NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080121

Metagenome / Metatranscriptome Family F080121

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080121
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 164 residues
Representative Sequence MKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Number of Associated Samples 101
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 70.43 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.696 % of family members)
Environment Ontology (ENVO) Unclassified
(63.478 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(78.261 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.80%    β-sheet: 13.22%    Coil/Unstructured: 45.98%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000930|BpDRAFT_10596613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300000947|BBAY92_10103795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300001348|JGI20154J14316_10100370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300001355|JGI20158J14315_10108046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani936Open in IMG/M
3300004097|Ga0055584_101929843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300005838|Ga0008649_10166531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani872Open in IMG/M
3300005838|Ga0008649_10244183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300006357|Ga0075502_1603495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300006382|Ga0075494_1379135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300006392|Ga0075507_1017284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300006394|Ga0075492_1349358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300006401|Ga0075506_1010828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300006419|Ga0075496_1419702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300006424|Ga0075497_1510267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300007558|Ga0102822_1093070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300007715|Ga0102827_1049845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani940Open in IMG/M
3300007955|Ga0105740_1025808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani842Open in IMG/M
3300008993|Ga0104258_1110240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300009003|Ga0102813_1145167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300009054|Ga0102826_1070588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
3300009142|Ga0102885_1063039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani885Open in IMG/M
3300009432|Ga0115005_10711890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani807Open in IMG/M
3300009432|Ga0115005_10729492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani796Open in IMG/M
3300009434|Ga0115562_1137267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300009441|Ga0115007_10356103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani954Open in IMG/M
3300009441|Ga0115007_10806082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300009442|Ga0115563_1285095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300009496|Ga0115570_10479338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300009496|Ga0115570_10480809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300009543|Ga0115099_10786968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300009599|Ga0115103_1510595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300009599|Ga0115103_1700870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300009606|Ga0115102_10285183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300009606|Ga0115102_10590381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300009606|Ga0115102_10763437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300009608|Ga0115100_10451402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300009677|Ga0115104_10590425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300012412|Ga0138266_1464125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300012414|Ga0138264_1139680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani705Open in IMG/M
3300012470|Ga0129329_1076152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300012525|Ga0129353_1669116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300012969|Ga0129332_1113928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300016703|Ga0182088_1066642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300016723|Ga0182085_1151982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300016734|Ga0182092_1149002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300016766|Ga0182091_1052066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300018622|Ga0188862_1017027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300018836|Ga0192870_1059024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300018846|Ga0193253_1100912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300018980|Ga0192961_10123592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani788Open in IMG/M
3300018980|Ga0192961_10127797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300019045|Ga0193336_10313985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300019045|Ga0193336_10315422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani694Open in IMG/M
3300019084|Ga0193051_108018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300019084|Ga0193051_108813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300019149|Ga0188870_10094860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300020165|Ga0206125_10153006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani926Open in IMG/M
3300020182|Ga0206129_10185853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani936Open in IMG/M
