| Basic Information | |
|---|---|
| Family ID | F080270 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPA |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.13 % |
| % of genes near scaffold ends (potentially truncated) | 99.13 % |
| % of genes from short scaffolds (< 2000 bps) | 95.65 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.696 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.087 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.522 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.391 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF09123 | DUF1931 | 36.52 |
| PF06897 | DUF1269 | 9.57 |
| PF07992 | Pyr_redox_2 | 6.96 |
| PF02467 | Whib | 4.35 |
| PF00196 | GerE | 3.48 |
| PF13367 | PrsW-protease | 2.61 |
| PF00012 | HSP70 | 1.74 |
| PF03358 | FMN_red | 1.74 |
| PF02148 | zf-UBP | 0.87 |
| PF02781 | G6PD_C | 0.87 |
| PF13738 | Pyr_redox_3 | 0.87 |
| PF01066 | CDP-OH_P_transf | 0.87 |
| PF02787 | CPSase_L_D3 | 0.87 |
| PF00479 | G6PD_N | 0.87 |
| PF00011 | HSP20 | 0.87 |
| PF03729 | DUF308 | 0.87 |
| PF13556 | HTH_30 | 0.87 |
| PF01569 | PAP2 | 0.87 |
| PF13191 | AAA_16 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 9.57 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 1.74 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 1.74 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.87 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.87 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.87 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.87 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.70 % |
| Unclassified | root | N/A | 31.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01DA3PI | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101077468 | Not Available | 690 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101265092 | Not Available | 628 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10196062 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005330|Ga0070690_100171087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1495 | Open in IMG/M |
| 3300005340|Ga0070689_100607822 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005435|Ga0070714_101204806 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005435|Ga0070714_101322656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
| 3300005602|Ga0070762_10467327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 822 | Open in IMG/M |
| 3300005610|Ga0070763_10701298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300005921|Ga0070766_11118376 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006028|Ga0070717_10983185 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300006028|Ga0070717_11290330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
| 3300006176|Ga0070765_100267112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1573 | Open in IMG/M |
| 3300006176|Ga0070765_101581787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300006852|Ga0075433_11352086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| 3300007788|Ga0099795_10059249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1416 | Open in IMG/M |
| 3300009092|Ga0105250_10299442 | Not Available | 695 | Open in IMG/M |
| 3300009522|Ga0116218_1387588 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009524|Ga0116225_1549735 | Not Available | 512 | Open in IMG/M |
| 3300009525|Ga0116220_10129688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
| 3300009545|Ga0105237_11971410 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300009792|Ga0126374_10539615 | Not Available | 849 | Open in IMG/M |
| 3300010373|Ga0134128_11440323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 758 | Open in IMG/M |
| 3300010866|Ga0126344_1075263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1599 | Open in IMG/M |
