NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080103

Metagenome Family F080103

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080103
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 41 residues
Representative Sequence MKITALDTYFLSAPLPQPVRTSTSTISRVSELIVRLTTDA
Number of Associated Samples 95
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.87 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 86.96 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.826 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(20.870 % of family members)
Environment Ontology (ENVO) Unclassified
(29.565 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.783 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 47.06%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00496SBP_bac_5 14.78
PF13458Peripla_BP_6 6.09
PF02538Hydantoinase_B 5.22
PF02515CoA_transf_3 5.22
PF03446NAD_binding_2 4.35
PF01027Bax1-I 4.35
PF01266DAO 4.35
PF12867DinB_2 3.48
PF04392ABC_sub_bind 2.61
PF00588SpoU_methylase 2.61
PF11794HpaB_N 2.61
PF14595Thioredoxin_9 1.74
PF05685Uma2 1.74
PF04909Amidohydro_2 1.74
PF00296Bac_luciferase 1.74
PF00144Beta-lactamase 1.74
PF04072LCM 1.74
PF00561Abhydrolase_1 0.87
PF13495Phage_int_SAM_4 0.87
PF15902Sortilin-Vps10 0.87
PF13365Trypsin_2 0.87
PF01425Amidase 0.87
PF07366SnoaL 0.87
PF13378MR_MLE_C 0.87
PF02012BNR 0.87
PF03841SelA 0.87
PF02746MR_MLE_N 0.87
PF00753Lactamase_B 0.87
PF10066DUF2304 0.87
PF01408GFO_IDH_MocA 0.87
PF01850PIN 0.87
PF02668TauD 0.87
PF13602ADH_zinc_N_2 0.87
PF00440TetR_N 0.87
PF03795YCII 0.87
PF14833NAD_binding_11 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 10.43
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 5.22
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 2.61
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 2.61
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 2.61
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.61
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.74
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.74
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.74
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.74
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 1.74
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.74
COG2367Beta-lactamase class ADefense mechanisms [V] 1.74
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.87
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.87
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.87
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.83 %
UnclassifiedrootN/A12.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725002|GPICC_F5MS3JC01EDP4PAll Organisms → cellular organisms → Bacteria504Open in IMG/M
3300000559|F14TC_102178292All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria612Open in IMG/M
3300004156|Ga0062589_101643514All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005167|Ga0066672_10488059All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300005175|Ga0066673_10585188Not Available651Open in IMG/M
3300005332|Ga0066388_101626668Not Available1138Open in IMG/M
3300005444|Ga0070694_100711093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes818Open in IMG/M
3300005450|Ga0066682_10020143All Organisms → cellular organisms → Bacteria → Proteobacteria3760Open in IMG/M
3300005467|Ga0070706_100623997All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300005552|Ga0066701_10607839All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300005618|Ga0068864_100178220All Organisms → cellular organisms → Bacteria1941Open in IMG/M
3300005713|Ga0066905_101007554All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium735Open in IMG/M
3300005713|Ga0066905_101627001All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005764|Ga0066903_103432695All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium855Open in IMG/M
3300005764|Ga0066903_106304506Not Available619Open in IMG/M
