Basic Information | |
---|---|
Family ID | F080233 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 38 residues |
Representative Sequence | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 6.09 % |
% of genes near scaffold ends (potentially truncated) | 63.48 % |
% of genes from short scaffolds (< 2000 bps) | 66.09 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.609 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (33.913 % of family members) |
Environment Ontology (ENVO) | Unclassified (79.130 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.652 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF00471 | Ribosomal_L33 | 38.26 |
PF00574 | CLP_protease | 33.04 |
PF01970 | TctA | 2.61 |
PF13640 | 2OG-FeII_Oxy_3 | 2.61 |
PF08003 | Methyltransf_9 | 2.61 |
PF13186 | SPASM | 1.74 |
PF00501 | AMP-binding | 1.74 |
PF02826 | 2-Hacid_dh_C | 1.74 |
PF06945 | DUF1289 | 1.74 |
PF02585 | PIG-L | 0.87 |
PF05050 | Methyltransf_21 | 0.87 |
PF13489 | Methyltransf_23 | 0.87 |
PF04055 | Radical_SAM | 0.87 |
PF03567 | Sulfotransfer_2 | 0.87 |
PF03480 | DctP | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 66.09 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 66.09 |
COG0267 | Ribosomal protein L33 | Translation, ribosomal structure and biogenesis [J] | 38.26 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 33.04 |
COG1784 | TctA family transporter | General function prediction only [R] | 2.61 |
COG3333 | TctA family transporter | General function prediction only [R] | 2.61 |
COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 1.74 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.61 % |
All Organisms | root | All Organisms | 37.39 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 33.91% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.00% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.43% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.57% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.35% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.48% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.61% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.74% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.74% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.74% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.74% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.74% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.87% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.87% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.87% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.87% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.87% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
3300020052 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020168 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409BT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020280 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX556044-ERR599114) | Environmental | Open in IMG/M |
3300020294 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153) | Environmental | Open in IMG/M |
3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOWin2010_100507672 | 3300000117 | Marine | MFYIWHTLLIATFIAVAYYMGYHHGGKKAKVKETIRKS* |
DelMOWin2010_101124252 | 3300000117 | Marine | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS* |
JGI24003J15210_100207323 | 3300001460 | Marine | MFYIWHTLIIATFIAVAYYMGYHHGVKKAKVKETIRKS* |
JGI24004J15324_1000467511 | 3300001472 | Marine | YIWHTLIIATFIAVAYYMGYHHGGKKTKVEETIRKS* |
