| Basic Information | |
|---|---|
| Family ID | F080276 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ITAAYPEADRIRCYEYSVDDEFAREVAPLVRSGEKWLPGA |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 8.70 % |
| % of genes from short scaffolds (< 2000 bps) | 8.70 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.043 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.261 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.130 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.609 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 36.76% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF05199 | GMC_oxred_C | 4.35 |
| PF00903 | Glyoxalase | 4.35 |
| PF07452 | CHRD | 3.48 |
| PF00067 | p450 | 3.48 |
| PF02774 | Semialdhyde_dhC | 2.61 |
| PF13563 | 2_5_RNA_ligase2 | 1.74 |
| PF03641 | Lysine_decarbox | 1.74 |
| PF07690 | MFS_1 | 0.87 |
| PF07662 | Nucleos_tra2_C | 0.87 |
| PF00701 | DHDPS | 0.87 |
| PF13546 | DDE_5 | 0.87 |
| PF03092 | BT1 | 0.87 |
| PF03328 | HpcH_HpaI | 0.87 |
| PF13551 | HTH_29 | 0.87 |
| PF01850 | PIN | 0.87 |
| PF00271 | Helicase_C | 0.87 |
| PF13586 | DDE_Tnp_1_2 | 0.87 |
| PF01243 | Putative_PNPOx | 0.87 |
| PF01050 | MannoseP_isomer | 0.87 |
| PF06186 | DUF992 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 4.35 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 3.48 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 2.61 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 2.61 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 1.74 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 0.87 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.87 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.04 % |
| All Organisms | root | All Organisms | 6.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005541|Ga0070733_10795487 | Not Available | 635 | Open in IMG/M |
| 3300009012|Ga0066710_103802224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300016357|Ga0182032_10393966 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300020581|Ga0210399_11583443 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021560|Ga0126371_10862841 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300026550|Ga0209474_10354469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300027729|Ga0209248_10134430 | Not Available | 740 | Open in IMG/M |
| 3300031793|Ga0318548_10652108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300031941|Ga0310912_10675610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300032090|Ga0318518_10690237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 2A | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.74% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.87% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF026 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1004999702 | 3300002245 | Forest Soil | TAAYPEADRIRCYEYSVDDEFAREVAPLIRSGAKWLPGA* |