3300021169|Ga0206687_1325003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300021345|Ga0206688_10299167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300021359|Ga0206689_11122641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300021887|Ga0063105_1014929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300021887|Ga0063105_1023211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300021889|Ga0063089_1014559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300021894|Ga0063099_1021204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300021899|Ga0063144_1007637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300021906|Ga0063087_1027736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300021910|Ga0063100_1060754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300021921|Ga0063870_1023643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300021922|Ga0063869_1007209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300021925|Ga0063096_1000314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300021939|Ga0063095_1006919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300021941|Ga0063102_1000631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300021950|Ga0063101_1001085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300021950|Ga0063101_1002127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300022367|Ga0210312_113150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300022369|Ga0210310_1019679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300023674|Ga0228697_129298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
(restricted) 3300024261|Ga0233439_10214539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani872Open in IMG/M
3300024346|Ga0244775_10884584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300024346|Ga0244775_10963328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300025570|Ga0208660_1071081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani815Open in IMG/M
3300025620|Ga0209405_1087847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300025637|Ga0209197_1090315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300025654|Ga0209196_1178840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300025666|Ga0209601_1216619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300025849|Ga0209603_1171884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani857Open in IMG/M
3300026503|Ga0247605_1151460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300027810|Ga0209302_10275193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300027833|Ga0209092_10259431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani954Open in IMG/M
3300027849|Ga0209712_10296033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani916Open in IMG/M
3300028282|Ga0256413_1224007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300030715|Ga0308127_1036082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300030720|Ga0308139_1042649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300030722|Ga0308137_1060907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300031062|Ga0073989_12928189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300031523|Ga0307492_10159464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani790Open in IMG/M
3300031542|Ga0308149_1031212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300031557|Ga0308148_1023769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300031570|Ga0308144_1028899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300031594|Ga0302131_1109391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani960Open in IMG/M
3300031621|Ga0302114_10174329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani924Open in IMG/M
3300031738|Ga0307384_10344856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300031739|Ga0307383_10606934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300031739|Ga0307383_10634929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300032481|Ga0314668_10438890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300032491|Ga0314675_10410348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300032517|Ga0314688_10449556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300032521|Ga0314680_10628703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300032651|Ga0314685_10521187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300032709|Ga0314672_1213223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300032714|Ga0314686_10442933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani643Open in IMG/M
3300032750|Ga0314708_10394684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani676Open in IMG/M
3300032752|Ga0314700_10673873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300032755|Ga0314709_10539838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.70%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.91%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.57%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater8.70%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.83%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.09%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.61%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.61%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.74%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.74%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.74%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.74%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.74%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.87%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.87%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.87%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.87%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.87%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300001348Pelagic Microbial community sample from North Sea - COGITO 998_met_04EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021906Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025637Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes)EnvironmentalOpen in IMG/M
