NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080270

Metagenome / Metatranscriptome Family F080270

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080270
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 44 residues
Representative Sequence MAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPA
Number of Associated Samples 102
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.13 %
% of genes near scaffold ends (potentially truncated) 99.13 %
% of genes from short scaffolds (< 2000 bps) 95.65 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.696 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.087 % of family members)
Environment Ontology (ENVO) Unclassified
(36.522 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.391 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 0.00%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF09123DUF1931 36.52
PF06897DUF1269 9.57
PF07992Pyr_redox_2 6.96
PF02467Whib 4.35
PF00196GerE 3.48
PF13367PrsW-protease 2.61
PF00012HSP70 1.74
PF03358FMN_red 1.74
PF02148zf-UBP 0.87
PF02781G6PD_C 0.87
PF13738Pyr_redox_3 0.87
PF01066CDP-OH_P_transf 0.87
PF02787CPSase_L_D3 0.87
PF00479G6PD_N 0.87
PF00011HSP20 0.87
PF03729DUF308 0.87
PF13556HTH_30 0.87
PF01569PAP2 0.87
PF13191AAA_16 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG4803Uncharacterized membrane proteinFunction unknown [S] 9.57
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 1.74
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 1.74
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.87
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.87
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.87
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.87
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.87
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.70 %
UnclassifiedrootN/A31.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ01DA3PIAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300002245|JGIcombinedJ26739_101077468Not Available690Open in IMG/M
3300002245|JGIcombinedJ26739_101265092Not Available628Open in IMG/M
3300003505|JGIcombinedJ51221_10196062All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300005330|Ga0070690_100171087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1495Open in IMG/M
3300005340|Ga0070689_100607822All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300005435|Ga0070714_101204806All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005435|Ga0070714_101322656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia703Open in IMG/M
3300005602|Ga0070762_10467327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales822Open in IMG/M
3300005610|Ga0070763_10701298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300005921|Ga0070766_11118376All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300006028|Ga0070717_10983185All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300006028|Ga0070717_11290330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300006176|Ga0070765_100267112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1573Open in IMG/M
3300006176|Ga0070765_101581787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300006852|Ga0075433_11352086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia617Open in IMG/M
3300007788|Ga0099795_10059249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1416Open in IMG/M
3300009092|Ga0105250_10299442Not Available695Open in IMG/M
3300009522|Ga0116218_1387588All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300009524|Ga0116225_1549735Not Available512Open in IMG/M
3300009525|Ga0116220_10129688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300009545|Ga0105237_11971410All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300009792|Ga0126374_10539615Not Available849Open in IMG/M
3300010373|Ga0134128_11440323All Organisms → cellular organisms → Bacteria → Terrabacteria group758Open in IMG/M
3300010866|Ga0126344_1075263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1599Open in IMG/M
3300010876|Ga0126361_10748695All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300011120|Ga0150983_12485535All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300011120|Ga0150983_15750525Not Available501Open in IMG/M
3300012189|Ga0137388_10062787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3062Open in IMG/M
3300012206|Ga0137380_10730446Not Available858Open in IMG/M
3300012361|Ga0137360_10724983All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300012362|Ga0137361_10331976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1394Open in IMG/M