| 3300010876|Ga0126361_10748695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300011120|Ga0150983_12485535 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300011120|Ga0150983_15750525 | Not Available | 501 | Open in IMG/M |
| 3300012189|Ga0137388_10062787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3062 | Open in IMG/M |
| 3300012206|Ga0137380_10730446 | Not Available | 858 | Open in IMG/M |
| 3300012361|Ga0137360_10724983 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300012362|Ga0137361_10331976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1394 | Open in IMG/M |
| 3300012683|Ga0137398_10034927 | All Organisms → cellular organisms → Bacteria | 2880 | Open in IMG/M |
| 3300013105|Ga0157369_10939143 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300017924|Ga0187820_1133004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300017926|Ga0187807_1116130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300017926|Ga0187807_1197609 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300017928|Ga0187806_1077662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300017933|Ga0187801_10432133 | Not Available | 550 | Open in IMG/M |
| 3300017937|Ga0187809_10159714 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300017942|Ga0187808_10190556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300017942|Ga0187808_10359104 | Not Available | 662 | Open in IMG/M |
| 3300017993|Ga0187823_10309958 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300018007|Ga0187805_10357683 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300019887|Ga0193729_1199205 | Not Available | 684 | Open in IMG/M |
| 3300020579|Ga0210407_10970933 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300020582|Ga0210395_10546616 | Not Available | 871 | Open in IMG/M |
| 3300020582|Ga0210395_11418512 | Not Available | 506 | Open in IMG/M |
| 3300021086|Ga0179596_10657871 | Not Available | 531 | Open in IMG/M |
| 3300021088|Ga0210404_10006513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4704 | Open in IMG/M |
| 3300021168|Ga0210406_10365783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300021171|Ga0210405_10644573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300021180|Ga0210396_10702580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300021384|Ga0213876_10674969 | Not Available | 550 | Open in IMG/M |
| 3300021401|Ga0210393_10708935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300021402|Ga0210385_10658031 | Not Available | 801 | Open in IMG/M |
| 3300021403|Ga0210397_10689925 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300021403|Ga0210397_11608850 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300021404|Ga0210389_10909560 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300021406|Ga0210386_11240050 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300021407|Ga0210383_11140291 | Not Available | 657 | Open in IMG/M |
| 3300021420|Ga0210394_10515318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
| 3300021432|Ga0210384_10336444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1359 | Open in IMG/M |
| 3300021433|Ga0210391_10556179 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300021433|Ga0210391_11038587 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021477|Ga0210398_10210684 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300021479|Ga0210410_11112091 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300023056|Ga0233357_1018812 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300024283|Ga0247670_1041736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300025898|Ga0207692_10784706 | Not Available | 622 | Open in IMG/M |
| 3300025901|Ga0207688_11026940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 521 | Open in IMG/M |
| 3300025903|Ga0207680_11364457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 503 | Open in IMG/M |
