NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080253

Metagenome / Metatranscriptome Family F080253

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080253
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 45 residues
Representative Sequence WYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Number of Associated Samples 110
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.88 %
% of genes near scaffold ends (potentially truncated) 98.26 %
% of genes from short scaffolds (< 2000 bps) 81.74 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.522 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(15.652 % of family members)
Environment Ontology (ENVO) Unclassified
(49.565 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.304 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 25.71%    Coil/Unstructured: 74.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF14534DUF4440 1.74
PF07396Porin_O_P 0.87
PF00557Peptidase_M24 0.87
PF12849PBP_like_2 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG3746Phosphate-selective porinInorganic ion transport and metabolism [P] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.52 %
UnclassifiedrootN/A3.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100615386All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium963Open in IMG/M
3300002245|JGIcombinedJ26739_101713492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300004080|Ga0062385_10840906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300004092|Ga0062389_100178525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2051Open in IMG/M
3300004560|Ga0068940_1190411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300004598|Ga0068975_1246922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300004611|Ga0068925_1340773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300004617|Ga0068955_1396140Not Available503Open in IMG/M
3300004633|Ga0066395_10819667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300004972|Ga0072325_1295115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300005542|Ga0070732_10541211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300005591|Ga0070761_10071919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1963Open in IMG/M
3300005602|Ga0070762_10131448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1481Open in IMG/M
3300005610|Ga0070763_10816119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300005712|Ga0070764_10939600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300005764|Ga0066903_102412317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1017Open in IMG/M
3300005921|Ga0070766_10127785All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300006052|Ga0075029_100893336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300006176|Ga0070765_102008897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300009518|Ga0116128_1020588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2247Open in IMG/M
3300009519|Ga0116108_1217942All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300009521|Ga0116222_1060182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1647Open in IMG/M
3300009621|Ga0116116_1021462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2327Open in IMG/M
3300009623|Ga0116133_1038440All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1184Open in IMG/M
3300009630|Ga0116114_1015381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2374Open in IMG/M
3300009632|Ga0116102_1108873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium790Open in IMG/M