GOS2221_10190152 | 3300001938 | Marine | MFYIWHTLIITTFMAVAYYMGYHHATKKHKAKEITRKI* |
Ga0066830_100601723 | 3300005433 | Marine | DLISKINSMFYIWHTLLIATFIAVAYHMGYQHGGQKAKIKVRPRK* |
Ga0066865_100628794 | 3300005523 | Marine | TNSMFYIWHTLIIATFIAVAFHMGYQYGKRKVKIKKTLSKS* |
Ga0066835_102716722 | 3300005606 | Marine | MFYIWHTLLIATFIAVAYHMGYQHGGQKAKIKVRPRK* |
Ga0008649_100244343 | 3300005838 | Marine | MYMFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS* |
Ga0075445_100079566 | 3300006193 | Marine | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKLIIRNSK* |
Ga0075503_15732312 | 3300006400 | Aqueous | NSTKGVRVHAHLIITSMFYIWHTLLIATFIAVAYYMGYQHGGKKAKVKETIRKS* |
Ga0098037_12377343 | 3300006737 | Marine | SMFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKKTIRKS* |
Ga0098048_10279618 | 3300006752 | Marine | WHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS* |
Ga0075476_102363593 | 3300006867 | Aqueous | FYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKG* |
Ga0075476_103552011 | 3300006867 | Aqueous | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRK |
Ga0070750_102886251 | 3300006916 | Aqueous | IWHTLLIATFIAVAYYMGYQHGGKKAKVKETIRKS* |
Ga0098060_10755292 | 3300006921 | Marine | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKDKETIR* |
Ga0098045_10004238 | 3300006922 | Marine | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS* |
Ga0098041_12124854 | 3300006928 | Marine | NSMFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS* |
Ga0098052_12542151 | 3300008050 | Marine | MFYIWHTLIIASFIGVAYHLGYTYGKRQTKNKETIRKS |
Ga0115551_11778791 | 3300009193 | Pelagic Marine | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIR |
Ga0129348_12205502 | 3300010296 | Freshwater To Marine Saline Gradient | MFYVWHTLIIATFIAVAYQLGYLHGRKKAQVKKTLRKG |
Ga0163110_101067623 | 3300012928 | Surface Seawater | MFYIWHTILIATFIAVAYYMGYHHGGKKVKVKETIRKS* |
Ga0163109_100040805 | 3300012936 | Surface Seawater | MFYIWHTLIIVTFIAVAYQMGYLYGKGQNKVKKTVRKS* |
Ga0163179_100348734 | 3300012953 | Seawater | MFYIWHTLLIAAFISVGYYLGWEHGKRQAKNKETIRKS* |
Ga0163179_110908663 | 3300012953 | Seawater | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIR |
Ga0181369_10033008 | 3300017708 | Marine | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKIRLRK |
Ga0181387_10038596 | 3300017709 | Seawater | FYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0181387_10189003 | 3300017709 | Seawater | NSMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0181387_10583643 | 3300017709 | Seawater | MFYIWHTLIIATFIAVAYYMGYHHGGKKVKNKETIRK |
Ga0181391_11055153 | 3300017713 | Seawater | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETI |
Ga0181390_101099611 | 3300017719 | Seawater | MFYIWHTIIIATFIAVAYHMGYQYGKRQVKIKKALRKS |
Ga0181390_10181111 | 3300017719 | Seawater | IWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKG |
Ga0181390_10489003 | 3300017719 | Seawater | MFYIWHTLIIATFIAVAYYMGHQHGGKKAKVKETIRKS |
Ga0181373_10010395 | 3300017721 | Marine | MFYIWHTLIIATFIAVAYNMGHQHGRKEAKVKKTIRKS |
Ga0181388_10236831 | 3300017724 | Seawater | YRIINSMFYIWHTLIIATFIAVAYYMGYHHGGKKVKNKETIRKS |
Ga0181398_10079823 | 3300017725 | Seawater | MFYIWHTLIIATFIAVAYYMGYQHGGQKAKVKKTIRKS |
Ga0181398_10338782 | 3300017725 | Seawater | MFYIWHTLIIATFIAVAYYMGHQHGTKKVVEKKLPHSK |
Ga0181428_10064781 | 3300017738 | Seawater | IWHTLIIVTFIAMAYYMGYQHGGKKTKIKETIRKS |
Ga0181428_10841713 | 3300017738 | Seawater | INCMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0181433_10777433 | 3300017739 | Seawater | RIINSMFYIWHTLIIATFIAVAYYMGYQHGGQKAKVKETIRKS |