| 3300025904|Ga0207647_10780367 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300025915|Ga0207693_11031329 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300025981|Ga0207640_10534139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
| 3300026078|Ga0207702_12417506 | Not Available | 512 | Open in IMG/M |
| 3300026088|Ga0207641_12412463 | Not Available | 525 | Open in IMG/M |
| 3300026294|Ga0209839_10230267 | Not Available | 587 | Open in IMG/M |
| 3300026304|Ga0209240_1005193 | All Organisms → cellular organisms → Bacteria | 4925 | Open in IMG/M |
| 3300026356|Ga0257150_1015918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1041 | Open in IMG/M |
| 3300026489|Ga0257160_1024027 | Not Available | 977 | Open in IMG/M |
| 3300026498|Ga0257156_1055964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300026498|Ga0257156_1085943 | Not Available | 653 | Open in IMG/M |
| 3300026899|Ga0209326_1004115 | Not Available | 1103 | Open in IMG/M |
| 3300027030|Ga0208240_1016259 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300027037|Ga0209005_1014265 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300027168|Ga0208239_1023100 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027297|Ga0208241_1017833 | Not Available | 1045 | Open in IMG/M |
| 3300027439|Ga0209332_1097174 | Not Available | 528 | Open in IMG/M |
| 3300027502|Ga0209622_1036321 | Not Available | 885 | Open in IMG/M |
| 3300027505|Ga0209218_1054095 | Not Available | 813 | Open in IMG/M |
| 3300027604|Ga0208324_1092405 | Not Available | 850 | Open in IMG/M |
| 3300027738|Ga0208989_10286409 | Not Available | 529 | Open in IMG/M |
| 3300027775|Ga0209177_10115636 | Not Available | 871 | Open in IMG/M |
| 3300027817|Ga0209112_10084652 | Not Available | 1009 | Open in IMG/M |
| 3300027855|Ga0209693_10155130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
| 3300027884|Ga0209275_10229131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
| 3300027895|Ga0209624_11062469 | Not Available | 522 | Open in IMG/M |
| 3300028047|Ga0209526_10955878 | Not Available | 516 | Open in IMG/M |
| 3300028072|Ga0247675_1013102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300028906|Ga0308309_10120604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2065 | Open in IMG/M |
| 3300028906|Ga0308309_11104829 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300030520|Ga0311372_11581901 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300030906|Ga0302314_11080150 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300030980|Ga0074027_10197708 | Not Available | 534 | Open in IMG/M |
| 3300031022|Ga0138301_1869336 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031035|Ga0074026_11281604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1256 | Open in IMG/M |
| 3300031525|Ga0302326_12019087 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300031823|Ga0307478_10277785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1367 | Open in IMG/M |
| 3300031823|Ga0307478_10568787 | Not Available | 947 | Open in IMG/M |
| 3300032515|Ga0348332_12576361 | Not Available | 596 | Open in IMG/M |
| 3300032782|Ga0335082_10192786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1941 | Open in IMG/M |
| 3300032805|Ga0335078_11615221 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032895|Ga0335074_10815337 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300032898|Ga0335072_10808101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 895 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 14.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.09% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.74% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.87% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027037 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030980 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031035 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_02199970 | 2170459024 | Grass Soil | MANLPIRRGGRRTHLVNPSREFEDIYDRMGQLMNMAVGPVGPVAVVDLPWVPLP |