| Ga0062384_1007054751 | 3300004082 | Bog Forest Soil | EALAAIAAAYPEADRVRCYEYTVDDEFAREVAPLVRSGKDWLPGA* |
| Ga0062388_1010346011 | 3300004635 | Bog Forest Soil | LAEALAAIAAAYPEADLIRCYEYLVDDEYTREVAPLLRSGERWLPEA* |
| Ga0068869_1001256631 | 3300005334 | Miscanthus Rhizosphere | EALDAIGSAFPDIARIRCYEYTVDNEFPVEVPPLICSGDKWRPAG* |
| Ga0070733_107954871 | 3300005541 | Surface Soil | EALAAIEAAYPETGRIRCYEYTVDDEFAREAAVLVKSNGKWAPSEEPS* |
| Ga0066661_108707321 | 3300005554 | Soil | ADRVRCYEYSVDDEFAREVAPLIRSGEKWLPGSQ* |
| Ga0081455_107772752 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ALAAIGAAYPAADRIRCYEYTVDDEFAREVAPLVRSGEKWAPGG* |
| Ga0070717_108989721 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RIRCYEYTVDDEYAREVAPLIRSGDKWLPGEDLA* |
| Ga0066696_106521411 | 3300006032 | Soil | DEALAAIDAAYPDADRIRCYEYTIDDEFAREVAPLIKSAGNWRPDRSEA* |
| Ga0070765_1001362371 | 3300006176 | Soil | YRDADHIRCYEYTVDDEYAREVAPLVKSSGKWQPGDSPRP* |
| Ga0079222_125523022 | 3300006755 | Agricultural Soil | AAITAAYPDADRIRCYEYSVDDEFAREVAPLVRSGEKWVPGS* |
| Ga0075431_1019891102 | 3300006847 | Populus Rhizosphere | AAYPAADHIRCYEYSVDDEFAREVAPLLRSGEKWVPGA* |
| Ga0073928_111378911 | 3300006893 | Iron-Sulfur Acid Spring | SAAALAAIMAAYPEAERIRCYEYSVDDEFAREVPPLVRSGEKWLPGG* |
| Ga0099793_107073871 | 3300007258 | Vadose Zone Soil | LAAIGTAYPDADRIRCYEYTVDDEYAREVAPLLKSGDKWRPADGSA* |
| Ga0066710_1038022241 | 3300009012 | Grasslands Soil | EALAAIDAACPEADRIRCYEYTVDDEYAREVAALVKSGDRWRPGVSPPAEDA |
| Ga0099827_102821583 | 3300009090 | Vadose Zone Soil | LWEALAAIDAACPEADRIRCYEYTVDDEYAREVAPLVRAGDKWRPEGTR* |
| Ga0066709_1030318591 | 3300009137 | Grasslands Soil | ALVAIDAAYPNAERIRCYEYTVDDEFAREVAPLIKSNRKWRPLDGMQN* |
| Ga0126306_118897441 | 3300010166 | Serpentine Soil | EALAAIDAAYPQAERIRCYEYTVDDEYAREVAPLAKSGGKWRPRVDPR* |
| Ga0126379_121845682 | 3300010366 | Tropical Forest Soil | AAYPDAQRIRCYEYSVDDEFAREVTPLVRSGEKWVPGV* |
| Ga0126381_1011697041 | 3300010376 | Tropical Forest Soil | PDAQRIRCYEYSVDDEFAREVTLLVRSGDKWAPGG* |
| Ga0126381_1041922572 | 3300010376 | Tropical Forest Soil | AVQRIRCYEYSVDNEFPVEVAPLVRSGDKWLPGA* |
| Ga0134121_115586201 | 3300010401 | Terrestrial Soil | LGEALDAIGSAFPEIDRIRCYEYTVDNEFPVEAPPLVRSGDKWRPAG* |
| Ga0137393_102821903 | 3300011271 | Vadose Zone Soil | GALAAIVAAYPEADRIRCYEYSVDNEFPVEVAPLVRSGEKWVPGA* |
| Ga0137393_106521872 | 3300011271 | Vadose Zone Soil | GALAAIVAAYPEADRIRCYEYSVDNEFPVEVAPLVRSGEKWLPGA* |
| Ga0150985_1083708522 | 3300012212 | Avena Fatua Rhizosphere | AIRAAYPETDRIRCYEYSVDDEFAREVPPLVRSGEKWLPGG* |
| Ga0137387_112828802 | 3300012349 | Vadose Zone Soil | AAIMAAYPEADRIRCYEYSVDNEFPVEVATLLRSGEKWLPGA* |