3300025654Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes)EnvironmentalOpen in IMG/M
3300025666Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BpDRAFT_1059661313300000930Freshwater And MarineIIKRINMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVXXXXLYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ*
BBAY92_1010379513300000947Macroalgal SurfaceMKFFSLIAVVASASAVQLNNADNTNPGPIINGAITGTCTPALDVSQEQLDIQLDYFSRSFDMVHYNNAMNIYNALLKKGGSKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQAALNEKYHNGEFQDPQKFDPVAKHPVTWSNVVL*
JGI20154J14316_1010037023300001348Pelagic MarineMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*MNN*KYSRQTIFN*
JGI20158J14315_1010804623300001355Pelagic MarineMKFYSIIAVVASASAVQLNNADNTNPGPIINGAITGTCTPALDVSQEQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGSKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQAALNEKYHNGEFQDPQKFDPVAKHPVTWSNVVL*EIN*KYSRQTIFN*
Ga0055584_10192984323300004097Pelagic MarineVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ*
Ga0008649_1016653123300005838MarineMKLYSLLAVIGAASAVKLTTPGAVVNGQITGTCTQALDVSQSQLDVQLDYFSRSFDMVHYNNALEIYNGLLKKGGVKPRVSVHTWELYDGAFTFPRVRRYDLVQKQMDLIQHFEDNINSNFTNGQNVANFI*
Ga0008649_1024418313300005838MarineMKFSILALIATASAVKLSDPGPVVNGHETGTCIAALDISQKELDVQLDYFSRSFSKIHYDNAMAIYGELLKGGQKPRLSAHTWELYDGAFTFPRVRRYDLVQKEMDKLQHFEDNLNSNFTNMQNVENFITVAKAAQTALNAKYHNGEFQDPVLFDPVADHPVTWSNVVL*
Ga0075502_160349513300006357AqueousKFSILALVATVASVKITAPGRVVNGVETGDCTPPLDISQKELDIQLDYFSRSFAKVHYNNAMAIYNELLKLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPAKFDPVADHPVTWSNV
Ga0075494_137913513300006382AqueousSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*MNN*KYSRQTIFN*
Ga0075507_101728413300006392AqueousNMKFSILALVATVASVKITAPGRVVNGVETGDCTPPLDISQKELDIQLDYFSRSFAKVHYNNAMAIYNELLKLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPAKFDPVADHPVTWSNVVL*
Ga0075492_134935813300006394AqueousAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0075506_101082813300006401AqueousFSILALVATVASVKITAPGRVVNGVETGDCTPPLDISQKELDIQLDYFSRSFAKVHYNNAMAIYNELLKLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPAKFDPVADHPVTWSNVVL*
Ga0075496_141970223300006419AqueousMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0075497_151026723300006424AqueousMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0102822_109307013300007558EstuarineMKFSILALVASVASVKITGPGRVVNGHETGDCTPPLDISQKELDVQLDYFSRSFAKVHYDNAVAIYGELLNLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPANFDPVADHPVTWSNVVL*
Ga0102827_104984513300007715EstuarineMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ*
Ga0105740_102580823300007955Estuary WaterMKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFSRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0104258_111024013300008993Ocean WaterSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVRKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIALNEKYHNGEFQDPQKFYPVADHPVTWSNVV
Ga0102813_114516723300009003EstuarineYFIIKRINMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ*
Ga0102826_107058813300009054EstuarineFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNAQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0102885_106303913300009142EstuarineMKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQSLNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0115005_1071189023300009432MarineIIAAVATVSAVQLNNADNTNPGPIINGGITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQSAMNEKYHNGEF*
Ga0115005_1072949213300009432MarineMKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMHIYNALLAKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0115562_113726723300009434Pelagic MarineMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0115007_1035610313300009441MarineMKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0115007_1080608213300009441MarineMKFYSIIAAVATVSAVQLGNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNVYNALLAKGGEKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQSAMNEKYHNGEF*
Ga0115563_128509513300009442Pelagic MarineNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0115570_1047933813300009496Pelagic MarineMKFCLIAAVASVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVA
Ga0115570_1048080913300009496Pelagic MarineMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVA
Ga0115099_1078696813300009543MarineSILALVASVASVKITGPGRVVNGHETGDCTPPLDISQKELDVQLDYFSRSFAKVHYDNAVAIYGELLNLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPANFDPVADHPVTWSNVVL*
Ga0115103_151059513300009599MarineIIKRINMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ*
Ga0115103_170087013300009599MarineMPGMSLSGDVQADPLAKVVTEAPAAGAQALAATDPARIVNGAPVAATECIAPLDVSQKELDIQLDYFSRSFSMTHYENAMNIYKGLLEKGEQPRVSIHTWELYDGAFTFPRVRRFDLVQKQMDLIQHFEDDLNSNFTNQQHVANFIQIAKAAQTMLNEKYHDGEFQDPAKFDPVADHPVTWSNVRLSD*
Ga0115102_1028518323300009606MarineKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0115102_1059038113300009606MarineNMKFALIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0115102_1076343713300009606MarineMPGMSLSGDVQADPLAKVVTEAPAAGAQALAAADPARIVNGAPVAANECIAPLDVSQKELDIQLDYFSRSFSMTHYENAMNIYKGLLEKGEQPRVSIHTWELYDGAFTFPRVRRFDLVQKQMDLIQHFEDDLNSNFTNQQHVANFIQIAKAAQTMLNEKYHDGEFQDPAKFDPVADHPVTWSNVRLSD*