| JGIcombinedJ26739_1010774682 | 3300002245 | Forest Soil | MAQLPARRNARNVTLVSPSREFEDIYDRMGQLLNLTFG |
| JGIcombinedJ26739_1012650921 | 3300002245 | Forest Soil | MAQLPARRNARNVTLVSPSREFEDIYDRMGQLLSLTFGD |
| JGIcombinedJ51221_101960622 | 3300003505 | Forest Soil | MASLPIRRTGRNQTLMNPTREFEDIYDRMGQLMNFAFGGLTPVALADMPWAPLG |
| Ga0070690_1001710871 | 3300005330 | Switchgrass Rhizosphere | MAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPTAD |
| Ga0070689_1006078223 | 3300005340 | Switchgrass Rhizosphere | MLMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFG |
| Ga0070714_1012048063 | 3300005435 | Agricultural Soil | MAVLPVRRGGRNTNAMVVNPSREFEDIYDRMGQLMNFAFGLT |
| Ga0070714_1013226561 | 3300005435 | Agricultural Soil | MATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPWV |
| Ga0070762_104673273 | 3300005602 | Soil | MAALPVRRGGRNSMVVNPSREFEDIYDRMGQLMNFAFGLTPAVLA |
| Ga0070763_107012982 | 3300005610 | Soil | MATLLPVRRSGRNQNLMNPSREFEDIYDRMGQLMNF |
| Ga0070766_111183761 | 3300005921 | Soil | MATLLPVRRSGRNQNLMNPSREFEDVYDRMGQLMNFAF |
| Ga0070717_109831851 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFA |
| Ga0070717_112903302 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMLPVQRSGRNLTVVNPSREFEDIYDRMGQLMNLAFGLAPVDVAE |
| Ga0070765_1002671121 | 3300006176 | Soil | MATLLPVRRSGRNQNLMNPSREFEDVYDRMGQLMNFAFGGLTPAD |
| Ga0070765_1015817872 | 3300006176 | Soil | MAALPVRRGGRNSMVVNPSREFEDIYDRMGQLMNFAFGLT |
| Ga0075433_113520862 | 3300006852 | Populus Rhizosphere | MAALPARRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGLTP |
| Ga0099795_100592491 | 3300007788 | Vadose Zone Soil | MAALPVRRGGRNTSLVNPSREFEDIYDRMGQLVNFAFGDMARVEMPWVP |
| Ga0105250_102994421 | 3300009092 | Switchgrass Rhizosphere | MLMATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPW |
| Ga0116218_13875882 | 3300009522 | Peatlands Soil | MAALPVRRGGRNTSVVSPSREFEDIYDRMGQLMNFAFG |
| Ga0116225_15497352 | 3300009524 | Peatlands Soil | MASLPIRRTGRNQTLMNPTREFEDIYDRMGQLMNFAFGLTPAALAD |
| Ga0116220_101296881 | 3300009525 | Peatlands Soil | MAALPVRRGGRNTSVVSPSREFEDIYDRMGQLMNFAFGLTPAAL |
| Ga0105237_119714102 | 3300009545 | Corn Rhizosphere | MAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVP |
| Ga0126374_105396151 | 3300009792 | Tropical Forest Soil | MAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGDLARVEMPWVP |
| Ga0134128_114403231 | 3300010373 | Terrestrial Soil | MAMLPTRRGGQSLTIIDPSREFEDIYNRMGQLMDLALGD |
| Ga0126344_10752631 | 3300010866 | Boreal Forest Soil | MAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAF |
| Ga0126361_107486953 | 3300010876 | Boreal Forest Soil | MAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPAALADMPW |
| Ga0150983_124855352 | 3300011120 | Forest Soil | MAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPSA |
| Ga0150983_157505252 | 3300011120 | Forest Soil | MAALPARRSGRTPTVVNPSREFEDIYDRMGQLMNFAFGLPPGALADMPWIPL |
| Ga0137388_100627875 | 3300012189 | Vadose Zone Soil | MAALPVRRGGQGLTVLNPSREFEDIYNRMGQLMNLALGDF |
| Ga0137380_107304462 | 3300012206 | Vadose Zone Soil | MAQLPARRGGPGTTAVSPFREFEDIYDRMGQLINFAFG |
| Ga0137360_107249832 | 3300012361 | Vadose Zone Soil | MVSLPVRRGGQGLTVLNPSREFEDIYNRMGQMMNLA |
| Ga0137361_103319762 | 3300012362 | Vadose Zone Soil | MAQLPARRSARNISLVDPSREFEDIYDRMGQLMSMAF |
| Ga0137398_100349271 | 3300012683 | Vadose Zone Soil | MAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMSFAFGDLGLARPGSAPWSP |
| Ga0157369_109391432 | 3300013105 | Corn Rhizosphere | MAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPTAD |
| Ga0187820_11330041 | 3300017924 | Freshwater Sediment | MAALPVRRGRQNTSVVNPSREFEDIYDRMGQLMNFAFGLTPAALAD |
| Ga0187807_11161303 | 3300017926 | Freshwater Sediment | MAALPVRRGGRNTNTMVVNPSREFEDIYDRMGQLMNFAFGLT |
| Ga0187807_11976091 | 3300017926 | Freshwater Sediment | MAMLPVRRSGGRNLTVVNPSREFEDIYDRMGQLMNLAFGLNPIDGADGAWAPL |
