| Basic Information | |
|---|---|
| Family ID | F080084 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 49 residues |
| Representative Sequence | DEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIITQLTARITALEGA |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 94.78 % |
| % of genes from short scaffolds (< 2000 bps) | 85.22 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (60.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (22.609 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (39.130 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 2.61 |
| PF00959 | Phage_lysozyme | 1.74 |
| PF13392 | HNH_3 | 1.74 |
| PF08291 | Peptidase_M15_3 | 0.87 |
| PF07460 | NUMOD3 | 0.87 |
| PF00149 | Metallophos | 0.87 |
| PF04383 | KilA-N | 0.87 |
| PF01464 | SLT | 0.87 |
| PF11651 | P22_CoatProtein | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.74 % |
| Unclassified | root | N/A | 18.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001851|RCM31_10273829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300002091|JGI24028J26656_1000078 | All Organisms → cellular organisms → Bacteria | 45744 | Open in IMG/M |
| 3300002091|JGI24028J26656_1003910 | All Organisms → Viruses → Predicted Viral | 2428 | Open in IMG/M |
| 3300002092|JGI24218J26658_1000998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10154 | Open in IMG/M |
| 3300005346|Ga0074242_10798594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300005527|Ga0068876_10670073 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005528|Ga0068872_10261022 | Not Available | 969 | Open in IMG/M |
| 3300005582|Ga0049080_10304533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300006030|Ga0075470_10084366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300006037|Ga0075465_10167180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300006400|Ga0075503_1539271 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006752|Ga0098048_1210216 | All Organisms → Viruses | 573 | Open in IMG/M |
| 3300006802|Ga0070749_10097239 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
| 3300006802|Ga0070749_10739976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300006916|Ga0070750_10312778 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006917|Ga0075472_10608245 | Not Available | 548 | Open in IMG/M |
| 3300007276|Ga0070747_1281251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300007346|Ga0070753_1048000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1766 | Open in IMG/M |
| 3300007346|Ga0070753_1109885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300007534|Ga0102690_1159744 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300007540|Ga0099847_1219618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300007541|Ga0099848_1030148 | All Organisms → Viruses → Predicted Viral | 2264 | Open in IMG/M |
| 3300007542|Ga0099846_1077763 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
| 3300007960|Ga0099850_1240074 | Not Available | 701 | Open in IMG/M |
| 3300007992|Ga0105748_10427605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300008267|Ga0114364_1015586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6071 | Open in IMG/M |
| 3300008448|Ga0114876_1007336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6667 | Open in IMG/M |
| 3300008448|Ga0114876_1132936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300008448|Ga0114876_1156326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300009155|Ga0114968_10766483 | Not Available | 503 | Open in IMG/M |
| 3300009161|Ga0114966_10781232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300009169|Ga0105097_10568004 | Not Available | 637 | Open in IMG/M |
| 3300010299|Ga0129342_1215232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300010368|Ga0129324_10377337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300012757|Ga0157628_1040874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300012968|Ga0129337_1361719 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300014962|Ga0134315_1006135 | Not Available | 2002 | Open in IMG/M |
| 3300017742|Ga0181399_1085414 | Not Available | 791 | Open in IMG/M |
| 3300017747|Ga0181352_1106915 | Not Available | 764 | Open in IMG/M |
