NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080188

Metagenome / Metatranscriptome Family F080188

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080188
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 87 residues
Representative Sequence VVQGAFLAAVLLLGCDGGPCKATKSAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ
Number of Associated Samples 93
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 20.00 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 90.43 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.130 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.652 % of family members)
Environment Ontology (ENVO) Unclassified
(48.696 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(51.304 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 2.78%    β-sheet: 21.30%    Coil/Unstructured: 75.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF13432TPR_16 35.65
PF13174TPR_6 5.22
PF01790LGT 1.74
PF13483Lactamase_B_3 1.74
PF09527ATPase_gene1 0.87
PF00202Aminotran_3 0.87
PF08443RimK 0.87
PF12706Lactamase_B_2 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 1.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.13 %
UnclassifiedrootN/A0.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16600213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1184Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1047967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium561Open in IMG/M
3300001431|F14TB_100614922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1064Open in IMG/M
3300001990|JGI24737J22298_10054191All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1214Open in IMG/M
3300002077|JGI24744J21845_10065685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium663Open in IMG/M
3300003659|JGI25404J52841_10017071All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1574Open in IMG/M
3300004268|Ga0066398_10206120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium521Open in IMG/M
3300005295|Ga0065707_10582667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium701Open in IMG/M
3300005332|Ga0066388_100363814All Organisms → cellular organisms → Bacteria2093Open in IMG/M
3300005332|Ga0066388_100882932All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1475Open in IMG/M
3300005436|Ga0070713_100596116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1049Open in IMG/M
3300005456|Ga0070678_100311172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1342Open in IMG/M
3300005543|Ga0070672_100000800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae18754Open in IMG/M
3300005764|Ga0066903_102163784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1072Open in IMG/M
3300005764|Ga0066903_102464922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1007Open in IMG/M
3300005983|Ga0081540_1007911All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus7506Open in IMG/M
3300006237|Ga0097621_100128468All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2155Open in IMG/M
3300006605|Ga0074057_11623282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium537Open in IMG/M
3300006871|Ga0075434_100939769All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium879Open in IMG/M
3300006914|Ga0075436_100295516All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1160Open in IMG/M
3300009156|Ga0111538_10453993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1624Open in IMG/M