3300005764|Ga0066903_107061925All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300006358|Ga0068871_101890937All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006794|Ga0066658_10409278All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300006797|Ga0066659_10515968All Organisms → cellular organisms → Bacteria → Proteobacteria960Open in IMG/M
3300006797|Ga0066659_11036662All Organisms → cellular organisms → Bacteria → Proteobacteria685Open in IMG/M
3300006844|Ga0075428_101424285All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300006845|Ga0075421_101502668All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300006865|Ga0073934_10287095All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300006880|Ga0075429_101612891All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006903|Ga0075426_10037733All Organisms → cellular organisms → Bacteria3455Open in IMG/M
3300006904|Ga0075424_100589908All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300006904|Ga0075424_101942630All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300007255|Ga0099791_10420635All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300007265|Ga0099794_10362683All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300009090|Ga0099827_10403872Not Available1168Open in IMG/M
3300009092|Ga0105250_10576650All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300009100|Ga0075418_10850574All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria985Open in IMG/M
3300009148|Ga0105243_10820326All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria918Open in IMG/M
3300009162|Ga0075423_11987991All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300009806|Ga0105081_1039108All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria657Open in IMG/M
3300010043|Ga0126380_10011601All Organisms → cellular organisms → Bacteria3978Open in IMG/M
3300010043|Ga0126380_10997401Not Available705Open in IMG/M
3300010043|Ga0126380_11365295Not Available620Open in IMG/M
3300010046|Ga0126384_11388172All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium654Open in IMG/M
3300010047|Ga0126382_10286229All Organisms → cellular organisms → Bacteria → Proteobacteria1229Open in IMG/M
3300010047|Ga0126382_10356594All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1123Open in IMG/M
3300010047|Ga0126382_12319893Not Available519Open in IMG/M
3300010303|Ga0134082_10018040All Organisms → cellular organisms → Bacteria → Proteobacteria2582Open in IMG/M
3300010359|Ga0126376_10831991All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium905Open in IMG/M
3300010360|Ga0126372_10055585All Organisms → cellular organisms → Bacteria → Proteobacteria2714Open in IMG/M
3300010360|Ga0126372_11722476All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300010361|Ga0126378_13314166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4512Open in IMG/M
3300010362|Ga0126377_11121454All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300010362|Ga0126377_11750288All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria697Open in IMG/M
3300010362|Ga0126377_12069087All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300010366|Ga0126379_11166892All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300010375|Ga0105239_12106772All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium655Open in IMG/M
3300010376|Ga0126381_100555503Not Available1627Open in IMG/M
3300010376|Ga0126381_102243419All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300010376|Ga0126381_103063871All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300010391|Ga0136847_11583825All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1447Open in IMG/M
3300010398|Ga0126383_10578556Not Available1192Open in IMG/M
3300010398|Ga0126383_13513227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4512Open in IMG/M
3300010401|Ga0134121_10818931Not Available896Open in IMG/M
3300011271|Ga0137393_10253254All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300012209|Ga0137379_11583694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4554Open in IMG/M