| Ga0187806_10776623 | 3300017928 | Freshwater Sediment | MAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPA |
| Ga0187801_104321331 | 3300017933 | Freshwater Sediment | MAALPVRRGGRNTNAMVVNPSREFEDIYDRMGQLMNFAFG |
| Ga0187809_101597142 | 3300017937 | Freshwater Sediment | MAMLPVRRSGGRNLTVVNPSREFEDIYDRMGQLMNLAFGLNPIDGADGAWAPLAD |
| Ga0187808_101905563 | 3300017942 | Freshwater Sediment | MAMLPVRRSGGRNLTVVNPSREFEDIYDRMGQLMNLAFGLNP |
| Ga0187808_103591041 | 3300017942 | Freshwater Sediment | MAALPVRRGGRNTNTMVVNPSREFEDIYDRMGQLMNFA |
| Ga0187823_103099582 | 3300017993 | Freshwater Sediment | MAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPW |
| Ga0187805_103576832 | 3300018007 | Freshwater Sediment | MAMLPVRRGGGRNLTVVNPTREFEDIYDRMGQLMNLALGLNPIDGADG |
| Ga0193729_11992052 | 3300019887 | Soil | MAQLPARRSARNITLVDPSREFEDIYDRMGQLMSMA |
| Ga0210407_109709331 | 3300020579 | Soil | MAALPARRGGRTPTVINPSREFEDIYDRMGQLMNFAF |
| Ga0210395_105466162 | 3300020582 | Soil | MAQLPARRSARNITLADPSRELEDIDERVGQLMSMAFGDMA |
| Ga0210395_114185122 | 3300020582 | Soil | MAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPTADLSETDD |
| Ga0179596_106578712 | 3300021086 | Vadose Zone Soil | MAQLPARRSARNITLVDPSREFEDIYDRMGQLMSMAFGDMAF |
| Ga0210404_100065131 | 3300021088 | Soil | MAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPAALADMPWVP |
| Ga0210406_103657831 | 3300021168 | Soil | MAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNVAFGVTPAEL |
| Ga0210405_106445733 | 3300021171 | Soil | MAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPA |
| Ga0210396_107025801 | 3300021180 | Soil | MAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPSADLS |
| Ga0213876_106749691 | 3300021384 | Plant Roots | MATLPVRRSGRNPSTLVNPSREFEDIYDRMGQLMNFAFGDLARVE |
| Ga0210393_107089351 | 3300021401 | Soil | MAALPVRRSGRNSMVVNPSREFEDIYDRMGQLMNFAFGLTPAVLADMPW |
| Ga0210385_106580311 | 3300021402 | Soil | MAQLPARRSARNITLVDPSREFEDIYDRMGQLMSMAFGD |
| Ga0210397_106899251 | 3300021403 | Soil | MATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPWVPLAD |
| Ga0210397_116088502 | 3300021403 | Soil | MARLPARSGGRNMTLINPTREFEDIYDRMGQLVNLAFGDVA |
| Ga0210389_109095601 | 3300021404 | Soil | MAALPARRSGRTPTVVNPSREFEDIYDRMGQLMNFAFGP |
| Ga0210386_112400502 | 3300021406 | Soil | MAMLPVHRSSGRSLTVVNPSREFEDIYDRMGQLMNIAFGLTPVDM |
| Ga0210383_111402911 | 3300021407 | Soil | MASIPARRSGQNITALNPSREFEDIYDRMGQLMNLAFGDFGLVQPT |
| Ga0210394_105153181 | 3300021420 | Soil | MATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPWVPLA |
| Ga0210384_103364441 | 3300021432 | Soil | MAALPVRRSGRNSMVVNPSREFEDIYDRMGQLMNSREG |
| Ga0210391_105561792 | 3300021433 | Soil | MATLPARRSSGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVDVAPTA |
| Ga0210391_110385871 | 3300021433 | Soil | MAMPQVRRSRGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVDVAEG |
| Ga0210398_102106841 | 3300021477 | Soil | MAALPVRRGGQHTNTMVVNPSREFEDIYDRMGQLMNFAFGLTPAALADMPWVP |
| Ga0210410_111120912 | 3300021479 | Soil | MAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPSADLSE |
| Ga0233357_10188121 | 3300023056 | Soil | MAMLPVQRSGRNLTVVNPSREFEDIYDRMGQLMNL |
| Ga0247670_10417363 | 3300024283 | Soil | MAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPSA |
| Ga0207692_107847062 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVE |
| Ga0207688_110269401 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEM |
| Ga0207680_113644571 | 3300025903 | Switchgrass Rhizosphere | MATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNF |
| Ga0207647_107803671 | 3300025904 | Corn Rhizosphere | MATLPVRRGGRNTSLVNPTREFEDIYDRMGQLMNFAFGDLARVEMPWVPLADL |
| Ga0207693_110313292 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALPVRRGGRTPAVVNTSREFEDIYDRMGQLMNFAFGLTPAALAD |
| Ga0207640_105341391 | 3300025981 | Corn Rhizosphere | MAALPVRRGGRNTMVVSPSREFEDIYYRMGQLMNFAFGLTPAALADMPWVPTAD |
| Ga0207702_124175062 | 3300026078 | Corn Rhizosphere | MATLPVRRSGRNPSTLVNPSREFEDIYDRMGQLMNFAFG |