3300009634|Ga0116124_1164963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300009646|Ga0116132_1262025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300009665|Ga0116135_1194447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300010043|Ga0126380_10600110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300010048|Ga0126373_11544663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300010366|Ga0126379_13867379All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300010379|Ga0136449_103713942All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300010859|Ga0126352_1170039Not Available514Open in IMG/M
3300010876|Ga0126361_10663959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300011060|Ga0138583_1101518All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300011077|Ga0138572_1048454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium936Open in IMG/M
3300011080|Ga0138568_1195521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300011090|Ga0138579_1001438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300011305|Ga0138532_1009600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium760Open in IMG/M
3300014156|Ga0181518_10264428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300014159|Ga0181530_10414440All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300014162|Ga0181538_10412255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300014167|Ga0181528_10054821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2204Open in IMG/M
3300014169|Ga0181531_10290809All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium999Open in IMG/M
3300014838|Ga0182030_10165481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2758Open in IMG/M
3300016270|Ga0182036_10676356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis833Open in IMG/M
3300017822|Ga0187802_10409919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300017925|Ga0187856_1034678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2355Open in IMG/M
3300017929|Ga0187849_1248357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300017931|Ga0187877_1039817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2238Open in IMG/M
3300017935|Ga0187848_10319478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300017936|Ga0187821_10302399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300017938|Ga0187854_10430100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300017943|Ga0187819_10471725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300017955|Ga0187817_10017769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4188Open in IMG/M
3300017955|Ga0187817_10459641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300017996|Ga0187891_1043963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1913Open in IMG/M
3300018004|Ga0187865_1233746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300018005|Ga0187878_1301667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300018008|Ga0187888_1295220All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300018009|Ga0187884_10421598All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300018022|Ga0187864_10169546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1061Open in IMG/M
3300018026|Ga0187857_10366726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300018038|Ga0187855_10068738All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2170Open in IMG/M
3300018038|Ga0187855_10869753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300018042|Ga0187871_10092708All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1748Open in IMG/M
3300018043|Ga0187887_10014935All Organisms → cellular organisms → Bacteria → Acidobacteria5108Open in IMG/M
3300018044|Ga0187890_10332721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium852Open in IMG/M
3300018085|Ga0187772_10875958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300019240|Ga0181510_1199399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300019284|Ga0187797_1296299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300020580|Ga0210403_10909700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300020582|Ga0210395_10593663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300021406|Ga0210386_10507982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1042Open in IMG/M