| Ga0137384_104011402 | 3300012357 | Vadose Zone Soil | ISAAYPEVDRIRCYEYSVDNEFPVEVAPLLRSGEKWLPDA* |
| Ga0137361_103121372 | 3300012362 | Vadose Zone Soil | MAAYPEADRIRCYEYSVDNEFPVEVAPLLRSGEKWLPGA* |
| Ga0137398_102775001 | 3300012683 | Vadose Zone Soil | ALAAITAAYPQAHRIGCYEYSVDNEFPVEVAPLLWSGEKWVPEG* |
| Ga0137404_104504282 | 3300012929 | Vadose Zone Soil | IAAAYPEADRIRCYEYSIDNEFPVEVAPLLRSGEKWLPGA* |
| Ga0126369_119790152 | 3300012971 | Tropical Forest Soil | YPEAQRIRCYEYSVDNEFPVEVAPLLRSGEKWIPGT* |
| Ga0134077_105001702 | 3300012972 | Grasslands Soil | AAYPEAERIRCYEYSVDNEFPVEVAPLVRSGEKWLPGA* |
| Ga0157379_114976171 | 3300014968 | Switchgrass Rhizosphere | IETAHPEVGRIRCYEYTVDDEYAREVAPLVRSAEGWRPEGGR* |
| Ga0182041_105595312 | 3300016294 | Soil | AYPEADRICCYEYTVDDEFAREVAPLVRTGDKWLSGA |
| Ga0182033_120177391 | 3300016319 | Soil | YPEADRIGCYEYTVDDEFAREVAPLVRSGKNWMPVV |
| Ga0182032_103939661 | 3300016357 | Soil | FGTLAEALAAITAAYPHAARIRCYEYTVDDEFAREVRPLVRSGASWLPGV |
| Ga0182034_108240822 | 3300016371 | Soil | AAYPEADHIRCYEYTVDDEFAREVAPLERSGEKWVPDA |
| Ga0187814_104296513 | 3300017932 | Freshwater Sediment | HPKAQRIRCYEYSVDDEFAREVPPLVRSGDNWQPGV |
| Ga0187817_106742251 | 3300017955 | Freshwater Sediment | AMSIRCYEYSVDNEYPVEAALLVRSQGKWLPAGDISH |
| Ga0066655_103273123 | 3300018431 | Grasslands Soil | YPEADRIRCYEYSVDDEYAREVAPLVRSGEKWLPGS |
| Ga0193751_12265412 | 3300019888 | Soil | AAIAAAHPAAERIRCYEYTVDDEYPVEVAPLVRSGDKWRPADNPSP |
| Ga0210403_105095882 | 3300020580 | Soil | ITAAYPEADRIRCYEYSVDDEFAREVAPLIRSGAKWLPGA |
| Ga0210399_115834432 | 3300020581 | Soil | FETLAEALAAITAAYPEAERIRCYEYSVDDEFAREVAPLLRSGEKWVPGT |
| Ga0210404_102452962 | 3300021088 | Soil | PEAERIRCYEYSVDNEFPVEVAPLLRSGEKWVPGT |
| Ga0210400_103534153 | 3300021170 | Soil | ILAAYPEADRIRCYEYSVDNEFPVEVAPLVRSAEKWLPGA |
| Ga0210400_110200861 | 3300021170 | Soil | IMAAYPEADRIRCYEYSVDDEFAREVAPLLRSGEKWLPGA |
| Ga0210396_103547101 | 3300021180 | Soil | ITAAYPEADRIRCYEYSVDDEFAREVAPLVRSGEKWLPGA |
| Ga0213879_101402942 | 3300021439 | Bulk Soil | EADRIRCYEYSVDDEFAREVAPLLRCGEKWLPGGA |
| Ga0213879_101488432 | 3300021439 | Bulk Soil | LVAVTAAYPGAERIRCYEYTVDDEFAREVAPLLRSGEKWTPAA |
| Ga0126371_108628411 | 3300021560 | Tropical Forest Soil | DFDTLAEALAAITAAHPGADRIRCYEYTVDDEFAREVAPLVRSGENWLPGA |
| Ga0242648_10098542 | 3300022506 | Soil | GALAAIAAAYPEADRIRCYEYSVDDEYAREVAPLLRSGEKWLPAV |
| Ga0242669_10362862 | 3300022528 | Soil | ALAAIAAAYPEADRIRCYEYSVDDEYAREVAPLLRSGEKWLPAV |
| Ga0242668_10135002 | 3300022529 | Soil | AAYPEADRIRCYEYSVDDEFAREVAPLVRSGEEWLPGA |
| Ga0242671_11292542 | 3300022714 | Soil | YPEADRIRCYEYSVDDEYAREVAPLLRSGEKWLPAV |
| Ga0207663_101159611 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TLATALAAIMAAYPEAERIRCYEYSVDDEFAREVPPLVRSGEKWLPGG |