3300012683|Ga0137398_10034927All Organisms → cellular organisms → Bacteria2880Open in IMG/M
3300013105|Ga0157369_10939143All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300017924|Ga0187820_1133004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300017926|Ga0187807_1116130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300017926|Ga0187807_1197609All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300017928|Ga0187806_1077662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1038Open in IMG/M
3300017933|Ga0187801_10432133Not Available550Open in IMG/M
3300017937|Ga0187809_10159714All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300017942|Ga0187808_10190556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300017942|Ga0187808_10359104Not Available662Open in IMG/M
3300017993|Ga0187823_10309958All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300018007|Ga0187805_10357683All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300019887|Ga0193729_1199205Not Available684Open in IMG/M
3300020579|Ga0210407_10970933All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300020582|Ga0210395_10546616Not Available871Open in IMG/M
3300020582|Ga0210395_11418512Not Available506Open in IMG/M
3300021086|Ga0179596_10657871Not Available531Open in IMG/M
3300021088|Ga0210404_10006513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4704Open in IMG/M
3300021168|Ga0210406_10365783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1161Open in IMG/M
3300021171|Ga0210405_10644573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300021180|Ga0210396_10702580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300021384|Ga0213876_10674969Not Available550Open in IMG/M
3300021401|Ga0210393_10708935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300021402|Ga0210385_10658031Not Available801Open in IMG/M
3300021403|Ga0210397_10689925All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300021403|Ga0210397_11608850All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300021404|Ga0210389_10909560All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300021406|Ga0210386_11240050All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300021407|Ga0210383_11140291Not Available657Open in IMG/M
3300021420|Ga0210394_10515318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1052Open in IMG/M
3300021432|Ga0210384_10336444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1359Open in IMG/M
3300021433|Ga0210391_10556179All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300021433|Ga0210391_11038587All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300021477|Ga0210398_10210684All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300021479|Ga0210410_11112091All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300023056|Ga0233357_1018812All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300024283|Ga0247670_1041736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria826Open in IMG/M
3300025898|Ga0207692_10784706Not Available622Open in IMG/M
3300025901|Ga0207688_11026940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria521Open in IMG/M
3300025903|Ga0207680_11364457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria503Open in IMG/M
3300025904|Ga0207647_10780367All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300025915|Ga0207693_11031329All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300025981|Ga0207640_10534139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M
3300026078|Ga0207702_12417506Not Available512Open in IMG/M
3300026088|Ga0207641_12412463Not Available525Open in IMG/M
3300026294|Ga0209839_10230267Not Available587Open in IMG/M
3300026304|Ga0209240_1005193All Organisms → cellular organisms → Bacteria4925Open in IMG/M
3300026356|Ga0257150_1015918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1041Open in IMG/M
3300026489|Ga0257160_1024027Not Available977Open in IMG/M
3300026498|Ga0257156_1055964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300026498|Ga0257156_1085943Not Available653Open in IMG/M
3300026899|Ga0209326_1004115Not Available1103Open in IMG/M
3300027030|Ga0208240_1016259All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300027037|Ga0209005_1014265All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300027168|Ga0208239_1023100All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300027297|Ga0208241_1017833Not Available1045Open in IMG/M