3300021474|Ga0210390_11568490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300021475|Ga0210392_10997429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300021477|Ga0210398_10041317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3820Open in IMG/M
3300022505|Ga0242647_1012823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300022722|Ga0242657_1027710All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1122Open in IMG/M
3300023101|Ga0224557_1044672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2100Open in IMG/M
3300025444|Ga0208189_1017218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1600Open in IMG/M
3300025454|Ga0208039_1012268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2025Open in IMG/M
3300025460|Ga0208562_1011449All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2243Open in IMG/M
3300025477|Ga0208192_1091223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300025500|Ga0208686_1133727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300025501|Ga0208563_1030472All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1301Open in IMG/M
3300027158|Ga0208725_1064433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300027297|Ga0208241_1068823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300027297|Ga0208241_1086739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300027591|Ga0209733_1110807Not Available687Open in IMG/M
3300027609|Ga0209221_1173896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300027641|Ga0208827_1208484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300027648|Ga0209420_1168715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300027855|Ga0209693_10398510All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300027884|Ga0209275_10459234All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300027884|Ga0209275_10850269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300027908|Ga0209006_11113916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300027986|Ga0209168_10332406All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300029817|Ga0247275_1005022All Organisms → cellular organisms → Bacteria6522Open in IMG/M
3300029910|Ga0311369_11381937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300030629|Ga0210268_1205681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300030741|Ga0265459_12593467All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300030878|Ga0265770_1114446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300031010|Ga0265771_1008505All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300031057|Ga0170834_110482642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300031525|Ga0302326_11492878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium906Open in IMG/M
3300031718|Ga0307474_10007491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7857Open in IMG/M
3300031823|Ga0307478_10346539All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1223Open in IMG/M
3300031962|Ga0307479_10182032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2067Open in IMG/M
3300032160|Ga0311301_10395281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2122Open in IMG/M
3300033828|Ga0334850_000288All Organisms → cellular organisms → Bacteria29018Open in IMG/M