| Ga0207664_115139612 | 3300025929 | Agricultural Soil | LAAIDAAYPDAVRIRCYEYTVDDEFAREVAPLVKSTGKWRPDSSR |
| Ga0207690_101141811 | 3300025932 | Corn Rhizosphere | LNTSTSFPDIARIRCYEYTVDNEFPVEVPPLIRSGDKWRPAG |
| Ga0207668_113244321 | 3300025972 | Switchgrass Rhizosphere | EALDAIGSAFPDIARIHCYEYTVDNEFPVEAPPLVRSGDKWRPAG |
| Ga0209474_103544692 | 3300026550 | Soil | KTLAEALAAIKASYPDADRIRCYEYTVDDEFAREVAPLVRSGGKWRPGEGPA |
| Ga0209474_105165771 | 3300026550 | Soil | DEALAAIDAAYPDADRIRCYEYTIDDEFAREVAPLIKSAGNWRPDRSEA |
| Ga0207949_10047431 | 3300026999 | Forest Soil | AIMAAYPEADRIRCYEYSVDDEFAREVAPLVRSGENWAPGA |
| Ga0208726_1030352 | 3300027099 | Forest Soil | LAEALAAIMAAYPEADRIRCYEYSVDNEFPVEVAPLLRSGEKWLPGD |
| Ga0209248_101344301 | 3300027729 | Bog Forest Soil | DFDTLAEALAAITAAYPEADRIRCYEYSVDDEFAREVAPLVRSGENWVPGT |
| Ga0209074_102869591 | 3300027787 | Agricultural Soil | IMAAYPEADRIRCYEYSVDNEFPVEVAPLLRSGKKWLPGA |
| Ga0209726_104756732 | 3300027815 | Groundwater | AAAHPEIDRIRCYEYTVDDEYAREVAPLVRSGDKWRPDSSR |
| Ga0209773_100946712 | 3300027829 | Bog Forest Soil | LAEALAAIAAAYPEADRIRCYEYSVDDEFAREAAPLLRSGEKWLPGA |
| Ga0209488_109277431 | 3300027903 | Vadose Zone Soil | ALASFGAAYPDIERIRCYEYTIDDEYAREVAPLVKSGDKWLPGAGPRAS |
| Ga0209006_104357782 | 3300027908 | Forest Soil | LAEALAAITAAYPEADRIRCYEYSVDDEFAREVAPLIRSGAKWLPGA |
| Ga0209526_102993191 | 3300028047 | Forest Soil | YPEADRIRCYEYSVDDEFAREVAPLVRSGEKWLPGA |
| Ga0170819_149763851 | 3300031469 | Forest Soil | YPESDRIRCYEYSVDDEFAREVAPLVRSGENWAPGA |
| Ga0318573_106451351 | 3300031564 | Soil | LAEAIAAITAAYPEADQIRCYEYTVDDEFAREVAPLLRSGEKWTPAA |
| Ga0310915_102003883 | 3300031573 | Soil | ASLAEALAAITAAYPEADRIRCYEYTVDNEFPVEVAPLLRSGEKWRPGA |
| Ga0318572_103518003 | 3300031681 | Soil | LAAITAAYPKADRIRCYEYSVDNEFPVEVTPLLRSGEKWLPDA |
| Ga0318572_104258782 | 3300031681 | Soil | AYPDADRIRCYEYTVDDEFAREVAPLLRTGEKWMPAA |
| Ga0318493_103311281 | 3300031723 | Soil | AITAAYPEADRIRCYEYTIDDEFAREVAPLLRIGEKWMPAA |
| Ga0306918_113371272 | 3300031744 | Soil | AAYPEARRIRCYEYSVDDEFAREVAPLVRSGENWLPSA |
| Ga0318502_101603382 | 3300031747 | Soil | AAITAAYPGASRTRCYEYSVDNEFPVEVAPLIRSGDNWLPGT |
| Ga0307475_107472461 | 3300031754 | Hardwood Forest Soil | AYPEADRIRCYEYSVDDEYAREVAPLLRSGEKWLPAV |
| Ga0318509_100488211 | 3300031768 | Soil | YPEADRIRCYEYSVDNEFPVEVTPLLRSGEKWLPDA |
| Ga0318546_100020328 | 3300031771 | Soil | AAYPEADRIRCYEYTIDDEFAREVAPLLRIGEKWMPAA |
| Ga0318546_106910072 | 3300031771 | Soil | LAAITAAYPTAHRIRCYEYTVDDEFAREAAPLVRSGESWRPGV |
| Ga0318543_100005578 | 3300031777 | Soil | DIAQALAAITAAYPEADRIRCYEYTIDDEFAREVAPLLRIGEKWMPAA |
| Ga0318508_10409151 | 3300031780 | Soil | PAAYPEADRIRCYEYTIDDEFAREVAPLLRIGEKWMPAA |
| Ga0318548_106521082 | 3300031793 | Soil | TLAEALAAITAAYPKADRIRCYEYSVDNEFPVEVTPLLRSGEKWLPDA |