Ga0181421_10279971 | 3300017741 | Seawater | RIINSMFYIWHTLIIATFIAVAYYMGYHHGGKKVKNKETIRKS |
Ga0181399_10360485 | 3300017742 | Seawater | FYIWHTLIIATFIAVAYYMGYQHGGQKAKVKKTVRKS |
Ga0181392_10165451 | 3300017749 | Seawater | ISIINSMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKG |
Ga0181405_11154831 | 3300017750 | Seawater | IIINSMFYIWHTLIIATFIAVAYYMGYQYGGQKAKVKKTVRKS |
Ga0181400_11654321 | 3300017752 | Seawater | IWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0181407_10070233 | 3300017753 | Seawater | MFYIWHTLIIATFIAVAYHMGYQHGKRKVKIKKTLPKS |
Ga0181407_10607113 | 3300017753 | Seawater | MFYIWHTLIIATFIAVAYYMGYQHGGKKVKNKETI |
Ga0181407_11269541 | 3300017753 | Seawater | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRK |
Ga0181411_11391404 | 3300017755 | Seawater | YIWHTLIIVTFIAMAYYMGYQHGGKKTKIKETIRKS |
Ga0181420_10599595 | 3300017757 | Seawater | SMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0181409_10400541 | 3300017758 | Seawater | IRIINSMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETVRKS |
Ga0181409_10463245 | 3300017758 | Seawater | IIINSMFYIWHTLIIATFIAVAYYMGYQHGGQKAKVKKTVRKS |
Ga0181409_11547623 | 3300017758 | Seawater | FYIWHTLIIALFIAVAYHMGYQYGGKKTKIKKTIRKS |
Ga0181414_101188210 | 3300017759 | Seawater | QISIINSMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKG |
Ga0181414_10528614 | 3300017759 | Seawater | QIRYIIINSMFYIWHTLIIATFIAVAYYMGYQHGGQKAKVKKTIRKS |
Ga0181410_10474315 | 3300017763 | Seawater | FYIWHTLIIATFIAVAYYMGYQHGGQKAKVKKTIRKS |
Ga0181410_11276911 | 3300017763 | Seawater | CMFYIWHTLIIATFIAVAYYMGYHYGRQKVKVKKTIRKS |
Ga0181385_10024918 | 3300017764 | Seawater | MFYIWHTLIIATFIAVAYYLGYQHGAKKIKVTQSTRKK |
Ga0181385_10051173 | 3300017764 | Seawater | MFYIWHTLIIATFIAVAYYMGYQHGGQKAKVKKTVRKS |
Ga0181413_12513811 | 3300017765 | Seawater | IRFRIINSLFYIWHTLIIATFIAVAYYMGYHHGGKKANVKETIRKS |
Ga0181406_11106594 | 3300017767 | Seawater | RKMFYIWHTLIIATFIAVAYYMGYHHGGKKVKVKETIRKS |
Ga0181386_10427736 | 3300017773 | Seawater | YIWHTIIIATFIAVAYYMGYHHGGKKAKVKETIRKG |
Ga0181386_12470493 | 3300017773 | Seawater | FYIWHTLIIATFIAVAYYMGYHHGGKEAKVKETIRKG |
Ga0181380_10520701 | 3300017782 | Seawater | NSMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKG |
Ga0181379_10048813 | 3300017783 | Seawater | MFYIWHTLIIATFIAVAYYLGYHHGGKEVKIKKTIRKS |
Ga0181580_100723234 | 3300017956 | Salt Marsh | MFYIWHTLLIATFIAVAYYMGYHHGGKKAQVKETIRKS |
Ga0181580_102442613 | 3300017956 | Salt Marsh | FYIWHTLIIATFVAVAFQMGYLYGKRQNKVKETIRKS |
Ga0181561_100441454 | 3300018410 | Salt Marsh | MYMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0181553_100966611 | 3300018416 | Salt Marsh | YMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0181553_106064312 | 3300018416 | Salt Marsh | MFYIWHTLLIATFIAVAYYMGYQHGGKKAKVKETIRKG |
Ga0181558_106484822 | 3300018417 | Salt Marsh | MFYIWHTLIIATFIAVAFQMGYQYGKRQNKVKKTISKS |
Ga0181568_112677121 | 3300018428 | Salt Marsh | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETI |
Ga0194029_10485703 | 3300019751 | Freshwater | VHAHLIITSMFYIWHTLLIATFIAVAYYMGYHYGGKKAKVKETIRKS |
Ga0181554_10692855 | 3300020052 | Salt Marsh | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS |
Ga0206125_100683886 | 3300020165 | Seawater | NNMFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS |
Ga0181588_103436151 | 3300020168 | Salt Marsh | MFYIWHTLLIATFIAVAYYMGYQHGGKKAKVKETIR |