3300012285|Ga0137370_10394870All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria837Open in IMG/M
3300012360|Ga0137375_10334505All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1352Open in IMG/M
3300012360|Ga0137375_11282690All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300012362|Ga0137361_11373041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4630Open in IMG/M
3300012923|Ga0137359_11607335All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300012948|Ga0126375_10162941All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300012948|Ga0126375_10232309All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300012948|Ga0126375_11601629All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium561Open in IMG/M
3300012971|Ga0126369_12407445All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria612Open in IMG/M
3300012975|Ga0134110_10199915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4838Open in IMG/M
3300015373|Ga0132257_102135086All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium724Open in IMG/M
3300017656|Ga0134112_10002439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5671Open in IMG/M
3300017659|Ga0134083_10098496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1150Open in IMG/M
3300018068|Ga0184636_1308099All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300018077|Ga0184633_10189285Not Available1064Open in IMG/M
3300018482|Ga0066669_11687333All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium581Open in IMG/M
3300020074|Ga0194113_10804718All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300021078|Ga0210381_10398804Not Available508Open in IMG/M
3300025961|Ga0207712_11247035All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium664Open in IMG/M
3300026035|Ga0207703_10120840All Organisms → cellular organisms → Bacteria2249Open in IMG/M
3300026116|Ga0207674_10219011All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300026118|Ga0207675_102530277All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria524Open in IMG/M
3300026297|Ga0209237_1067854All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300026298|Ga0209236_1022372All Organisms → cellular organisms → Bacteria3508Open in IMG/M
3300026306|Ga0209468_1023170All Organisms → cellular organisms → Bacteria → Proteobacteria2205Open in IMG/M
3300026309|Ga0209055_1003086All Organisms → cellular organisms → Bacteria10250Open in IMG/M
3300026310|Ga0209239_1123095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171073Open in IMG/M
3300026323|Ga0209472_1089280All Organisms → cellular organisms → Bacteria → Proteobacteria1242Open in IMG/M
3300026326|Ga0209801_1043929All Organisms → cellular organisms → Bacteria2057Open in IMG/M
3300026327|Ga0209266_1052821All Organisms → cellular organisms → Bacteria → Proteobacteria1989Open in IMG/M
3300026329|Ga0209375_1000152All Organisms → cellular organisms → Bacteria → Proteobacteria63031Open in IMG/M
3300026499|Ga0257181_1046778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4713Open in IMG/M
3300026524|Ga0209690_1290666All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300026529|Ga0209806_1088559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_41350Open in IMG/M
3300026532|Ga0209160_1016077All Organisms → cellular organisms → Bacteria5207Open in IMG/M
3300026538|Ga0209056_10089361All Organisms → cellular organisms → Bacteria2559Open in IMG/M
3300026540|Ga0209376_1154799All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300027846|Ga0209180_10730583All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria536Open in IMG/M
3300028047|Ga0209526_10795791All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300028380|Ga0268265_10172108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1852Open in IMG/M
3300028812|Ga0247825_10514654All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300031846|Ga0318512_10386749Not Available702Open in IMG/M
3300031943|Ga0310885_10335265All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300032059|Ga0318533_10486202Not Available904Open in IMG/M