3300010047|Ga0126382_11213200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium676Open in IMG/M
3300010376|Ga0126381_100170448All Organisms → cellular organisms → Bacteria → Proteobacteria2881Open in IMG/M
3300012931|Ga0153915_12885242Not Available561Open in IMG/M
3300012971|Ga0126369_12131907All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium648Open in IMG/M
3300012984|Ga0164309_10495214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium934Open in IMG/M
3300015371|Ga0132258_10005045All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales25818Open in IMG/M
3300016270|Ga0182036_10529451All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium937Open in IMG/M
3300016294|Ga0182041_11380482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium646Open in IMG/M
3300016294|Ga0182041_11734175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium578Open in IMG/M
3300016357|Ga0182032_10278795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1311Open in IMG/M
3300016357|Ga0182032_10913898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium746Open in IMG/M
3300016357|Ga0182032_11427151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium600Open in IMG/M
3300017947|Ga0187785_10430006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium642Open in IMG/M
3300017947|Ga0187785_10583419All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium571Open in IMG/M
3300017974|Ga0187777_10129877All Organisms → cellular organisms → Bacteria → Proteobacteria1672Open in IMG/M
3300018060|Ga0187765_10795166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium630Open in IMG/M
3300021560|Ga0126371_12312438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium649Open in IMG/M
3300025290|Ga0207673_1049625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium594Open in IMG/M
3300025915|Ga0207693_11052783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium619Open in IMG/M
3300025924|Ga0207694_10410257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1127Open in IMG/M
3300025928|Ga0207700_10480651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1098Open in IMG/M
3300025945|Ga0207679_12173320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium504Open in IMG/M
3300026121|Ga0207683_10487278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1138Open in IMG/M
3300027654|Ga0209799_1138998All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium553Open in IMG/M
3300027703|Ga0207862_1255196All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium513Open in IMG/M
3300027743|Ga0209593_10056454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1500Open in IMG/M
3300031543|Ga0318516_10598825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium629Open in IMG/M
3300031543|Ga0318516_10731860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium561Open in IMG/M
3300031544|Ga0318534_10520586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium679Open in IMG/M
3300031545|Ga0318541_10428902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium739Open in IMG/M
3300031549|Ga0318571_10223532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium683Open in IMG/M
3300031549|Ga0318571_10282628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium619Open in IMG/M
3300031572|Ga0318515_10045351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2195Open in IMG/M
3300031572|Ga0318515_10735952All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium521Open in IMG/M