| 3300017747|Ga0181352_1112802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300017752|Ga0181400_1171846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300017754|Ga0181344_1051345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
| 3300017754|Ga0181344_1118516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300017766|Ga0181343_1001900 | Not Available | 8109 | Open in IMG/M |
| 3300017766|Ga0181343_1147191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300017771|Ga0181425_1072017 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300017785|Ga0181355_1276156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300017786|Ga0181424_10236881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300017967|Ga0181590_11083737 | Not Available | 518 | Open in IMG/M |
| 3300018048|Ga0181606_10364225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300020176|Ga0181556_1133384 | Not Available | 1052 | Open in IMG/M |
| 3300020498|Ga0208050_1004904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1647 | Open in IMG/M |
| 3300021347|Ga0213862_10243589 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 634 | Open in IMG/M |
| 3300021389|Ga0213868_10658321 | Not Available | 540 | Open in IMG/M |
| 3300021956|Ga0213922_1079980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 680 | Open in IMG/M |
| 3300021961|Ga0222714_10448398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300022178|Ga0196887_1088865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 709 | Open in IMG/M |
| 3300022179|Ga0181353_1060272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300022198|Ga0196905_1033044 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300023174|Ga0214921_10071627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2821 | Open in IMG/M |
| 3300023184|Ga0214919_10060320 | All Organisms → Viruses → Predicted Viral | 3520 | Open in IMG/M |
| 3300023184|Ga0214919_10147952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1870 | Open in IMG/M |
| 3300023184|Ga0214919_10209938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1448 | Open in IMG/M |
| 3300023184|Ga0214919_10481515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300023184|Ga0214919_10656096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300024352|Ga0255142_1000087 | Not Available | 35705 | Open in IMG/M |
| 3300024539|Ga0255231_1040027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300024568|Ga0255238_1003073 | All Organisms → Viruses → Predicted Viral | 3767 | Open in IMG/M |
| 3300024859|Ga0255278_1120270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300025635|Ga0208147_1126335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300025645|Ga0208643_1101283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300025645|Ga0208643_1153884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 580 | Open in IMG/M |
| 3300025646|Ga0208161_1023784 | All Organisms → Viruses → Predicted Viral | 2257 | Open in IMG/M |
| 3300025655|Ga0208795_1049586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1246 | Open in IMG/M |
| 3300025668|Ga0209251_1159592 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 581 | Open in IMG/M |
| 3300025732|Ga0208784_1257393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300025756|Ga0255239_1009298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1591 | Open in IMG/M |
| 3300025759|Ga0208899_1092805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
| 3300025889|Ga0208644_1357389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300026473|Ga0255166_1020587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1418 | Open in IMG/M |
| 3300026503|Ga0247605_1089094 | Not Available | 757 | Open in IMG/M |
| 3300027129|Ga0255067_1048756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300027608|Ga0208974_1190602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300027732|Ga0209442_1262740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300027797|Ga0209107_10557918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10346945 | Not Available | 542 | Open in IMG/M |
| 3300027893|Ga0209636_11146161 | Not Available | 554 | Open in IMG/M |