Ga0181599_10571361 | 3300020178 | Salt Marsh | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0206131_104129651 | 3300020185 | Seawater | FYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKG |
Ga0211591_11036701 | 3300020280 | Marine | INSMFYIWHTLLIATFIAVAYHMGYQHGGQKAKIKVRPRK |
Ga0211520_10558463 | 3300020294 | Marine | MFDIWHTLLIAAFISIGYYLGWEHGKRQAKNKETIRK |
Ga0211510_10798033 | 3300020336 | Marine | MFYIWHTIIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0211476_102940231 | 3300020381 | Marine | MFYIWHTLIIAVFIAVAYHMGYQHGSKQVKKVNTPK |
Ga0211659_104697321 | 3300020404 | Marine | MFYIWHTLIIATFIAVAYYMGYQHGGKKIKNKETI |
Ga0211539_104383781 | 3300020437 | Marine | IWHTLIIATFIAVAYYMGYQHGGKKIKNKETIRKS |
Ga0211564_102782141 | 3300020445 | Marine | INSMFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKKTIRKS |
Ga0211641_1000527713 | 3300020450 | Marine | MFYIWHTLIIATFIAVAYHMGYQYGKRQTKVKKTISKS |
Ga0211541_101810971 | 3300020475 | Marine | INSMFYIWHTIIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0213858_100590763 | 3300021356 | Seawater | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKG |
Ga0222718_1000670713 | 3300021958 | Estuarine Water | MIMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0222718_106035761 | 3300021958 | Estuarine Water | IWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS |
Ga0222716_100905973 | 3300021959 | Estuarine Water | MFYIWHTLLIATFIAVAYYMGYQHGGKKAKVKETIRKS |
Ga0222715_100789825 | 3300021960 | Estuarine Water | YMFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS |
Ga0212021_10665411 | 3300022068 | Aqueous | MFYIWHTLIIATFIAVAYYMGYQHGGKETKVKETIRKS |
Ga0224906_10186512 | 3300022074 | Seawater | MFYIWHTLIIATFIAVAYYMGYHHGGKEAKVKETIRKG |
Ga0255779_12705981 | 3300022922 | Salt Marsh | FYMFYIWHTLIIATFIAVAFHMGYQYGKRQNKVKKTVSKS |
Ga0255773_100152001 | 3300022925 | Salt Marsh | YIWHTLLIATFIAVAYYMGYHHGGKKAKVKETIRKS |
(restricted) Ga0233427_100212726 | 3300022933 | Seawater | MFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKG |
Ga0208157_10383645 | 3300025086 | Marine | RTGDNSTKGVRVHAHLIITSMFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETIRKS |
Ga0209535_10064654 | 3300025120 | Marine | MFYIWHTLIIATFIAVAYHLGYQHGAKKIKVTQSTRKK |
Ga0209535_10080616 | 3300025120 | Marine | MFYIWHTLIIVTFIAMAYYMGYQHGGKKTKIKETIRKS |
Ga0209535_10108324 | 3300025120 | Marine | MFYIWHTLIIATFIAVAYYMGYQHGGKKVKNKETIRKS |
Ga0209348_10362623 | 3300025127 | Marine | MFYIWHTLIIATFIAVAYYMGYQHGGKKIKNKETIRKS |
Ga0209232_10113287 | 3300025132 | Marine | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKETVRKS |
Ga0209336_100112037 | 3300025137 | Marine | YIWHTLIIATFIAVAYYMGYHHGGKKTKVEETIRKS |
Ga0209336_101558891 | 3300025137 | Marine | MFYIWHTLIIATFIAVAYYMGYQHGGKKVKVKKTLRKS |
Ga0209336_101607851 | 3300025137 | Marine | MFYIWHTLIIATFIAVAYYMGYHHGGKKTKVEETI |
Ga0208814_10084454 | 3300025276 | Deep Ocean | MFYIWHTLIIATFIAVAYYMGYHHGGKKAKVKLIIRNSK |
Ga0209306_10339159 | 3300025680 | Pelagic Marine | RIINSMFYIWHTLIIATFIAVAYYMGYQHGGKKAKVKETIRKS |
Ga0208763_100000973 | 3300026136 | Marine | MFYIWHTLIIVTFIAVAYHMGYQYGKGQSKVKKTIRKG |
Ga0208407_10100016 | 3300026257 | Marine | MFYIWHTLIIATFIAVAYYMGYNHGGKKAKVKETIRKS |
Ga0257106_10876411 | 3300028194 | Marine | MFYIWHTLIIATFIAVAYYMGYHHGSKKSKSKKLRPHS |
Ga0315320_100433243 | 3300031851 | Seawater | MFYIWHTLIIATFIAVAYYMGYHYGGQKAKVKKTVRKS |
Ga0315320_101107291 | 3300031851 | Seawater | IRYIIINSMFYIWHTLIIATFIAVAYYMGYQHGGQKAKVKKTVRKS |
Ga0315320_101803511 | 3300031851 | Seawater | MFYIWHTLIIATFIAVAYYMGYQHGGQKAKVKKTI |
⦗Top⦘ |