3300031640|Ga0318555_10544151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium629Open in IMG/M
3300031680|Ga0318574_10435194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium767Open in IMG/M
3300031716|Ga0310813_11093636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium730Open in IMG/M
3300031720|Ga0307469_10191732All Organisms → cellular organisms → Bacteria → Proteobacteria1585Open in IMG/M
3300031723|Ga0318493_10901635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium501Open in IMG/M
3300031744|Ga0306918_10609344All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium856Open in IMG/M
3300031764|Ga0318535_10214641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium861Open in IMG/M
3300031765|Ga0318554_10668528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium584Open in IMG/M
3300031769|Ga0318526_10420569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium546Open in IMG/M
3300031770|Ga0318521_10682855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium623Open in IMG/M
3300031771|Ga0318546_10684251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium722Open in IMG/M
3300031771|Ga0318546_11079826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium564Open in IMG/M
3300031781|Ga0318547_10888965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium556Open in IMG/M
3300031781|Ga0318547_11002115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium522Open in IMG/M
3300031781|Ga0318547_11076206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium503Open in IMG/M
3300031795|Ga0318557_10230972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium846Open in IMG/M
3300031795|Ga0318557_10551073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium529Open in IMG/M
3300031821|Ga0318567_10308408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium893Open in IMG/M
3300031831|Ga0318564_10338749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium661Open in IMG/M
3300031833|Ga0310917_10263283All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae1162Open in IMG/M
3300031859|Ga0318527_10052702All Organisms → cellular organisms → Bacteria1589Open in IMG/M
3300031860|Ga0318495_10105433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1269Open in IMG/M
3300031890|Ga0306925_10898808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium911Open in IMG/M
3300031890|Ga0306925_12040840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium539Open in IMG/M
3300031894|Ga0318522_10403404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium518Open in IMG/M
3300031896|Ga0318551_10202024All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1100Open in IMG/M
3300031897|Ga0318520_10704876All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium631Open in IMG/M
3300031910|Ga0306923_10704844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1123Open in IMG/M
3300031910|Ga0306923_11171583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium823Open in IMG/M
3300031947|Ga0310909_11454378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium547Open in IMG/M
3300031954|Ga0306926_10756980All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1174Open in IMG/M
3300031954|Ga0306926_10985059All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1004Open in IMG/M
3300031981|Ga0318531_10408313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium615Open in IMG/M
3300031981|Ga0318531_10428599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium599Open in IMG/M