3300027439|Ga0209332_1097174Not Available528Open in IMG/M
3300027502|Ga0209622_1036321Not Available885Open in IMG/M
3300027505|Ga0209218_1054095Not Available813Open in IMG/M
3300027604|Ga0208324_1092405Not Available850Open in IMG/M
3300027738|Ga0208989_10286409Not Available529Open in IMG/M
3300027775|Ga0209177_10115636Not Available871Open in IMG/M
3300027817|Ga0209112_10084652Not Available1009Open in IMG/M
3300027855|Ga0209693_10155130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1130Open in IMG/M
3300027884|Ga0209275_10229131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300027895|Ga0209624_11062469Not Available522Open in IMG/M
3300028047|Ga0209526_10955878Not Available516Open in IMG/M
3300028072|Ga0247675_1013102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1172Open in IMG/M
3300028906|Ga0308309_10120604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2065Open in IMG/M
3300028906|Ga0308309_11104829All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300030520|Ga0311372_11581901All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300030906|Ga0302314_11080150All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300030980|Ga0074027_10197708Not Available534Open in IMG/M
3300031022|Ga0138301_1869336All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300031035|Ga0074026_11281604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1256Open in IMG/M
3300031525|Ga0302326_12019087All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300031823|Ga0307478_10277785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1367Open in IMG/M
3300031823|Ga0307478_10568787Not Available947Open in IMG/M
3300032515|Ga0348332_12576361Not Available596Open in IMG/M
3300032782|Ga0335082_10192786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1941Open in IMG/M
3300032805|Ga0335078_11615221All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300032895|Ga0335074_10815337All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300032898|Ga0335072_10808101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia895Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.09%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil14.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment8.70%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.09%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.74%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.87%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.87%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.87%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026899Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027030Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes)EnvironmentalOpen in IMG/M
3300027037Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027168Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_021999702170459024Grass SoilMANLPIRRGGRRTHLVNPSREFEDIYDRMGQLMNMAVGPVGPVAVVDLPWVPLP
JGIcombinedJ26739_10107746823300002245Forest SoilMAQLPARRNARNVTLVSPSREFEDIYDRMGQLLNLTFG
JGIcombinedJ26739_10126509213300002245Forest SoilMAQLPARRNARNVTLVSPSREFEDIYDRMGQLLSLTFGD
JGIcombinedJ51221_1019606223300003505Forest SoilMASLPIRRTGRNQTLMNPTREFEDIYDRMGQLMNFAFGGLTPVALADMPWAPLG
Ga0070690_10017108713300005330Switchgrass RhizosphereMAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPTAD
Ga0070689_10060782233300005340Switchgrass RhizosphereMLMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFG
Ga0070714_10120480633300005435Agricultural SoilMAVLPVRRGGRNTNAMVVNPSREFEDIYDRMGQLMNFAFGLT
Ga0070714_10132265613300005435Agricultural SoilMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPWV
Ga0070762_1046732733300005602SoilMAALPVRRGGRNSMVVNPSREFEDIYDRMGQLMNFAFGLTPAVLA
Ga0070763_1070129823300005610SoilMATLLPVRRSGRNQNLMNPSREFEDIYDRMGQLMNF
Ga0070766_1111837613300005921SoilMATLLPVRRSGRNQNLMNPSREFEDVYDRMGQLMNFAF
Ga0070717_1098318513300006028Corn, Switchgrass And Miscanthus RhizosphereMAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFA
Ga0070717_1129033023300006028Corn, Switchgrass And Miscanthus RhizosphereMAMLPVQRSGRNLTVVNPSREFEDIYDRMGQLMNLAFGLAPVDVAE
Ga0070765_10026711213300006176SoilMATLLPVRRSGRNQNLMNPSREFEDVYDRMGQLMNFAFGGLTPAD
Ga0070765_10158178723300006176SoilMAALPVRRGGRNSMVVNPSREFEDIYDRMGQLMNFAFGLT
Ga0075433_1135208623300006852Populus RhizosphereMAALPARRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGLTP
Ga0099795_1005924913300007788Vadose Zone SoilMAALPVRRGGRNTSLVNPSREFEDIYDRMGQLVNFAFGDMARVEMPWVP
Ga0105250_1029944213300009092Switchgrass RhizosphereMLMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPW
Ga0116218_138758823300009522Peatlands SoilMAALPVRRGGRNTSVVSPSREFEDIYDRMGQLMNFAFG
Ga0116225_154973523300009524Peatlands SoilMASLPIRRTGRNQTLMNPTREFEDIYDRMGQLMNFAFGLTPAALAD
Ga0116220_1012968813300009525Peatlands SoilMAALPVRRGGRNTSVVSPSREFEDIYDRMGQLMNFAFGLTPAAL
Ga0105237_1197141023300009545Corn RhizosphereMAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVP
Ga0126374_1053961513300009792Tropical Forest SoilMAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGDLARVEMPWVP
Ga0134128_1144032313300010373Terrestrial SoilMAMLPTRRGGQSLTIIDPSREFEDIYNRMGQLMDLALGD
Ga0126344_107526313300010866Boreal Forest SoilMAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAF
Ga0126361_1074869533300010876Boreal Forest SoilMAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPAALADMPW
Ga0150983_1248553523300011120Forest SoilMAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPSA
Ga0150983_1575052523300011120Forest SoilMAALPARRSGRTPTVVNPSREFEDIYDRMGQLMNFAFGLPPGALADMPWIPL
Ga0137388_1006278753300012189Vadose Zone SoilMAALPVRRGGQGLTVLNPSREFEDIYNRMGQLMNLALGDF
Ga0137380_1073044623300012206Vadose Zone SoilMAQLPARRGGPGTTAVSPFREFEDIYDRMGQLINFAFG
Ga0137360_1072498323300012361Vadose Zone SoilMVSLPVRRGGQGLTVLNPSREFEDIYNRMGQMMNLA
Ga0137361_1033197623300012362Vadose Zone SoilMAQLPARRSARNISLVDPSREFEDIYDRMGQLMSMAF
Ga0137398_1003492713300012683Vadose Zone SoilMAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMSFAFGDLGLARPGSAPWSP
Ga0157369_1093914323300013105Corn RhizosphereMAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPTAD
Ga0187820_113300413300017924Freshwater SedimentMAALPVRRGRQNTSVVNPSREFEDIYDRMGQLMNFAFGLTPAALAD
Ga0187807_111613033300017926Freshwater SedimentMAALPVRRGGRNTNTMVVNPSREFEDIYDRMGQLMNFAFGLT
Ga0187807_119760913300017926Freshwater SedimentMAMLPVRRSGGRNLTVVNPSREFEDIYDRMGQLMNLAFGLNPIDGADGAWAPL
Ga0187806_107766233300017928Freshwater SedimentMAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPA
Ga0187801_1043213313300017933Freshwater SedimentMAALPVRRGGRNTNAMVVNPSREFEDIYDRMGQLMNFAFG
Ga0187809_1015971423300017937Freshwater SedimentMAMLPVRRSGGRNLTVVNPSREFEDIYDRMGQLMNLAFGLNPIDGADGAWAPLAD
Ga0187808_1019055633300017942Freshwater SedimentMAMLPVRRSGGRNLTVVNPSREFEDIYDRMGQLMNLAFGLNP
Ga0187808_1035910413300017942Freshwater SedimentMAALPVRRGGRNTNTMVVNPSREFEDIYDRMGQLMNFA
Ga0187823_1030995823300017993Freshwater SedimentMAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPW
Ga0187805_1035768323300018007Freshwater SedimentMAMLPVRRGGGRNLTVVNPTREFEDIYDRMGQLMNLALGLNPIDGADG
Ga0193729_119920523300019887SoilMAQLPARRSARNITLVDPSREFEDIYDRMGQLMSMA
Ga0210407_1097093313300020579SoilMAALPARRGGRTPTVINPSREFEDIYDRMGQLMNFAF
Ga0210395_1054661623300020582SoilMAQLPARRSARNITLADPSRELEDIDERVGQLMSMAFGDMA
Ga0210395_1141851223300020582SoilMAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPTADLSETDD
Ga0179596_1065787123300021086Vadose Zone SoilMAQLPARRSARNITLVDPSREFEDIYDRMGQLMSMAFGDMAF
Ga0210404_1000651313300021088SoilMAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPAALADMPWVP
Ga0210406_1036578313300021168SoilMAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNVAFGVTPAEL
Ga0210405_1064457333300021171SoilMAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPA
Ga0210396_1070258013300021180SoilMAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPSADLS
Ga0213876_1067496913300021384Plant RootsMATLPVRRSGRNPSTLVNPSREFEDIYDRMGQLMNFAFGDLARVE
Ga0210393_1070893513300021401SoilMAALPVRRSGRNSMVVNPSREFEDIYDRMGQLMNFAFGLTPAVLADMPW
Ga0210385_1065803113300021402SoilMAQLPARRSARNITLVDPSREFEDIYDRMGQLMSMAFGD
Ga0210397_1068992513300021403SoilMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPWVPLAD
Ga0210397_1160885023300021403SoilMARLPARSGGRNMTLINPTREFEDIYDRMGQLVNLAFGDVA
Ga0210389_1090956013300021404SoilMAALPARRSGRTPTVVNPSREFEDIYDRMGQLMNFAFGP
Ga0210386_1124005023300021406SoilMAMLPVHRSSGRSLTVVNPSREFEDIYDRMGQLMNIAFGLTPVDM
Ga0210383_1114029113300021407SoilMASIPARRSGQNITALNPSREFEDIYDRMGQLMNLAFGDFGLVQPT
Ga0210394_1051531813300021420SoilMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPWVPLA
Ga0210384_1033644413300021432SoilMAALPVRRSGRNSMVVNPSREFEDIYDRMGQLMNSREG
Ga0210391_1055617923300021433SoilMATLPARRSSGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVDVAPTA
Ga0210391_1103858713300021433SoilMAMPQVRRSRGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVDVAEG
Ga0210398_1021068413300021477SoilMAALPVRRGGQHTNTMVVNPSREFEDIYDRMGQLMNFAFGLTPAALADMPWVP
Ga0210410_1111209123300021479SoilMAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPSADLSE
Ga0233357_101881213300023056SoilMAMLPVQRSGRNLTVVNPSREFEDIYDRMGQLMNL
Ga0247670_104173633300024283SoilMAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPSA
Ga0207692_1078470623300025898Corn, Switchgrass And Miscanthus RhizosphereMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVE
Ga0207688_1102694013300025901Corn, Switchgrass And Miscanthus RhizosphereMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEM
Ga0207680_1136445713300025903Switchgrass RhizosphereMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNF
Ga0207647_1078036713300025904Corn RhizosphereMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPWVPLADL
Ga0207693_1103132923300025915Corn, Switchgrass And Miscanthus RhizosphereMAALPVRRGGRTPAVVNTSREFEDIYDRMGQLMNFAFGLTPAALAD
Ga0207640_1053413913300025981Corn RhizosphereMAALPVRRGGRNTMVVSPSREFEDIYYRMGQLMNFAFGLTPAALADMPWVPTAD
Ga0207702_1241750623300026078Corn RhizosphereMATLPVRRSGRNPSTLVNPSREFEDIYDRMGQLMNFAFG
Ga0207641_1241246323300026088Switchgrass RhizosphereMAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPSADLSETDD
Ga0209839_1023026723300026294SoilMATLLPVRRSGRNQNLMNPSREFEDIYDRMGQLMNFAFGGLTPADLADMPW
Ga0209240_100519343300026304Grasslands SoilMAALPVRRGGQGLTVLNPSREFEDIYNRMGQMMNLAIG
Ga0257150_101591833300026356SoilMAALPVRRGGQNTSVVNPSREFEDIYDRMGQLMNF
Ga0257160_102402713300026489SoilMAQLPARRSPRNITLVDPSREFEDIYDRMGQLMSMAFGDMAFAPA
Ga0257156_105596423300026498SoilMAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGNMARAEMP
Ga0257156_108594323300026498SoilMVMLPTRRSMRNRSLADPTREFEDIYQRMGELVNAAFSDFALAPPA
Ga0209326_100411513300026899Forest SoilMAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGD
Ga0208240_101625933300027030Forest SoilMAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLPPAALA
Ga0209005_101426513300027037Forest SoilMAMLPVQRSGRNLTVVNPSREFEDIYDRMTQLMNLAFGVAPVDVTEGAWIPLAD
Ga0208239_102310023300027168Forest SoilMTTPVRRSRGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVDVAEGPW
Ga0208241_101783313300027297Forest SoilMATLLPVRRSGRNQNLMNPSREFEDIYDRMGQLMNFA
Ga0209332_109717413300027439Forest SoilMAQLPARRSARNITLVDPSREFEDIYDRMGQLMSMAFGDLAFTPALAAA
Ga0209622_103632113300027502Forest SoilMAALPVRRSGRNTSLVNPTREFEDIYDRMGQLVNFAFGDLARVEMPWV
Ga0209218_105409523300027505Forest SoilMAQLPARRSARNITLVDPSQEFEDIYDRMGQLMSMAFGD
Ga0208324_109240513300027604Peatlands SoilMASLPIRRSGRNQTLMNPTREFEDIYDRMGQLMNFAFGGLTPVALA
Ga0208989_1028640913300027738Forest SoilMAILPARRRQGQQNLTTNDPSREFEDIYNRMGQLMN
Ga0209177_1011563623300027775Agricultural SoilMAALPVRRSGRNTSLVNPSREFEDIYDRMGQLMNFAFGDMA
Ga0209112_1008465213300027817Forest SoilMTMLPTRRNSGRTMTLVNPSREFEDIYDRMGQLMNMAFGSLAPVA
Ga0209693_1015513013300027855SoilMAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPAALADM
Ga0209275_1022913113300027884SoilMAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNF
Ga0209624_1106246923300027895Forest SoilMAMLPVQRSGRNLTVVNPSREFEDIYDRMTQLMNLAFGAP
Ga0209526_1095587813300028047Forest SoilMAALPVRRGGRNTSLVNPNREFEDIYDRMGQLMNFAFGDMAR
Ga0247675_101310213300028072SoilMAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPSALADMPWVPT
Ga0308309_1012060413300028906SoilMAALPVRRGGQNTNTMVVNPSREFEDIYDRMGQLM
Ga0308309_1110482923300028906SoilMAALPVRRGGRNSMVVNPSREFEDIYDRMGQLMNFAFGLTPAVLAD
Ga0311372_1158190113300030520PalsaMTTPTVRRNGGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVNVADGP
Ga0302314_1108015013300030906PalsaMTTPTVRRNGGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVNVAEGP
Ga0074027_1019770813300030980SoilMAALPVRHGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPAVLAD
Ga0138301_186933623300031022SoilMTTPTVRRNGGRNPTVVNPTREFEDIYDRMGQLMNVAFGLAPV
Ga0074026_1128160433300031035SoilMAALPARRSGRTPTVVNPSREFEDIYDRMGQLMNFAFG
Ga0302326_1201908723300031525PalsaMAMPQVRRRGGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPV
Ga0307478_1027778513300031823Hardwood Forest SoilMAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNF
Ga0307478_1056878713300031823Hardwood Forest SoilMAALPVRRGGQNTNTMVVNPSREFEDIYDRMGQLMNFAFGLTPAALA
Ga0348332_1257636113300032515Plant LitterRRLAMAPLPARRSSGRNLTVVNPAREFEDIYDRMGQLMNLAFGLARVDVAEGPWIPLGQAPSHRD
Ga0335082_1019278633300032782SoilMAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGDIA
Ga0335078_1161522123300032805SoilMAALPVRRGGRNLTVVNPSREFEDIYDRMGQLMNFAFGLTPAALADM
Ga0335074_1081533713300032895SoilMATLPVRRNRGRNLTVVNPTREFEDIYDRMGQLMNV
Ga0335072_1080810113300032898SoilMAALPVRRGGRNSMVVNPSREFEDIYDRMGQLMNFAFGLPPAVLADMPWVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.