027907Populus RhizospherePVWGNPNTDINSNAFGRITTATGARTITLSGRIDF
Ga0170824_11651124513300031231Forest SoilLNSPQWGYSLQAGGPVTDINNPNFGLITAAGGARTITINARIDF
Ga0307469_1155839623300031720Hardwood Forest SoilTKLTFRADVINLLNKPQWGNPTTDINSASFGRINTATGNRTVTLNARIDF
Ga0326597_1083587813300031965SoilNMLNNPQFGNPNTNMYSNNFGRITGAGGARQFTLNARIDF
Ga0306922_1069314113300032001SoilKPQWGLPVTNINSATFGRITTATGNRTVTFNARLDF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.