3300032001|Ga0306922_11271899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium745Open in IMG/M
3300032009|Ga0318563_10319619All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium840Open in IMG/M
3300032017|Ga0310899_10277719All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium770Open in IMG/M
3300032039|Ga0318559_10586211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium520Open in IMG/M
3300032041|Ga0318549_10122780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1145Open in IMG/M
3300032052|Ga0318506_10215847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium848Open in IMG/M
3300032089|Ga0318525_10560714All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium583Open in IMG/M
3300032091|Ga0318577_10563038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium542Open in IMG/M
3300032094|Ga0318540_10488325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium595Open in IMG/M
3300032179|Ga0310889_10787990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium501Open in IMG/M
3300032180|Ga0307471_100546141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1313Open in IMG/M
3300032205|Ga0307472_100000469All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales14218Open in IMG/M
3300032261|Ga0306920_101150593All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1123Open in IMG/M
3300032782|Ga0335082_10032227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales5554Open in IMG/M
3300032782|Ga0335082_10454475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1144Open in IMG/M
3300032782|Ga0335082_10524636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1046Open in IMG/M
3300032782|Ga0335082_11140606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium646Open in IMG/M
3300032783|Ga0335079_10010485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales10550Open in IMG/M
3300033289|Ga0310914_11498146All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium578Open in IMG/M
3300033433|Ga0326726_12075650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium553Open in IMG/M
3300033480|Ga0316620_10034406All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales3266Open in IMG/M
3300033480|Ga0316620_11231204All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium734Open in IMG/M
3300033486|Ga0316624_11846603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium559Open in IMG/M
3300033550|Ga0247829_11026020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium685Open in IMG/M
3300034090|Ga0326723_0111139All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1189Open in IMG/M
3300034090|Ga0326723_0214326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium855Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.04%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.61%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.74%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.87%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_002676902088090014SoilVVNGARFVLKCRAVRSRRAVQGAILAAALLLGCDGGPCKASVSAVTGLDGGQVRCVRPEDCPLTSNVAICADTGEPTLPTQSCVRCEQTQCVKYACSQ
AP72_2010_repI_A10DRAFT_104796713300000651Forest SoilRVGACIACGAGRMRASHRVGSVGRAFRSSIPADVVNGARFVLKSLAVRPRCVALAAFLAAVLLLGCDGGPCKATTSAVTGLDAGQVRCVRPEDCPLTGNLAVCGDTSEPNLPTTSCVRCEQTLCVKYACSQ*
F14TB_10061492223300001431SoilCNATVSAVTGLDAGQVSCVRAEDCPLTANLLVCADSSEPSRPTQSCVRCEQTLCVKYACSP*
JGI24737J22298_1005419123300001990Corn RhizosphereTAVRPRCVVQGALLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ*