3300033982|Ga0371487_0270583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300034124|Ga0370483_0351647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland13.04%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil12.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.70%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.83%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.61%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.61%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.74%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.74%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.87%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.87%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.87%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004560Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004598Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004611Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004617Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004972Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011060Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011077Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011090Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011305Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022505Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030629Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031010Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300033828Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10061538613300002245Forest SoilYTIGLNYYPNYWVKYMVNLAIDQLKDPSTIGALPQNYYVVMQRLQFRF*
JGIcombinedJ26739_10171349213300002245Forest SoilLTWFPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF*
Ga0062385_1084090613300004080Bog Forest SoilYPNYWVKYVVNVGIDQLKDPSVTGAEPQNYYVVLQRLQFRF*
Ga0062389_10017852523300004092Bog Forest SoilEFTFGVTWYPNYWVKYSVNLGVDQLKDPSTIGAVPQNYYVVLQQLQFRF*
Ga0068940_119041123300004560Peatlands SoilDFHTREYTAGLNWYPNYWVRYMVNLSVDQLKDPSTIGAVPQNYFVVLQRLQFRF*
Ga0068975_124692213300004598Peatlands SoilMGLNWYPNYWVKYVVNLAIDQLKDPSLIGAVPQNYFVVLQRLQFRF*
Ga0068925_134077313300004611Peatlands SoilWYPNYWVKYVVNLAIDQLKDPSTIGAVPQNYFTVLQRLQFRF*
Ga0068955_139614013300004617Peatlands SoilGLNWYPNYWVKYVVNLAIDQLKEPSTIGAVPQNYYVVMQRLQFRF*
Ga0066395_1081966713300004633Tropical Forest SoilTFGFNWYLNYWVKYQVNLGVDRLRQVSINTGALPQNYFVALQRLQFRF*
Ga0072325_129511523300004972Peatlands SoilDFHTREYTMGLNWYPNYWVKYVVNLAIDQLKDPSTIGAVPQNYFTVLQRLQFRF*
Ga0070732_1054121113300005542Surface SoilKYMVNLGVDQLHQPSVAGQVPQNYFVVLQRLQFRF*
Ga0070761_1007191923300005591SoilVKYVVNLGIDQLKEPSVGGQEPGNFFVVTQRLQFRF*
Ga0070762_1013144823300005602SoilTWYPNYWVKYQVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF*
Ga0070763_1081611923300005610SoilNWYPNYWVKYVLNVGIDQLKDPSTIGAVPQNYFVVTQRLQFRF*
Ga0070764_1093960013300005712SoilNWYPNYWVKYVFNLGVDQLKQPSTIGAEPQNYFVVLQRLQFRF*
Ga0066903_10241231723300005764Tropical Forest SoilFNWYLNYWVKYQVNLGVDRLRQVSINTGALPQNYFVALQRLQFRF*
Ga0070766_1012778523300005921SoilNDHTLSYTAGVNWYPNYWVKYVLNVSVDQLKEPSVIGQEPQTFYVIEQRLQFRF*
Ga0075029_10089333613300006052WatershedsVKYMVNIGVDQLHQPSITGQIPQNFIVVLQRLQFRF*
Ga0070765_10200889713300006176SoilDHTFEYTAGLNWYPNYWVKYVINLGIDQLKEPSTIGATPQNYFVVTQRIQFRF*
Ga0116128_102058813300009518PeatlandNYHTFEYTAGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF*
Ga0116108_121794223300009519PeatlandGLNWYPNYWVKYVVNLAIDQLKDPSTIGAVPQNYVTVLQRLQFRF*
Ga0116222_106018213300009521Peatlands SoilLNWYPNYWVKYVVNLAIDQLKDPSLIGAVPQNYFVVLQRLQFRF*
Ga0116116_102146223300009621PeatlandYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF*
Ga0116133_103844023300009623PeatlandPEFDDHTFAYTLGVNWYPNYWVKYQLNVNFDQLKEPSTIGAVPQTYYVIEQRLQFRF*
Ga0116114_101538123300009630PeatlandFEYTAGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF*
Ga0116102_110887313300009632PeatlandLNWYPNYWVKYVVNLGIDQLKDPSVTGAEPQNYFVVLQRIQFRF*
Ga0116124_116496323300009634PeatlandWVRYMVNLSVDQLKDPSLTAALPQNYFVVLQRLQFRF*
Ga0116132_126202523300009646PeatlandFHTTEYTMGLNWYPNYWVKYVVNLAIDQLKDPSTIGAVPQNYVTVLQRLQFRF*
Ga0116135_119444723300009665PeatlandTWYPNYWVKYSVNLGIDQLKDPSTIGAIPQNYYVVLQQLQFRF*