Ga0115100_1045140213300009608MarineMKFALIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0115104_1059042513300009677MarineKINMKFYSIIAAVATVSAVQLQGADMTNPGPIINGAITGSCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0138266_146412513300012412Polar MarineIYFIIKTINMKFSIIAMVASASAVQLSGADNTNPGPIVNGAITGTCTPALDVSQEQLDVQLDYFSRSFDMVHYGNAMNIYNALLKKGGSKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQEALN*
Ga0138264_113968023300012414Polar MarineYFIIKTINMKFSIIAMVASASAVQLSGADNTNPGPIVNGAITGTCTPALDVSQEQLDVQLDYFSRSFDMVHYGNAMNIYTALLKKGGSKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQEALN*
Ga0129329_107615213300012470AqueousKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0129353_166911613300012525AqueousMKFSILALVATVASVKITAPGRVVNGVETGDCTPPLDISQKELDIQLDYFSRSFAKVHYNNAMAIYNELLKLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPAKFDPVADHPVTWSNVV
Ga0129332_111392813300012969AqueousKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL*
Ga0182088_106664213300016703Salt MarshKFSILALVATVASVKITAPGRVVNGVETGDCTPPLDISQKELDIQLDYFSRSFAKVHYNNAMAIYNELLKLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKEAQTALNTKYHNGEFQDPAKFDPVADHPVTWSNVVL
Ga0182085_115198213300016723Salt MarshKFSILALVATVASVKITAPGRVVNGVETGDCTPPLDISQKELDIQLDYFSRSFAKVHYNNAMAIYNELLKLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNINSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPAKFDPVADHPVTWSNVVL
Ga0182092_114900213300016734Salt MarshKFSILALVATVASVKITAPGRVVNGVETGDCTPPLDISQKELDIQLDYFSRSFAKVHYNNAMAIYNELLKLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKEAQTALNTKYHNGEFQDPAKFDPVADHPVTWRGFPEGGSRGGCRDGNRIRRETEQCKPSAVGSEGIGCMSA
Ga0182091_105206613300016766Salt MarshNMKFSILALVATVASVKITAPGRVVNGVETGDCTPPLDISQKELDIQLDYFSRSFAKVHYNNAMAIYNELLKLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPAKFDPVADHPVTWSNVVL
Ga0188862_101702713300018622Freshwater LakeKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0192870_105902413300018836MarineTVSAVQLHNSDNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLEKGGSKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQTALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0193253_110091213300018846MarineKFYSIIAVVASVSALQLQNADNSNPGPVINGAITGTCTPALDVSQKQLDVQLDYFSRSFDMVHYNNALNIYNELLKKGDKPRVSVHTWELYDGSFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNG
Ga0192961_1012359213300018980MarineMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0192961_1012779713300018980MarineMKFFSLIAVVASASAVQLDNIDNSNPGPIINGAITGTCIPALDVSQAQLDVQLDYFSRSFDMTHYNNAMEIYNALLKKGGSKPRVSIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQTALNEKYHNGEFQDPQKFDPVADHPVTWSNVVLXEINXKYSRQTIFN
Ga0193336_1031398513300019045MarineMKFYNLLAAIATTSAVRVQAPGDVLNNTILGTCPPGLEYSQKELDIQLDKFSRSFDIKNYDNSIEIYNELLKGGQKPRVSIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVQNFITVAKAAQAALNAKYHNGEF
Ga0193336_1031542223300019045MarineMKFYNLLTAIATTSAVRVQAPGDVLNNTILGTCPPGLEYSQKELDIQLDKFSRSFDIKNYDNSIEIYNELLKGGQKPRVSIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVQNFITVAKAAQAALNAKYHNGEF
Ga0193051_10801813300019084MarineFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0193051_10881313300019084MarineQRATPAAAAGADNSNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNAMVAKGGLKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNAQNVANFIQIAKAAQEALNTKYHNGEFQDPQKFDPVAAHPVTWSNVVL
Ga0188870_1009486013300019149Freshwater LakeKIINMKFYSIIAVVASASAVQLNNADNTNPGPIINGAITGTCTPALDVSQEQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGSKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQAALNEKYHNGEFQDPQKFDPVAKHPVTWSNVVL
Ga0206125_1015300613300020165SeawaterMKFYSIIAAVATVSALQLNNADNTNPGPIINGGITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQSAMNEKYHNGEF
Ga0206129_1018585323300020182SeawaterMKFYSIIAVVASASAVQLNNADNTNPGPIINGAITGTCTPALDVSQEQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGSKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQAALNEKYHNGEFQDPQKFDPVAKHPVTWSNVVL
Ga0206687_132500323300021169SeawaterKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0206688_1029916713300021345SeawaterKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFPNGQNVANFIQVAKAAQ
Ga0206689_1112264123300021359SeawaterNMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0063105_101492913300021887MarineAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMHIYNALLAKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQISHEREISQRRIPRSTKIRPSS
Ga0063105_102321113300021887MarineKFYSIIAAVATVSAVQLGNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNVYNALLAKGGEKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQSAMNEKYHNGEF
Ga0063089_101455913300021889MarineKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0063099_102120413300021894MarineFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0063144_100763713300021899MarineINMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0063087_102773613300021906MarineYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0063100_106075413300021910MarineKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMHIYNALLAKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVLXEINXKYSRQTIFNSSINGEKNILS
Ga0063870_102364313300021921MarineTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0063869_100720913300021922MarineKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0063096_100031413300021925MarineKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMXIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0063095_100691913300021939MarineINMKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0063102_100063113300021941MarineKFYSIIAAVATVSAVQLNNADNTNPGPIINGGITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQSAMNEKYHNGEF
Ga0063101_100108513300021950MarineKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMHIYNALLAKGGNKPRVAVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNAQNVANFIQVAKAAQ
Ga0063101_100212713300021950MarineINMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQSAMNEKYHNGEF
Ga0210312_11315013300022367EstuarineATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0210310_101967923300022369EstuarineKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0228697_12929813300023674SeawaterKFSILALVASVASVKITGPGRVVNGHETGDCTPPLDISQKELDVQLDYFSRSFAKVHYDNAVAIYGELLNLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPANFDPVADHPVTWSNVVL
(restricted) Ga0233439_1021453913300024261SeawaterMKLYSLLAVIGAASAVKLTTPGVVVNGQITGTCTQALDVSQSQLDVQLDYFSRSFDMVHYNNALEIYNGLLKKGGVKPRVSVHTWELYDGAFTFPRVRRYDLVQKQMDLIQHFEDNINSNFTNGQNVANFI
Ga0244775_1088458413300024346EstuarineMKFSILALVASVASVKITGPGRVVNGHETGDCTPPLDISQKELDVQLDYFSRSFAKVHYDNAVAIYGELLNLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPANFDPVADHPVTWSNVVL
Ga0244775_1096332813300024346EstuarineMKFYSLFAVLASASAINLRDADCTPALDVSQKELDKQLDYFSRTFDMVHYNNAMEVYNGLLKKGGDKPRVTVHTWELYDNAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNSQNVANFIQVAKDAQNDLNHKYHNGEF
Ga0208660_107108113300025570AqueousMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0209405_108784723300025620Pelagic MarineMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0209197_109031523300025637Pelagic MarineMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0209196_117884013300025654Pelagic MarineSVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0209601_121661913300025666Pelagic MarineMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNV
Ga0209603_117188423300025849Pelagic MarineMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVLXMNNXKYSRQTIFN
Ga0247605_115146013300026503SeawaterSILALVASVASVKITGPGRVVNGHETGDCTPPLDISQKELDVQLDYFSRSFAKVHYDNAVAIYGELLNLGQKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNQQNVENFITVAKDAQTALNTKYHNGEFQDPAKFDPVADHPVTWSNVVL
Ga0209302_1027519323300027810MarineMKFLLIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNALNIYNALVAKGGSKPRVAVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVA
Ga0209092_1025943113300027833MarineMKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0209712_1029603313300027849MarineMKFYSIIAAVATVSAVQLNNADNTNPGPIINGGITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVIQVAKAAQSAMNEKYHNGEF
Ga0256413_122400713300028282SeawaterKFYSIIAAVATVSAVQLQGADMTNPGPIINGAITGSCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVLXAINXKYSRQTIFN
Ga0308127_103608223300030715MarineSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0308139_104264913300030720MarineFYSIIAAVATVSAVQLGNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNVYNALLAKGGEKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVLXEINXKYSRQTIFNSSINGEKNILS
Ga0308137_106090713300030722MarineMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0073989_1292818923300031062MarineVILSRAQCFRNGVTNTLGSCALSTAPAAALDNTAPSVATVSAVQLQGADMTNPGPIINGQITGSCTPALDVSQKQLDIQLDYFSRSFDMVHYNNAMNIYNALLKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0307492_1015946413300031523Sea-Ice BrineTASAVQLGNADNTNPGPIVNGAITGSCTPALDVSQGQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGGEKPRVSVHTWELYDGSFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNTKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0308149_103121223300031542MarineKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0308148_102376913300031557MarineRINMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0308144_102889913300031570MarineYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMHIYNALLAKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVLXEINXKYSRQTIFNSSINGEKNILS
Ga0302131_110939113300031594MarineMKFYSIIAAVATVSAVQLHNADNTNPGPIINGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMHIYNALLAKGGNKPRVAIHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQIAMNEKYHNGEFQDPQKFDPVADHPVTWSNVVLXEINXKYSRQTIFNSSINGEKNILS
Ga0302114_1017432923300031621MarineMKFALIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0307384_1034485613300031738MarineRINMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0307383_1060693413300031739MarineNMKFYSIIAAVATVSAVQLNNADNTNPGPIINGAITGTCTPALDVSQSQLDVQLDYFSRSFDMVHYNNAMNVYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNYTNGQNVANFIQVAKAAQ
Ga0307383_1063492913300031739MarineINMKFYSIIAAVATVSAVQLQNADNTNPGPIVNGAITGSCTPALDVSQAQLDVQLDYFSRSFDMVHYNNAMNIYNALLKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQ
Ga0314668_1043889013300032481SeawaterKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0314675_1041034813300032491SeawaterKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPFTWSNVVL
Ga0314688_1044955613300032517SeawaterYNMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0314680_1062870313300032521SeawaterYNMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0314685_1052118713300032651SeawaterSVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0314672_121322313300032709SeawaterMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGEKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVLXMNNXKYSRQTIFN
Ga0314686_1044293313300032714SeawaterDNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0314708_1039468413300032750SeawaterNMKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLIQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL
Ga0314700_1067387313300032752SeawaterAESHADPLAKVVTEEAAAGAQALAATEPARIVNGAPVAANECIAPLDVSQKELDIQLDYFSRSFSMTHYENAMNIYKGLLEKGEQPRVSIHTWELYDGAFTFPRVRRFDLVQKQMDLIQHFEDDLNSNFTNQQHVANFIQTAKAAQAMLNEKYHDGEFQDPAKFDPVADHPVTWSNVKLS
Ga0314709_1053983813300032755SeawaterKFCLIAAVASVSAVQLHNADNTNPGPIVNGAITGTCTPALDVSQAQLDVQLDYFSRSFDMVHYGNAMNIYNALIKKGDKPRVSVHTWELYDGAFTFPRVRRYDLVQKHMDLVQHFEDNLNSNFTNGQNVANFIQVAKAAQQALNEKYHNGEFQDPQKFDPVADHPVTWSNVVL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.