JGI24744J21845_1006568523300002077Corn, Switchgrass And Miscanthus RhizosphereLLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ*
JGI25404J52841_1001707123300003659Tabebuia Heterophylla RhizosphereVVKGARFVLKWRAVRPRRAVPASILAAVFLLGCDGGRCNATVSAVTGLDAGQVRCVRPEDCPLTGNLLVCADTSEPSLPSQSCVRCEELLCVKYACPQ*
Ga0066398_1020612013300004268Tropical Forest SoilGARFVLKSRAVRPRCVPLAALLAAALLLGCDGGSCKATKSALTGLDGGQVRCVRPEDCPLTGNLAVCGDTSEPNLPTTSCVRCEQTLCVKYACSD*
Ga0065707_1058266713300005295Switchgrass RhizosphereLGCDGGPCKATVSAVTGLDAGQVRCVRPEDCPLTGNLAVCADTSEPNLPAQSCVRCEQTLCVKYACSQ*
Ga0066388_10036381423300005332Tropical Forest SoilMRVSHRVGSVGRACRSSTRADVVNGARFVLKSRAVRPRCVPLAALLAAALLLGCDGGSCKATKSALTGLDGGQVRCVRPEDCPLTGNLAVCGDTSEPNLPTTSCVRCEQTLCVKYACSQ*
Ga0066388_10088293223300005332Tropical Forest SoilVENGVRFVLKCCTVGLRSVVRVAILAGALLLGCDGGPCKATVSVVRGLDGGQLSCVRPEDCPLAGNLLVCADTGEPNLPTQACVRCEQAQCVKYACSQ*
Ga0070713_10059611613300005436Corn, Switchgrass And Miscanthus RhizosphereTASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ*
Ga0070678_10031117223300005456Miscanthus RhizosphereVRPRCVVQGAFLAAVLLLGCDGGPCKATKSAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ*
Ga0070672_100000800153300005543Miscanthus RhizosphereVLKWSAVRPRCVVQGALLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ*
Ga0066903_10216378423300005764Tropical Forest SoilVVEGARFVLKCRTVRPHRVVQVAILAAVVLLGCDGGPCKATRSAVTGLDGGQVRCVRPEDCPLTSNLAICADTGEPNLPTQSCVRCDETLCVKYSCSQ*
Ga0066903_10246492223300005764Tropical Forest SoilVLKCRAVRLRGVVQRAILAGFLLLGCDGGPCKATVSAVTGLDGGQLRCVQPGDCPLSGNVAICADTGEPNLPTQACVRCEQTQCVKYSCSQ*
Ga0081540_100791123300005983Tabebuia Heterophylla RhizosphereVVEGARFVLKCRAVRPRRVVQVGILAAVLLLGCDGGPCKATRSAVTGLDGGQVRCVRPEDCPLTSNLAICADTGEPNLPTQSCVRCDETLCVKYSCSQ*
Ga0097621_10012846833300006237Miscanthus RhizosphereVLKCSAVRPRCVVQGAFLAAVLLLGCDGGPCKATKSAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ*
Ga0074057_1162328213300006605SoilVVNGARFVLKCRTVRPRRVVQGAVLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTGEPTLPTQSCVRCDQTLCVKYACSQ*
Ga0075434_10093976913300006871Populus RhizosphereVLKCSAVRPRCVVQGAFLAAVLLLGCDGGPCKATKSAVIGLDGGQVRCVRPEDCPLTGNLVICADTSEPNLPTQSCVRCEQTLCVKYACSQ
Ga0075436_10029551613300006914Populus RhizosphereLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ*
Ga0111538_1045399333300009156Populus RhizosphereVSAVTGLDAGQVSCVRAEDCPLSANLLVCADSSEPSRPTQSCVRCEQTLCVKYACS
Ga0126382_1121320023300010047Tropical Forest SoilVVNGARFVFKSGAVRSRCAALAAFLAAALLLGCDGGPCKATVSVVRGLDGGQLSCVRPEDCPLAGNLLVCADTGEPNLPTQACVRCEQAQCVKYACSQ*
Ga0126381_10017044833300010376Tropical Forest SoilVSGVENGARFVLKCCTVGLRSVVRVAILAGVLLLGCDGGPCKTTVSAVRGLDGGQVHCVRPEDCPLSANLLVCADTTEPNLPTQACVRCEQTACVKYVCSQ*
Ga0153915_1288524223300012931Freshwater WetlandsMLAGACLLGCDGGPCKATASAILGLDGGQVICVRPEDCPLTGSVAICADTGEPNLPTQSCVRCEQTLCVKYACSQ*
Ga0126369_1213190713300012971Tropical Forest SoilILAGVLLLGCDGGPCKTTVSAVRGLDGGQVHCVRPEDCPLSANLLVCADTTEPNLPTQACVRCEQTACVKYVCSQ*
Ga0164309_1049521423300012984SoilVVQGALLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACS
Ga0132258_1000504563300015371Arabidopsis RhizosphereVVQGAFLAAVLLLGCDGGPCKATKSAVIGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ*
Ga0182036_1052945123300016270SoilMPASLLLGSVARACRSSTRADVVNGARFVLKSSAVRPRCVAQAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0182041_1138048223300016294SoilDRATVERVASEVENGARFVLKCCTVGLRSVVRVAILAGVLLLGCDGGPCKTTVSAVLGLDGGQVHCVRPEDCPLSANLLVCADTTEPNLPTQACVRCEQTVCMKYVCSQ