| 3300027896|Ga0209777_10501933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300028103|Ga0255172_1071242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300029933|Ga0119945_1029193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300031519|Ga0307488_10588064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300031758|Ga0315907_10446766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300031784|Ga0315899_10272548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1682 | Open in IMG/M |
| 3300031787|Ga0315900_10820419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300031787|Ga0315900_10856228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 618 | Open in IMG/M |
| 3300031963|Ga0315901_11029438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300032562|Ga0316226_1381422 | Not Available | 518 | Open in IMG/M |
| 3300033418|Ga0316625_101000590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300033482|Ga0316627_100228605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1462 | Open in IMG/M |
| 3300033978|Ga0334977_0466534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300033980|Ga0334981_0171749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300033981|Ga0334982_0140607 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
| 3300034012|Ga0334986_0629003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300034020|Ga0335002_0529898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300034023|Ga0335021_0234342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
| 3300034101|Ga0335027_0096090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2272 | Open in IMG/M |
| 3300034101|Ga0335027_0260850 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300034106|Ga0335036_0485696 | Not Available | 773 | Open in IMG/M |
| 3300034112|Ga0335066_0001096 | Not Available | 19572 | Open in IMG/M |
| 3300034118|Ga0335053_0268657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1085 | Open in IMG/M |
| 3300034119|Ga0335054_0417815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300034122|Ga0335060_0548616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300034283|Ga0335007_0757789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.43% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.35% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.35% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 2.61% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.61% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.61% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.61% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.61% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.74% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.87% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.87% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.87% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.87% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.87% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.87% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.87% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.87% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.87% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.87% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.87% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.87% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024539 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024859 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025756 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM31_102738292 | 3300001851 | Marine Plankton | PAPEGQAPYKSVRQDLIPVLVKAIQELKAEVETLEAQPQRLQ* |
| JGI24028J26656_10000781 | 3300002091 | Lentic | LIDEWLDPAPEGEEAYKSVRADLIPIFVKAIQELSAKNDALEARLAKLENAQ* |
| JGI24028J26656_10039105 | 3300002091 | Lentic | LIDEWLDPAPEGEEAYKSVRADLIPIFVKAIQELSAKNDALEARVAALEGK* |
| JGI24218J26658_100099812 | 3300002092 | Lentic | LIDEWLDPAPEGEEAYKSVRADLIPIFVKAIQELSAKNDALEARLAALEAK* |
| Ga0074242_107985941 | 3300005346 | Saline Water And Sediment | MNGKMKLLTGEEPYKAIRADLIPVLVKAIQEQQAIIQGLEARLAALESA* |
| Ga0068876_106700731 | 3300005527 | Freshwater Lake | PELIDEWKDPAPEGEEPYKAVRADLIPVLVKAIQEQQAMIETLKAKVAALEAK* |
| Ga0068872_102610225 | 3300005528 | Freshwater Lake | DLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQELSAKVAALEAK* |
| Ga0049080_103045331 | 3300005582 | Freshwater Lentic | KEWLDPAPEGEKPYKAINANLIPTLVKAIQEQQALIIQLTARITALESA* |