3300032122|Ga0310895_10298153All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium761Open in IMG/M
3300032180|Ga0307471_101002509All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1002Open in IMG/M
3300032205|Ga0307472_102512926All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria524Open in IMG/M
3300033550|Ga0247829_10610693All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300033550|Ga0247829_10707791All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium838Open in IMG/M
3300033550|Ga0247829_10934658All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300033551|Ga0247830_10088028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium2154Open in IMG/M
3300033805|Ga0314864_0203400All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria519Open in IMG/M
3300033814|Ga0364930_0247756All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium603Open in IMG/M
3300034820|Ga0373959_0070631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium789Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil20.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.87%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.87%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.87%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.87%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.87%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725002Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009806Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICC_010375402067725002SoilVKITGLETYFLSAPLPQPVRTSTHVISAVSEVVVRLTT
F14TC_10217829223300000559SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVKLTTDAGLVGIGEAH
Ga0062589_10164351413300004156SoilMKITSLETYSLSAPLPQVVRTSTHAISQVSEVIVKLTTDAGHVGIGE
Ga0066672_1048805923300005167SoilMKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLV
Ga0066673_1058518823300005175SoilMKITGLETFSLSAPLPQVVRTSTHAISQVSEVIVKLTTDAGHVGIGEA
Ga0066388_10162666813300005332Tropical Forest SoilMKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLTTDA
Ga0070694_10071109323300005444Corn, Switchgrass And Miscanthus RhizosphereMKITALETYFLAAPLAQPVRVSNSTIAQVSEVIVKLTTDS
Ga0066682_1002014313300005450SoilMKIKALDTYFLSATLPQPVRTSTSTISRVSELVVKLTTDA
Ga0070706_10062399713300005467Corn, Switchgrass And Miscanthus RhizosphereVPDMKISALETYFLAAPLAQPVRVSNSTIAQVSEVIVKLTTD
Ga0066701_1060783913300005552SoilMKITTLETYLLSAPLPQPVRTSTTTISRVSEVIVKLT
Ga0068864_10017822013300005618Switchgrass RhizosphereMKITALETYFLAAPLAQPVRVSNSTIAQVSEVIVKLTTDSG
Ga0066905_10100755423300005713Tropical Forest SoilMKITALDTYFLSAPLPAPVRTSTSTISRVSELIVKLTTDA
Ga0066905_10162700113300005713Tropical Forest SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVRLT
Ga0066903_10343269523300005764Tropical Forest SoilMKITQLDTYFLSAPLPAPVRTSTSTISRVSELIVKLTT
Ga0066903_10630450623300005764Tropical Forest SoilMKITRLDTYFLSIPLPQPVRTSTSTISQVSEVIVKLTTD
Ga0066903_10706192513300005764Tropical Forest SoilMKITTLETYLLSAPLPQPVRTSTSTISRVSEVIVKLTTDA
Ga0068871_10189093723300006358Miscanthus RhizosphereMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVRLTTDSGLVGIG
Ga0066658_1040927813300006794SoilMKIKALDTYFLSASLPQPVRTSTSTISRVSELIVTLATDAG
Ga0066659_1051596813300006797SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTLATDAGLV
Ga0066659_1103666213300006797SoilMKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLVGI
Ga0075428_10142428513300006844Populus RhizosphereMKITTLETYLLSAPLPQAVRTSTHAITRVSEVVVKLTTDAGLVGIG
Ga0075421_10150266823300006845Populus RhizosphereMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTLTTD
Ga0073934_1028709533300006865Hot Spring SedimentVKITALETYALSAPLPQPVRTSTHRITQVSEVIVKLT
Ga0075429_10161289113300006880Populus RhizosphereMKITGLETYSLSAPLPQTVRTSTHAISQVSEVIVKLTTDAGHVGIGEAH
Ga0075426_1003773353300006903Populus RhizosphereMHARMKVTGLETYCLSAPLPQPVRTSTHTISSVSEIV
Ga0075424_10058990813300006904Populus RhizosphereMKITGLETYSLSAPLPQVVRTSTHAITQVSEVIVKLT