Ga0182041_1173417523300016294SoilVLLLAVMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETEC
Ga0182032_1027879513300016357SoilMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETECWL
Ga0182032_1091389813300016357SoilSTRADVVNGARFVLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0182032_1142715113300016357SoilVVNGARFVFKSRAVRSRCAALAAFLAAALLLGCDGGPCKATTSAVIGLDGGQVHCVRPEDCPLTGKLAICADTSEPNLPTQSCVRCE
Ga0187785_1043000623300017947Tropical PeatlandLRRSTVVDGARFVLKCRTVRPRSAVQVAILDDLLLLGCDGGPCKATRSAITGLDGGQVRCVRPEDCPLTSNLAICADTGEPNLPTQSCVRCDETLCVKYSCSQ
Ga0187785_1058341923300017947Tropical PeatlandVLKCCAVRLRGVVQRAILAWVLSLGCDGGPCKATVSAVTGLDGGQVRCVQPEDCPLSGNVAICADTGEPNLPTQACVRCEQTECVKYACSQ
Ga0187777_1012987723300017974Tropical PeatlandVLGVLLLAAAASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETECWLYACSG
Ga0187765_1079516623300018060Tropical PeatlandVLGVLLLAAVAPGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQ
Ga0126371_1231243823300021560Tropical Forest SoilDGGPCKATVSAVIGLDGGQLRCVQPEDCPLSSNVAICADTGEPNLPTQACVRCEQTQCVKYACSQ
Ga0207673_104962523300025290Corn, Switchgrass And Miscanthus RhizosphereVVQGALLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ
Ga0207693_1105278313300025915Corn, Switchgrass And Miscanthus RhizosphereVVQGALLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ
Ga0207694_1041025723300025924Corn RhizosphereVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ
Ga0207700_1048065123300025928Corn, Switchgrass And Miscanthus RhizosphereLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ
Ga0207679_1217332023300025945Corn RhizosphereVLKCSAVRPRCVVQGAFLAAVLLLGCDGGPCKATKSAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ
Ga0207683_1048727823300026121Miscanthus RhizosphereVVQGAFLAAVLLLGCDGGPCKATKSAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ
Ga0209799_113899813300027654Tropical Forest SoilRLSTCTDVVNGARFVFKSGAVRSRCAALAAFLAAALLLGCDGGSCKATKSALTGLDGGQVRCVRPEDCPLTGNLAVCGDTSEPNLPTTSCVRCEQTLCVKYACSD
Ga0207862_125519613300027703Tropical Forest SoilRSRCVALAAFLAAVVFLGCDGGPCKATSSAVTGLDGGQVRCVRPEDCPLSENLLVCGDTSEPNRPNTACVRCEQTLCVKFACQ
Ga0209593_1005645413300027743Freshwater SedimentVSAVTGLDAGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ
Ga0318516_1059882513300031543SoilTKSAVTGLDGGQVLCVRPEDCPLTGKLAICADTSEPNLPTQSCVRCDQSLCVKYACSQ
Ga0318516_1073186023300031543SoilWRGRVLGVLLLAVMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETECWLYACSG
Ga0318534_1052058613300031544SoilFKSRAVRSRCAALAAFLAAALLLGCDGGPCKATTSAVIGLDGGQVHCVRPEDCPLSGNLAVCGDTSEPNRSGTSCVRCEQSLCVKYSCPQ
Ga0318541_1042890223300031545SoilVLGVLLLAVMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETECWLYACSG
Ga0318571_1022353223300031549SoilVLKCRAVRLRGVVQRAILAGFLLLGCDGGPCKATVSAVLGLDGGQLRCVQPEDCPLSGNVAICADTGEPNLPTQACVRCEQTQCVKYSCSQ
Ga0318571_1028262823300031549SoilVLLLAVMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETECWLYACSG
Ga0318515_1004535123300031572SoilMPANLLLGSVARACRSSTRADVVNGARFVLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318515_1073595223300031572SoilLLLAVMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETECWLYACSG
Ga0318555_1054415113300031640SoilARFVFKCRTVRPRSVVQVAILAALLLLGCDGGPCKATRSAITGLDGGQVRCSRPEDCPLTSNLAICADTGEPNLPTQSCVRCDETLCVKYSCSQ
Ga0318574_1043519433300031680SoilVSAVLGLDGGQVHCVRPEDCPLSANLLVCADTTEPNLPTQACVRCEQTVCMKYVCSQ
Ga0310813_1109363613300031716SoilLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCVKYACSQ
Ga0307469_1019173213300031720Hardwood Forest SoilGPCKASKSAVNGLDGGQVRCARPEDCPLSNNAAICADTGEPNLPTQRCVRCEETECWLYACSG
Ga0318493_1090163513300031723SoilRGVVQRAILAGFLLLGCDGGPCKATVSAVLGLDGGQLRCVQPEDCPLSGNVAICADTGEPNLPTQACVRCEQTQCVKYSCSQ
Ga0306918_1060934423300031744SoilMPASLLLGSVARACRSSTRADVVNGARFVLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318535_1021464113300031764SoilEGSWQAAPAWMGRRIPVRRGHRWSARAADRATVERVASEVENGARFVLKCCTVGLRSVVRVAILAGVLLLGCDGGPCKTTVSAVLGLDGGQVHCVRPEDCPLSANLLVCADTTEPNLPTQACVRCEQTVCMKYVCSQ
Ga0318554_1066852813300031765SoilLLGCDGGPCKATTSAVIGLDGGQVHCVRPEDCPLSGNLAVCGDTSEPNRSGTSCVRCEQSLCVKYSCPQ
Ga0318526_1042056923300031769SoilTDVVNGARFVFKSRAVRSRCAALAAFLAAALLLGCDGGPCKATTSAVIGLDGGQVHCVRPEDCPLSGNLAVCGDTSEPNRSGTSCVRCEQSLCVKYSCPQ
Ga0318521_1068285513300031770SoilLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGKLAICADTSEPNLPTQSCVRCDQSLCVKYACSQ
Ga0318546_1068425113300031771SoilFVFKSRAVRSRCAALAAFLAAALLLGCDGGPCKATTSAVIGLDGGQVHCVRPEDCPLSGNLAVCGDTSEPNRSGTSCVRCEQSLCVKYSCPQ
Ga0318546_1107982623300031771SoilVALGPGRTPASFLPGSVARACRSSTRADVVNGARFVLKSSAVRPRCVAQAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGKLAICADTSEPNLPTQSCVRCDQSLCVKYACSQ
Ga0318547_1088896513300031781SoilTVVDGARFVFKCRTVRPRSVVQVAILAALLLLGCDGGPCKATRSAITGLDGGQVRCSRPEDCPLTSNLAICADTGEPNLPTQSCVRCDETLCVKYSCSQ
Ga0318547_1100211523300031781SoilLLGSVARACRSSTRADVVNGARFVLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318547_1107620623300031781SoilFVLKSSAVRPRCVAQAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGKLAICADTSEPNLPTQSCVRCDQSLCVKYACSQ
Ga0318557_1023097223300031795SoilVALGRGRMPASLLLGSVARACRSSTRADVVNGARFVLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318557_1055107323300031795SoilLLAVMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETECWLYACSG
Ga0318567_1030840823300031821SoilVNGARFVLKSSAVRPRCVAQAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGKLAICADTSEPNLPTQSCVRCDQSLCVKYACSQ
Ga0318564_1033874913300031831SoilVRSRCAALAAFLAAALLLGCDGGPCKATTSAVIGLDGGQVHCVRPEDCPLSGNLAVCGDTSEPNRSGTSCVRCEQSLCVKYSCPQ
Ga0310917_1026328323300031833SoilMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEETECWLYACSG
Ga0318527_1005270213300031859SoilLGSVARACRSSTRADVVNGARFVLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318495_1010543323300031860SoilVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGKLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0306925_1089880813300031890SoilVAILAALLLLGCDGGPCKATRSAITGLDGGQVRCSRPEDCPLTSNLAICADTGEPNLPTQSCVRCDETLCVKYSCSQ
Ga0306925_1204084023300031890SoilLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318522_1040340413300031894SoilVLLLAVMASGCEGGPCKAAKSAVNGLDGGQVRCTRPEDCPLSNNAAICADTGEPNLPTQQCVRCEET
Ga0318551_1020202423300031896SoilVVDGARFVLKCRTVRPRSVVQVAILAALLLLGCDGGPCKATRSAITGLDGGQVRCSRPEDCPLTSNLAICADTGEPNLPTQSCVRCDETLCVKYSCSQ
Ga0318520_1070487623300031897SoilDLEQRAPFVLKCRAVRLRGVVQRAILAGFLLLGCDGGPCKATVSAVLGLDGGQLRCVQPEDCPLSGNVAICADTGEPNLPTQACVRCEQTQCVKYSCSQ
Ga0306923_1070484413300031910SoilKATKSAVTGLDGGQVLCVRPEDCPLTGKLAICADTSEPNLPTQSCVRCDQSLCVKYACSQ
Ga0306923_1117158323300031910SoilVENGARFVLKCCTVGLRSVVRVAILAGVLLLGCDGGPCKTTVSAVLGLDGGQVHCVRPEDCPLSANLLVCADTTEPNLPTQACVRCEQTVCMKYVCSQ
Ga0310909_1145437813300031947SoilCKATTSAVIGLDGGQVHCVRPEDCPLSGNLAVCGDTSEPNRSGTSCVRCEQSLCVKYSCP
Ga0306926_1075698023300031954SoilRAILAGFLLLGCDGGPCKATVSAVLGLDGGQLRCVQPEDCPLSGNVAICADTGEPNLPTQACVRCEQTQCVKYSCSQ