| Ga0207641_124124632 | 3300026088 | Switchgrass Rhizosphere | MAALPVRRGGRTPTVVNTSREFEDIYDRMGQLMNFAFGLTPAALADMPWVPSADLSETDD |
| Ga0209839_102302672 | 3300026294 | Soil | MATLLPVRRSGRNQNLMNPSREFEDIYDRMGQLMNFAFGGLTPADLADMPW |
| Ga0209240_10051934 | 3300026304 | Grasslands Soil | MAALPVRRGGQGLTVLNPSREFEDIYNRMGQMMNLAIG |
| Ga0257150_10159183 | 3300026356 | Soil | MAALPVRRGGQNTSVVNPSREFEDIYDRMGQLMNF |
| Ga0257160_10240271 | 3300026489 | Soil | MAQLPARRSPRNITLVDPSREFEDIYDRMGQLMSMAFGDMAFAPA |
| Ga0257156_10559642 | 3300026498 | Soil | MAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGNMARAEMP |
| Ga0257156_10859432 | 3300026498 | Soil | MVMLPTRRSMRNRSLADPTREFEDIYQRMGELVNAAFSDFALAPPA |
| Ga0209326_10041151 | 3300026899 | Forest Soil | MAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGD |
| Ga0208240_10162593 | 3300027030 | Forest Soil | MAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLPPAALA |
| Ga0209005_10142651 | 3300027037 | Forest Soil | MAMLPVQRSGRNLTVVNPSREFEDIYDRMTQLMNLAFGVAPVDVTEGAWIPLAD |
| Ga0208239_10231002 | 3300027168 | Forest Soil | MTTPVRRSRGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVDVAEGPW |
| Ga0208241_10178331 | 3300027297 | Forest Soil | MATLLPVRRSGRNQNLMNPSREFEDIYDRMGQLMNFA |
| Ga0209332_10971741 | 3300027439 | Forest Soil | MAQLPARRSARNITLVDPSREFEDIYDRMGQLMSMAFGDLAFTPALAAA |
| Ga0209622_10363211 | 3300027502 | Forest Soil | MAALPVRRSGRNTSLVNPTREFEDIYDRMGQLVNFAFGDLARVEMPWV |
| Ga0209218_10540952 | 3300027505 | Forest Soil | MAQLPARRSARNITLVDPSQEFEDIYDRMGQLMSMAFGD |
| Ga0208324_10924051 | 3300027604 | Peatlands Soil | MASLPIRRSGRNQTLMNPTREFEDIYDRMGQLMNFAFGGLTPVALA |
| Ga0208989_102864091 | 3300027738 | Forest Soil | MAILPARRRQGQQNLTTNDPSREFEDIYNRMGQLMN |
| Ga0209177_101156362 | 3300027775 | Agricultural Soil | MAALPVRRSGRNTSLVNPSREFEDIYDRMGQLMNFAFGDMA |
| Ga0209112_100846521 | 3300027817 | Forest Soil | MTMLPTRRNSGRTMTLVNPSREFEDIYDRMGQLMNMAFGSLAPVA |
| Ga0209693_101551301 | 3300027855 | Soil | MAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPAALADM |
| Ga0209275_102291311 | 3300027884 | Soil | MAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNF |
| Ga0209624_110624692 | 3300027895 | Forest Soil | MAMLPVQRSGRNLTVVNPSREFEDIYDRMTQLMNLAFGAP |
| Ga0209526_109558781 | 3300028047 | Forest Soil | MAALPVRRGGRNTSLVNPNREFEDIYDRMGQLMNFAFGDMAR |
| Ga0247675_10131021 | 3300028072 | Soil | MAALPVRRGGRNTMVVSPSREFEDIYDRMGQLMNFAFGLTPSALADMPWVPT |
| Ga0308309_101206041 | 3300028906 | Soil | MAALPVRRGGQNTNTMVVNPSREFEDIYDRMGQLM |
| Ga0308309_111048292 | 3300028906 | Soil | MAALPVRRGGRNSMVVNPSREFEDIYDRMGQLMNFAFGLTPAVLAD |
| Ga0311372_115819011 | 3300030520 | Palsa | MTTPTVRRNGGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVNVADGP |
| Ga0302314_110801501 | 3300030906 | Palsa | MTTPTVRRNGGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPVNVAEGP |
| Ga0074027_101977081 | 3300030980 | Soil | MAALPVRHGGRNTSVVNPSREFEDIYDRMGQLMNFAFGLTPAVLAD |
| Ga0138301_18693362 | 3300031022 | Soil | MTTPTVRRNGGRNPTVVNPTREFEDIYDRMGQLMNVAFGLAPV |
| Ga0074026_112816043 | 3300031035 | Soil | MAALPARRSGRTPTVVNPSREFEDIYDRMGQLMNFAFG |
| Ga0302326_120190872 | 3300031525 | Palsa | MAMPQVRRRGGRNLTVVNPTREFEDIYDRMGQLMNLAFGLAPV |
| Ga0307478_102777851 | 3300031823 | Hardwood Forest Soil | MAALPVRRGGRNTSVVNPSREFEDIYDRMGQLMNF |
| Ga0307478_105687871 | 3300031823 | Hardwood Forest Soil | MAALPVRRGGQNTNTMVVNPSREFEDIYDRMGQLMNFAFGLTPAALA |
| Ga0348332_125763611 | 3300032515 | Plant Litter | RRLAMAPLPARRSSGRNLTVVNPAREFEDIYDRMGQLMNLAFGLARVDVAEGPWIPLGQAPSHRD |
| Ga0335082_101927863 | 3300032782 | Soil | MAALPVRRGGRNTSLVNPSREFEDIYDRMGQLMNFAFGDIA |
| Ga0335078_116152212 | 3300032805 | Soil | MAALPVRRGGRNLTVVNPSREFEDIYDRMGQLMNFAFGLTPAALADM |
| Ga0335074_108153371 | 3300032895 | Soil | MATLPVRRNRGRNLTVVNPTREFEDIYDRMGQLMNV |
| Ga0335072_108081011 | 3300032898 | Soil | MAALPVRRGGRNSMVVNPSREFEDIYDRMGQLMNFAFGLPPAVLADMPWVP |
| ⦗Top⦘ |