Ga0126380_1060011023300010043Tropical Forest SoilYMADFSVDRLQQVSINAGALPQNYFVVLQRLQFRF*
Ga0126373_1154466323300010048Tropical Forest SoilWVKYQVNLGVDRLRQVSINTGALPQNYFVALQRLQFRF*
Ga0126379_1386737913300010366Tropical Forest SoilPNYWVRYMVDLGVDRLKAPSLTGALLQNYFTVLQRLQFRF*
Ga0136449_10371394213300010379Peatlands SoilNYWVKYVLNVGIDQLKEPSVIGQEPQNFFVVMQRLQFRF*
Ga0126352_117003913300010859Boreal Forest SoilNWYPNYWVKYMVNVGIDQLHQPSVTGQLPQNFFVVMQRLQFRF*
Ga0126344_128650613300010866Boreal Forest SoilVNWYPNYWVKYMVNVAVDQLKQPSVAGQVPQNFFVVLQRLQFRF*
Ga0126361_1066395913300010876Boreal Forest SoilGVNWYPNYWVKYMVNVAIDQLKDPSTTGQVPQNFVVVLQRLQFRF*
Ga0138583_110151813300011060Peatlands SoilLNWYPNYWVKYVVNLGIDQLKDPSVTGAESQNYFVVLQRIQFRF*
Ga0138572_104845413300011077Peatlands SoilTMGLNWYPNYWVKYVVNLAIDQLKDPSLIGAVPQNYFVVLQRLQFRF*
Ga0138568_119552123300011080Peatlands SoilYPNYWVKYVVNLAIDQLKEPSTIGAVPQNYFVVLQRLQFRF*
Ga0138579_100143813300011090Peatlands SoilTTEYTMGLNWYPNYWVRYMVNLNIDQLKDPSLIGAVPQNYFVVLQRLQFRF*
Ga0138532_100960013300011305Peatlands SoilTMGLNWYPNYWVKYVVNLAIDQLKDPSTIGAVPQNYFTVLQRLQFRF*
Ga0181518_1026442813300014156BogKYVFNLGIDQLKEPSVIGQEPQNYFVVTQRLQFRF*
Ga0181530_1041444013300014159BogYWVKYVFNLGIDQLKEPSVIGQEPQNFYVVTQRLQFRF*
Ga0181538_1041225523300014162BogWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF*
Ga0181528_1005482113300014167BogNWYLNYWVKYVVDLDVDRLKNPNTIGSLPQDYVVVLQRLQFRF*
Ga0181531_1029080913300014169BogNYWVKYVVDLDVDRLKNPNTIGSLPQDYVVVLQRLQFRF*
Ga0182030_1016548133300014838BogVKYVFNLGVDQLKEPSTIGALPQNYFVVTQRVQFRF*
Ga0182036_1067635623300016270SoilFNWYLNYWVKYQVNLGVDRLKQVSINTGAVPQNYFVALQRLQFRF
Ga0187802_1040991923300017822Freshwater SedimentFGINWYPNYWVKYMVNVGIDQLHQPSTTGQLPQNFYVVLQRLQFRF
Ga0187856_103467823300017925PeatlandNYHTFEYTAGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0187849_124835723300017929PeatlandWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0187877_103981723300017931PeatlandFEYTAGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0187848_1031947823300017935PeatlandYPNYWVKYQLNVNFDQLKEPSTIGAVPQTYYVIEQRLQFRF
Ga0187821_1030239923300017936Freshwater SedimentHTFEYTAGLNWYLNNWVKYQFNFNIDQLKEPSTIGQVPGTYFVFLNRIQFRF
Ga0187854_1043010023300017938PeatlandYTAGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0187819_1047172513300017943Freshwater SedimentTDQITIGLNWYPNYWVKYMVNLGIDQLHQPSVTGQVPQNFFVVLQRLQFRF
Ga0187817_1001776953300017955Freshwater SedimentGLNWYPNYWVRYMVNFNIDRLKDPSTIGAEPQNYYVVLQRVQFRF
Ga0187817_1045964123300017955Freshwater SedimentFTFGVNWYPNYWVRYSTEFNVDQLKQPSTIGIVPQNYFVFLQRLQFRF
Ga0187891_104396323300017996PeatlandWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0187865_123374613300018004PeatlandTFDYHTREYTVGLNWYPNYWVRYMVNLSVDQLKDPSLTAALPQNYFVVLQRLQFRF
Ga0187878_130166713300018005PeatlandVGLNWYPNYWVRYMVNLSVDQLKEPSLTGALPQNYFVVLQRLQFRF
Ga0187888_129522013300018008PeatlandTFNYHTDEITMGLTWYPNYWVKYQFNLAIDQLKDPSTIGAVPQNYYTLLQQLQFRF
Ga0187884_1042159813300018009PeatlandNDHTKEYTIGLNWYPNYWVKYVLNLGIDQLKEPSVIGQEPQNFYVVMQRLQFRF
Ga0187864_1016954623300018022PeatlandFNYHTFEYTAGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0187857_1036672613300018026PeatlandEYTAGVNWYPNYWVKYQVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0187855_1006873813300018038PeatlandPNYWVKYVVNLGIDQLKDPSVIGAEPQNYFVVTQRLQFRF
Ga0187855_1086975323300018038PeatlandWYPNYWVKYSVNLGVDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0187871_1009270813300018042PeatlandNYWVKYMVNLGIDQLKEPSTIGNLPQNYYVVTQRLQFRF
Ga0187887_1001493523300018043PeatlandVNWYPNYWVKYVLNVGVDKLKEPSVIGQEPQNYFVVLQRLQFRF
Ga0187890_1033272113300018044PeatlandWYPNYWVRYMVNVAIDQLKDPSTIGAVPQNYYVVMQRLQFRF
Ga0187772_1087595823300018085Tropical PeatlandEFTFGVNWYPNYWVKYMLNVGIDQLKQPSVIGSVPQDYFVVLQRLQFRF
Ga0181510_119939923300019240PeatlandNWYPNYWVKYVLNVGIDQLKDPSTIGAVPQNYFVITQRLQFRF