Ga0075424_10194263013300006904Populus RhizosphereMKIKALDTYFLSAPLPQPVRTSTSTIARVSELVVKLTTDAGLVGIG
Ga0099791_1042063523300007255Vadose Zone SoilMKIKALDTYFLSAPLPQPVRTSTSTISKVSELIVTLT
Ga0099794_1036268313300007265Vadose Zone SoilVKVTRLETCLLSAPLPQAVSTSTHRITTVSEVVVRLTTDSG
Ga0099827_1040387213300009090Vadose Zone SoilMHITRLDTYFLSIPLPQPVRTSTSTISQVSEVIVKL
Ga0105250_1057665013300009092Switchgrass RhizosphereMKITTLETYFLAAPLAQPVRVSNSTIAQVSEVIVK
Ga0075418_1085057413300009100Populus RhizosphereMKITTLETYLLSAPLPQAVRTSTHAITRVSEVVVKLT
Ga0105243_1082032613300009148Miscanthus RhizosphereIAGERGRVMKITALETYFLSAPLPQPVRTSNSTISRVSELIVTLTTDAGPVGIG*
Ga0075423_1198799113300009162Populus RhizosphereMKVTALETYFLSAPLPQPVRTSTAAISRVSEVIVKLTTDAGLV
Ga0105081_103910813300009806Groundwater SandMRYDADPMKVTTLETYLLSAPLPQAVRTSTNTITRVSEVIV
Ga0126380_1001160113300010043Tropical Forest SoilMKITTLETYMLSAPLPQPVRTSTSTISRVSELIVRLTTD
Ga0126380_1099740113300010043Tropical Forest SoilMQITTLDTYMLSVPLPQPVRTSTSTISRVSELIVRLTTDA
Ga0126380_1136529523300010043Tropical Forest SoilMKITRLDTYFLSIPLPQPVRTSTSTISQVSEVLVKLTTDAGLV
Ga0126384_1138817223300010046Tropical Forest SoilMKVTGLETYFLSAPLPQPVRTSTHVISAVSEVVVRLTTDAGHVGIG
Ga0126382_1028622913300010047Tropical Forest SoilMKITALDTYFLSAPLPQPVRTSTSTISRVSELIVRLTTDA
Ga0126382_1035659413300010047Tropical Forest SoilMKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLTT
Ga0126382_1231989313300010047Tropical Forest SoilMKITRLDTYFLSIPLPQPVRTSTSTISQVSEVIVKLTTDTG
Ga0134082_1001804033300010303Grasslands SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVQLTTDSGLIGIGE
Ga0126376_1083199123300010359Tropical Forest SoilMKITQLETYFLAIPLPQPVRTSTSTISQVSEVIVKLT
Ga0126372_1005558513300010360Tropical Forest SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVKLTTDS
Ga0126372_1172247613300010360Tropical Forest SoilMQITALETYMLSAPLPQPVRTSTSTISRVSELIVRLTTDAGLV
Ga0126378_1331416623300010361Tropical Forest SoilMKVTALETYFLSAPLPQAVRTSTHRIASVSEVIVRLSTDA
Ga0126377_1112145423300010362Tropical Forest SoilMKVEALDTYFLSAPLPQPVRTSTSTIARVSELIVKLTTDSGLVG
Ga0126377_1175028823300010362Tropical Forest SoilMKITTLETYLLSAPLPQVVRTSTHAITRVSEVVVKLTTDAGLVG
Ga0126377_1206908713300010362Tropical Forest SoilMKITTLETYMLSAPLPHPVRTSTSTISRVSELIVRL
Ga0126379_1116689223300010366Tropical Forest SoilMQITALETYILSAPLPQPVRTSTSTISRVSELIVRL
Ga0105239_1210677213300010375Corn RhizosphereMKITALETYFLAAPLAQPVRVSNSTIAQVTEVIVKLTTD
Ga0126381_10055550333300010376Tropical Forest SoilMKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLTTDAG
Ga0126381_10224341923300010376Tropical Forest SoilMKITTLETYMLSAPLPQPVRTSTSTISRVSELIVRL
Ga0126381_10306387123300010376Tropical Forest SoilMKVKALDTYFLSAPLPQPVRTSTSTIARVSELIVKLTTD
Ga0136847_1158382523300010391Freshwater SedimentMKIATLETYLLSAPLPQAVRTSTHTITRVSEVIVKLT
Ga0126383_1057855613300010398Tropical Forest SoilMKITQLDTYFLSIPLPQPVRTSTSTIGQVSEVIVKLTTDA
Ga0126383_1351322723300010398Tropical Forest SoilMKVTALETYFLSAPLPQAVRTSTHRIASVSEVIVRL
Ga0134121_1081893123300010401Terrestrial SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVRL
Ga0137393_1025325413300011271Vadose Zone SoilMRYDADPMKVTTLETYLLSAPLPQAVRTSTSTISR
Ga0137379_1158369423300012209Vadose Zone SoilMKVTALETYFLSAPLPQAVRTSTHRITSVSEVIVRLSTDAGLMGIGE
Ga0137370_1039487023300012285Vadose Zone SoilMKVTALDTYFLSAPLPQAVRTSTHTIASVSEVIVTLTTDSGLVG
Ga0137375_1033450523300012360Vadose Zone SoilVKVTTLETYLLSAPLPQAVRTSTHTITRVSEVIVKL
Ga0137375_1128269013300012360Vadose Zone SoilMKVTALETYFLSAPLPQAVRTSTHRITSVSEVVVKLTTDAGLV
Ga0137361_1137304113300012362Vadose Zone SoilMKVTSLETYFLSAPLPQAVRTSTHRITSVSEVIVRLSTDAGLMGIG
Ga0137359_1160733523300012923Vadose Zone SoilMKITKLETYALSAPLPQVVRTSTHAISQVSEVIVKLTTD
Ga0126375_1016294113300012948Tropical Forest SoilMKITTLDTYVLSVPLPQPVRTSTSTISRVSELIVRLTTDAGL
Ga0126375_1023230923300012948Tropical Forest SoilMHISALETYMLSVPLPQPVRTSTSTISRVSELIVRLT
Ga0126375_1160162923300012948Tropical Forest SoilMKVTGLETYFLSAPLPQPVRTSTHVISAVSEVVVRLTTDA
Ga0126369_1240744523300012971Tropical Forest SoilMKIAALETYFLSAPLPQAVRTSTSTIARVSELIVT