| Ga0318557_102563333 | 3300031795 | Soil | ALAAITAAYPKADRIRCYEYSVDNEFPVEVTPLLRSGEKWLPDA |
| Ga0318568_105731932 | 3300031819 | Soil | REALAAISAACPEADRIRCYEYSVDNEFPVEVAPLMRSGTNWLPGP |
| Ga0318567_106869391 | 3300031821 | Soil | ITAAYPEAHRIRCYEYSVDDEFARAVAPLVRSGEKWVSDA |
| Ga0310892_105156191 | 3300031858 | Soil | AIGSAFPEIDRVRCYEYTVDNEFPVEVPPLVRSGDKWRPAG |
| Ga0306919_102000601 | 3300031879 | Soil | AITAAYPEADRIGCYEYSVDDEFAREVAPLVRSGEKWLPAGDPSC |
| Ga0306919_102854423 | 3300031879 | Soil | DTLTEALAAIAAAYPEADRIRCYEYTVDDEFAREVRPLVRSGEKWMSGA |
| Ga0306919_106515712 | 3300031879 | Soil | ALAAITAGYPDANRIRCYEYTVDDEFAREVGPLVRSGEKWVPDV |
| Ga0306925_101551371 | 3300031890 | Soil | AAYPEADRIRCYEYTVDNEFPVEVAPLLRSGEKWRPGA |
| Ga0318551_100078926 | 3300031896 | Soil | AQALAAIPAAYPEADRIRCYEYTIDDEFAREVAPLLRIGEKWMPAA |
| Ga0318551_101046051 | 3300031896 | Soil | ALEAITAAYPEADRIPCYEYTVDDEFAREVAPLVRSGKNWVSSA |
| Ga0318551_107128251 | 3300031896 | Soil | YPKADRIRCYEYSVDNEFPVEVTPLLRSGEKWLPDA |
| Ga0306921_123637872 | 3300031912 | Soil | AAITAAYPEADRIGCYEYTVDDEFAREVAPLVRSGKNWMPVV |
| Ga0310912_106756101 | 3300031941 | Soil | DTLTDALAAITAAYPKADRIRCYEYSVDNEFPVEVTPLLRSGEKWLPDA |
| Ga0310913_110144661 | 3300031945 | Soil | TAAYPEVDRIRCYEYTVDDEFAREVAPLVRSGKNWMPVA |
| Ga0310910_101280081 | 3300031946 | Soil | YPEAQRIRCYEYTVDDEFAREVAPLVRSGENWLPGA |
| Ga0310910_105738161 | 3300031946 | Soil | AYPKADHIRCYEYSVDDEFAREVAPLVRSGEKWASGV |
| Ga0310909_116503601 | 3300031947 | Soil | LAAITAGYPDANRIRCYEYTVDDEFAREVGPLVRSGEKWVPDV |
| Ga0306926_105787532 | 3300031954 | Soil | AAYSEARRIRCYEYSVDDEFAREVAPLVRSGENWLPSA |
| Ga0307479_116441441 | 3300031962 | Hardwood Forest Soil | PEADRIRCYEYSVDNEFPVEVAPLLRSGEKWLPGG |
| Ga0318569_103264661 | 3300032010 | Soil | EALEAITAAYPEADRIPCYEYTVDDEFAREVAPLVRSGKNWVSSA |
| Ga0318507_102259071 | 3300032025 | Soil | PEADRIRCYEYSVDNEFPVEVAPLMRSGTNWLPGP |
| Ga0318532_101810652 | 3300032051 | Soil | TLAEALAAITAAYPEAQRIRCYEYTVDDEFAREVAPLVRSGENWLPGA |
| Ga0318506_103304651 | 3300032052 | Soil | LADALAAITAAYPEAHRIRCYEYSVDDEFARAVAPLVRSGENWVSGA |
| Ga0318533_100894082 | 3300032059 | Soil | AISAACPEADRIRCYEYSVDNEFPVEVAPLMRSGTNWLPGP |
| Ga0318514_105528772 | 3300032066 | Soil | LADALAAITAAYPEAHRIRCYEYSVDDEFARAVAPLVRSGEKWVSDA |
| Ga0318553_103185253 | 3300032068 | Soil | TAAYPKADRIRCYEYSVDNEFPVEVTPLLRSGEKWLPDA |
| Ga0318518_106902372 | 3300032090 | Soil | TGDFDTLVEALEAITAAYPEADRIPCYEYTVDDEFAREVAPLVRSGKNWVSSA |
| Ga0318577_100562501 | 3300032091 | Soil | PEAHRIRCYEYSVDDEFARAVAPLVRSGEKWVSDA |
| Ga0318540_100534301 | 3300032094 | Soil | LADALAAITAAYPEADRIRCYEYSVDDEFARAVAPLVRSGENWVSGA |
| Ga0318540_100769413 | 3300032094 | Soil | PEADRIPCYEYTVDDEFAREVAPLVRSGKNWVSSA |
| Ga0307470_117812061 | 3300032174 | Hardwood Forest Soil | AAITAAYPEADRIRCYEYSVDNEFPVEVAPLLRSGEKWLPGA |
| ⦗Top⦘ |