Ga0306926_1098505923300031954SoilLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318531_1040831313300031981SoilARFVFKSRAVRSRCAALAAFLAAALLLGCDGGPCKATTSAVIGLDGGQVHCVRPEDCPLSGNLAVCGDTSEPNRSGTSCVRCEQSLCVKYSCPQ
Ga0318531_1042859923300031981SoilRPRCVAQAAFRAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0306922_1127189913300032001SoilGLRSVVRVAILAGVLLLGCDGGPCKTTVSAVLGLDGGQVHCVRPEDCPLSANLLVCADTTEPNLPTQACVRCEQTVCMKYVCSQ
Ga0318563_1031961923300032009SoilTVRPRSVVQVAILAALLLLGCDGGPCKATRSAITGLDGGQVRCSRPEDCPLTSNLAICADTGEPNLPTQSCVRCDETLCVKYSCSQ
Ga0310899_1027771913300032017SoilAVRPRCVVQGALLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ
Ga0318559_1058621113300032039SoilDVVNGARFVLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATVSAVLGLDGGQLRCVQPEDCPLSGNVAICADTGEPNLPTQACVRCEQTQCVKYSCSQ
Ga0318549_1012278033300032041SoilSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318506_1021584723300032052SoilRAPFVLKCRAVRLRGVVQRAILAGFLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318525_1056071423300032089SoilSRAVRSRCAALAAFLAAALLLGCDGGPCKATTSAVIGLDGGQVHCVRPEDCPLSGNLAVCGDTSEPNRSGTSCVRCEQSLCVKYSCPQ
Ga0318577_1056303823300032091SoilVNGARFVLKSSAVRPRCVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0318540_1048832523300032094SoilVAPAAFLAALLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0310889_1078799023300032179SoilGARFVLKSSAVRPRCVAHAAFLAAVLLLGCDGGPCKATASAVTGLDGGQVRCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCDQTLCVKYACSQ
Ga0307471_10054614113300032180Hardwood Forest SoilLLAAAASGCEGGPCKASKSAVNGLDGGQVRCARPEDCPLSNNAAICADTGEPNLPTQRCVRCEETECWLYACSG
Ga0307472_100000469103300032205Hardwood Forest SoilVLGVLLLAAAASGCEGGPCKASKSAVNGLDGGQVRCARPEDCPLSNNAAICADTGEPNLPTQRCVRCEETECWLYACSG
Ga0306920_10115059323300032261SoilVAILAGVLLLGCDGGPCKTTVSAVLGLDGGQVHCVRPEDCPLSANLLVCADTTEPNLPTQACVRCEQTVCMKYVCSQ
Ga0335082_1003222733300032782SoilVVNGAPFVLKWHAVRPRRAVHGAILAGAFLLGCDGGPCKATVSAVTGLDGGQVRCVRPEDCPLTGNLAICADTGEPNLPTQSCVRCEQIQCVKYACSQ
Ga0335082_1045447523300032782SoilMLAGACLLGCDGGPCKANASAILDLDGGQVICVRPEDCPLTGSIAICADTGEPNLPTQSCVRCEQTLCVKYACSQ
Ga0335082_1052463613300032782SoilAILAGALLLGCDGGPCKALVSAVAGLDGGQVRCVRPEDCPLSGTVAICADTGEPNLPTQSCIRCEQTLCVKYACSQ
Ga0335082_1114060623300032782SoilVVNGAAFVLKCCTVRPRRVVQGAILAAVLLLGCDGGPCKATVSAVTGLDAGQVRCVRPEDCPLTGNLAICADTGEPNLPTQSCVRCDQTLCVKYACSQ
Ga0335079_1001048523300032783SoilVENGARFVLKCCAVRLRGVVRVSILAGVLLLGCDGGPCKATVSAVLGLDGGQVRCISPEDCPLSGNVAICADTGEPNLPTQSCVRCEQTQCVKYSCAR
Ga0310914_1149814613300033289SoilDLEQRAPFVLKCRAVRLRGVVQRAILAGFLLLGCDGGPCKATKSAVTGLDGGQVLCVRPEDCPLTGNLAICADTSEPNLPTQSCVRCEQTLCEKYACSQ
Ga0326726_1207565013300033433Peat SoilVLKWCAVRLRGVVRAAILAGALLLGCDGGPCKATVSAVSGLDGGQVRCVQPEDCPLSGNVAICADTGEPNLPTQACVRCEQTECVKYACSQ
Ga0316620_1003440633300033480SoilMLAGACLLGCDGGPCKATASAILGLDGGQVICARPEDCPLTGSVAICADTGEPNLPTQSCVRCEQTLCVKYACSQ
Ga0316620_1123120423300033480SoilMLAGACLLGCDGGPCKATASAILGLDGGQVICVRPEDCPLTGSVAICADTGEPNLPTQSCVRCEQTLCVKYACSQ
Ga0316624_1184660313300033486SoilRGVVQGAMLAGACLLGCDGGPCKATASAILGLDGGQVICVRPEDCPLTGSVAICADTGEPNLPTQSCVRCEQTLCVKYACSQ
Ga0247829_1102602023300033550SoilAVPASILAAVLLLSCDGGPCKATVSAVTGLDAGQVRCVRPEDCPLTGNLAVCADTSEPNLPAQSCVRCEQTLCVKYACSQ
Ga0326723_0111139_832_11883300034090Peat SoilGHRRTPGAAQRRGLSPLASGLENGAPFVLKWCAVRLRGVVRAAILAGALLLGCDGGPCKATVSAVSGLDGGQVRCVQPEDCPLSGNVAICADTGEPNLPTQACVRCEQTECVKYACSQ
Ga0326723_0214326_581_8203300034090Peat SoilMLGALLLVAVTSGCEGGPCKASKTPIGGLDGGQVRCVRPEDCPLSNNAAICADTGEPSLPTQQCVRCEETECWLYACSG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.