Ga0134110_1019991523300012975Grasslands SoilMKVTSLETYFLSAPLPQAVRTSTHRITSVSEVIVRLSTDAGLMGIGEAH
Ga0132257_10213508623300015373Arabidopsis RhizosphereMKITALETYFLAAPLAQPVRVSNSTIAQVSEVIVKLTTD
Ga0134112_1000243963300017656Grasslands SoilVKVTRLDTYFLSAPLPQPVSTSTHRITSVSEVVVKLTTDAGLVGI
Ga0134083_1009849613300017659Grasslands SoilVKVTRLDTYFLSAPLPQPVSTSTHRITSVSEVVVKLTTDA
Ga0184636_130809913300018068Groundwater SedimentVKGSDAMKITKLDTYFLSVSLPQPVRISTATISQVSEV
Ga0184633_1018928513300018077Groundwater SedimentMHITRLDTYFLSIPLPQPVRTSTSTISQVSEVIVKLSTDTG
Ga0066669_1168733323300018482Grasslands SoilMKITGLETYSLSAPLPQVVRTSTHAITQVRQVIVKLTTDADLGGIAEAPDAFLF
Ga0194113_1080471823300020074Freshwater LakeMKITGLETYSLSAPLPQPVRTSTIAISQVSEVIVKLATDEGHVGLGE
Ga0210381_1039880413300021078Groundwater SedimentMKVTALETYLLSAPLPQPVRTSTHTIARVSEVVVKLTTDAGH
Ga0207712_1124703523300025961Switchgrass RhizosphereMKITALETYFLSAPLPQPVRTSNSTISRVSELIVTLATDAGHVGIG
Ga0207703_1012084013300026035Switchgrass RhizosphereMKITALETYFLAAPLAQPVRVSNSTIAQVTEVIVKLTT
Ga0207674_1021901113300026116Corn RhizosphereMKITNLETYSLSAPLPQVVRTSTHAISQVSEVIVKLTTDAGHVGIGEGHVQARG
Ga0207675_10253027723300026118Switchgrass RhizosphereMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTLTTDSGLVGI
Ga0209237_106785433300026297Grasslands SoilMKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGL
Ga0209236_102237243300026298Grasslands SoilMKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLVGIG
Ga0209468_102317043300026306SoilMKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLVGIGE
Ga0209055_100308613300026309SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTLATDAG
Ga0209239_112309513300026310Grasslands SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVQLTTDSGLVGIG
Ga0209472_108928013300026323SoilMKIAALDTYFLSAPLPQAVRTSTSTISRVSELIVRL
Ga0209801_104392943300026326SoilMKIKALDTYFLSATLPQPVRTSTSTISRVSELVVKLTTDAG
Ga0209266_105282133300026327SoilMKIAALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLVGIGE
Ga0209375_100015213300026329SoilVKVTRLDTYFLSAPPPQPVSTSTHRITSVSEVVVKLTTDAGP
Ga0257181_104677823300026499SoilMKVTSLETYFLSAPLPQAVRTSTHRITSVSEVIVRLSTDAGH
Ga0209690_129066623300026524SoilVKVTRLDTYFLSAPLPQPVSTSTHRITSVSEVVVKLTTDAG
Ga0209806_108855913300026529SoilMKVTSLETYFLSAPLPQAVRTSTHRITSVSELIVR
Ga0209160_101607713300026532SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTL
Ga0209056_1008936113300026538SoilMKIKALDTYFLSATLPQPVRTSTSTISRVSELVVKLTTDASLVG
Ga0209376_115479913300026540SoilMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVKLTTD
Ga0209180_1073058313300027846Vadose Zone SoilMRYDADSMKVTTLETYLLSASLPQAVRTSTSTISRVSEVIVKLTTDAGLVGIG
Ga0209526_1079579123300028047Forest SoilMKVTTLETYFLSAPLPQAVRTSTHVISRVNEVVVKLTTDSGLVGI
Ga0268265_1017210833300028380Switchgrass RhizosphereMKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVKLT
Ga0247825_1051465423300028812SoilMKVTGLETYLLSAPLPQPVRTSTSTIARVSEVVVRLTTDTGLV
Ga0318512_1038674913300031846SoilMKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLT
Ga0310885_1033526523300031943SoilMKVTGLETYLLSAPLPQPVRTSTSTIARVSEVVVRLTT
Ga0318533_1048620213300032059SoilMKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLTTDAR
Ga0310895_1029815313300032122SoilMKVTALETYLLSAPLPQPVRTSTHTIARVSEVVVKLTTDAG
Ga0307471_10100250923300032180Hardwood Forest SoilMRIADLETYFLSAPLAQPVRVSNSTIAQVSEVIVKLTT
Ga0307472_10251292623300032205Hardwood Forest SoilMKVKALDTYFLSAPLPQPVRTSTSTIARVSELIVKLTTDSGLCG
Ga0247829_1061069323300033550SoilMKVTGLETYLLSAPLPQPVRTSTSTIARVSEVVVRLTTDTG
Ga0247829_1070779113300033550SoilMKITALETYFLSAPLPQPVRTSNSTIARVSELVVTLTTDAGHVGIGEA
Ga0247829_1093465823300033550SoilMKITALETYSLSAPLPQTVRTSIHAISQVSEVIVKLTTD
Ga0247830_1008802833300033551SoilMKITALETYFLSAPLPQPVRTSNSTIARVSELVVTLTTDAGHVGIGEAR
Ga0314864_0203400_2_1273300033805PeatlandMKITTLDTYMLSAPLPQPVRTSTSTISRVSELIVRLTTDAGH
Ga0364930_0247756_475_6033300033814SedimentVKITKLETYSLSAPLPQVVRTSTHAISQVSEVIVKLTTEAGHV
Ga0373959_0070631_682_7893300034820Rhizosphere SoilMKVTALETYLLSAPLPQPVRTSTHTIARVSEVVVKL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.