Ga0187797_129629913300019284PeatlandWYLNYWSKYIVNVGIDQLKDPSTIGAVPQNYYVVTQRLQFRF
Ga0210403_1090970023300020580SoilHTVEYTAGVNWYPNYWVKYVFNLGVDQLKQPSTIGAEPQNYFVVLQRLQFRF
Ga0210395_1059366313300020582SoilVEYTAGVNWYPNYWVKYVFNLGVDQLKQPSTIGAEPQNYFVVLQRLQFRF
Ga0210386_1050798213300021406SoilNWYPNYWVKYMVNLGINQLREPSTIGAIPQNYYVISQELQFRF
Ga0210390_1156849013300021474SoilWYPNYWVKYSVNLGVDQLKEPSTIGAVPQNYYVVLQQLQFRF
Ga0210392_1099742913300021475SoilYDFHTDEITFGLNWYPNYWVKYMVNVGIDQLHQPSTTGQLPQNFFVIMQRLQFRF
Ga0210398_1004131713300021477SoilFPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0242647_101282323300022505SoilDEFTFGVTWYPNYWVKYSVNLGVDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0242657_102771013300022722SoilTDEITLGLNWYPNYWVKYMVNLGIDQLHQPSTTGQIPQNFFVIMQRLQFRF
Ga0224557_104467223300023101SoilTFGLNWYPNYWVKYVVNLGIDQLKEPSVTGAEPQNYYVVMQRLQFRF
Ga0208189_101721823300025444PeatlandGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0208039_101226813300025454PeatlandTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0208562_101144913300025460PeatlandTFEYTAGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0208192_109122323300025477PeatlandRYMVNLSVDQLKDPSLTAALPQNYFVVLQRLQFRF
Ga0208686_113372713300025500PeatlandHTTEYTIGINYYPNYWVKYMVNAAIDQLKDPSTIGAVPQNYFVVMQRLQFRF
Ga0208563_103047223300025501PeatlandYHTFEYTAGVTWYPNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0208725_106443323300027158Forest SoilNWYPNYWVKYVLNVSLDQLKEPSVLGQVPQNFYVIEQRLQFRF
Ga0208241_106882323300027297Forest SoilFNDHTVEYTAGVNWYPNYWVKYVFNLGVDQLKQPSTIGAEPQNYFVVLQRLQFRF
Ga0208241_108673913300027297Forest SoilKYSVNLGVDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0209733_111080723300027591Forest SoilTFGVNWYPNYWVKYMVNVGIDQLHQPSITGQLPQNFFVVMQRLQFRF
Ga0209221_117389623300027609Forest SoilGLNWYPNYWVKYVVNVGIDQLKDPSVTGAEPQNYYVVLQRLQFRF
Ga0208827_120848423300027641Peatlands SoilTREYTAGLNWYPNYWVRYMVNLSVDQLKDPSTIGAVPQNYFVVLQRLQFRF
Ga0209420_116871523300027648Forest SoilVNWYPNYWTKYQLNFNVDQLKDPSLTGALPQNYFVVEQRLQFRF
Ga0209693_1039851013300027855SoilWVKYVLNVGIDQLKDPSTIGAVPQNYFVVTQRLQFRF
Ga0209275_1045923413300027884SoilITFGLNWYPNYWVKYMVNVGIDQLHQPSTTGQLPQNFFVVMQRLQFRF
Ga0209275_1085026913300027884SoilTFNYHTDEITAGLTWYPNYWVKYQVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0209006_1111391623300027908Forest SoilGLNWYPNYWVKYMVNVGIDQLHQPSTAGQVPQNFFVILQRLQFRF
Ga0209168_1033240613300027986Surface SoilGLNWYLNNWVKYQFNFNIDQLKEPSTIGQVPGTYFVFLNRIQFRF
Ga0247275_100502213300029817SoilNYWVKYSVNLGIDQLKDPSTIGAVPQNYYVVLQQLQFRF
Ga0311369_1138193723300029910PalsaYPNYWVKYMVNLAIDQLKDPSTIGSLPQNYYVVMQRLQFRF
Ga0210268_120568123300030629SoilWVKYQVNLGIDQLKNPSTIGAVPQNYYVVLQQLQFRF
Ga0265459_1259346723300030741SoilEYTAGVNWYPNYWVKYVLNVGIDQLKEPSVIGQEPQNYYVIEQRLQFRF
Ga0265770_111444623300030878SoilVKYVLNIGIDQLKDPSVTGAEPQNYYVILQRLQFRF
Ga0265771_100850513300031010SoilVNWFPNYWVKYSVNLGIDQLKDPSTIGAVPQNYFVVLQQLQFRF
Ga0170834_11048264213300031057Forest SoilPNYWVKYMVNVAIDQLKDPSTTGQVPQNFVVVLQRLQFRF
Ga0302326_1149287813300031525PalsaFNDHTDEFTVGVNWYPNYWVKYVFNLGVDQLKDPSVIGSVPQNYFVFLQRIQFRF
Ga0307474_1000749193300031718Hardwood Forest SoilTYDYHTDEITFGVNWYPNYWVKYMVNVGVDQLHQPSATGQLPQNFFVVLQRLQFRF
Ga0307478_1034653913300031823Hardwood Forest SoilWYPNYWVKYMVNVGIDQLKQPSTTGQIPQNFYVVLQRLQFRF
Ga0307479_1018203213300031962Hardwood Forest SoilHTDEITFGLNWYPNYWVKYMVNVGIDQLKQPSTTGQIPQNFYVVLQRLQFRF
Ga0311301_1039528123300032160Peatlands SoilWYPNYWVRYSTEFNVDQLKQPSTIGIVPQNYFVFLQRLQFRF
Ga0334850_000288_28894_290163300033828SoilPNYWVKYVVNVGIDQLKQPSLIGAEPQNYFVVLQRLQFRF
Ga0371487_0270583_646_7773300033982Peat SoilNWYPNYWVKYVVNLGIDQLKDPSITGAEPQNYYVVMQRLQFRF
Ga0370483_0351647_348_5093300034124Untreated Peat SoilFHTREYTIGLNWYPNYWVKYQFNVAIDQLKDPSLIGAIPQNYFVALQRLQFRF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.