| Ga0075470_100843661 | 3300006030 | Aqueous | AQEFEQVLPDMIEEWKDPAPEGEEPYKAVNANLIPTLVKAIQEQQALITQLQADLAALKGA* |
| Ga0075465_101671802 | 3300006037 | Aqueous | DLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQELNAKNASLEARLAALEN* |
| Ga0075503_15392711 | 3300006400 | Aqueous | DLIDEWKDPAPEGGEPYKTVRQDLIPVLVKAIQEQQATITALEARITALENA* |
| Ga0098048_12102163 | 3300006752 | Marine | EVFPDLVGVWKDEPPEGEEPYKAVSQDLIPTLVKALQELSAKNDALESRITALEGA* |
| Ga0070749_100972396 | 3300006802 | Aqueous | KDPEPEGEAPYKSVRQDLIPVLVKAIQELKAQNDDLRVRLAAAGI* |
| Ga0070749_107399761 | 3300006802 | Aqueous | DPAPEGEEPYKSVRADLIPVLVKAMQEQQALITALTARIEALEA* |
| Ga0070750_103127783 | 3300006916 | Aqueous | PEGEEPYKSVRADLIPTLVKAIQEQQDIIKALETRIQTLENQ* |
| Ga0075472_106082451 | 3300006917 | Aqueous | DPAPEGEEPYKAINANLIPTLVKAIQEQQALITQLTARITALETP* |
| Ga0070747_12812512 | 3300007276 | Aqueous | EVFPDLIAEWKDPAPEGEEPYKSVSQDLIPTLVKAIQEQQAIIEALTARIAALES* |
| Ga0070753_10480007 | 3300007346 | Aqueous | FIAQEFEQVFPDLVDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQELKAELDEAKAKIAALEAK* |
| Ga0070753_11098851 | 3300007346 | Aqueous | DGEESYKSVRADLIPVLIKAIQEQQALITSLTARVALLEGN* |
| Ga0102690_11597441 | 3300007534 | Freshwater Lake | PDLIDEWKEAPPEGEEPYKSVRADLIPVLVKAIQELKAIVDAQAVEIAALKG* |
| Ga0099847_12196181 | 3300007540 | Aqueous | IAQEFEQVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIIEDMKTRLAVAGI* |
| Ga0099848_10301481 | 3300007541 | Aqueous | YKSVRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA* |
| Ga0099846_10777632 | 3300007542 | Aqueous | QEFEQVFPDLIGEWKDPAPEGEEPYKSVRQDLIPVLVKAIQELKAENDVLKARLDAAGL* |
| Ga0099850_12400741 | 3300007960 | Aqueous | YKSVRQDLIPVLVKAIQEQQTLIESQQSQIDALTARIEVLETA* |
| Ga0105748_104276052 | 3300007992 | Estuary Water | LISEWKDPAPEGEEPYKAVSQDLIPTLVKAIQEQQATIESQAAAITDLTTRLTALENN* |
| Ga0114364_10155865 | 3300008267 | Freshwater, Plankton | VFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQALITQLQADVAALKGASA* |
| Ga0114876_10073361 | 3300008448 | Freshwater Lake | FETVFPNLIDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA* |
| Ga0114876_11329361 | 3300008448 | Freshwater Lake | TWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQLLIQQLQADVAILKGVQQ* |
| Ga0114876_11563263 | 3300008448 | Freshwater Lake | DEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA* |
| Ga0114968_107664831 | 3300009155 | Freshwater Lake | PAPEGEEPYKAVNADLIPTLVKAIQEQQALIQSLTDRITQLENKL* |
| Ga0114966_107812321 | 3300009161 | Freshwater Lake | QEFETVFPEMIDTWKDPAPEGEEPYKAVNADLIPVLVKAIQELNAKVDEQAVRIAELEGVA* |
| Ga0105097_105680043 | 3300009169 | Freshwater Sediment | EMIQNWKDPAPEGEEPYKAVNADLIPILVKAIQELKAEFDAYKATHP* |
| Ga0129342_12152322 | 3300010299 | Freshwater To Marine Saline Gradient | VFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAMIEELKAEVAALKGE* |
| Ga0129324_103773371 | 3300010368 | Freshwater To Marine Saline Gradient | GEDPYKSVRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA* |
| Ga0157628_10408741 | 3300012757 | Freshwater | PAPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA* |
| Ga0129337_13617191 | 3300012968 | Aqueous | IDTWKDEAPEGEEPYKSVRADLIPVLVKAIQELKAEFDAYKATHP* |
| Ga0134315_10061351 | 3300014962 | Surface Water | VFPDLIDTWKDKPPEGEEPYKSVRPDLMPVVVKAIQELAAKVSALEAKQ* |
| Ga0181399_10854141 | 3300017742 | Seawater | GEDVKVIAQNLVPYLVKAVQELSAKNDALEARIIALEKA |
| Ga0181352_11069151 | 3300017747 | Freshwater Lake | DMVENWADPAPEGEEAYKAVNANLIPTLVKAIQEQQAIIESMKTEIDALKAKVGA |
| Ga0181352_11128021 | 3300017747 | Freshwater Lake | DPAPEGEEPYKSVRADLIPVLVKAMQEQQALIAQLQADVAALKA |
| Ga0181400_11718462 | 3300017752 | Seawater | WIDPAPEGEEPYKAVRADLIPTLVKAIQEQQATIESQATAITDLTTRLTALENN |
| Ga0181344_10513455 | 3300017754 | Freshwater Lake | EVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQALIQTLTARITALESA |
| Ga0181344_11185164 | 3300017754 | Freshwater Lake | EVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIITQLTARITALEGA |
| Ga0181343_10019001 | 3300017766 | Freshwater Lake | GEEPYKAVNADLIPVLVKAMQEQQALIVSLEARVAALEAA |
| Ga0181343_11471913 | 3300017766 | Freshwater Lake | DEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIITQLTARITALEGA |
| Ga0181425_10720171 | 3300017771 | Seawater | REGLVGEWKDEAPEGEEPYKAVSQDLIPTLVKAIQEQQTLIESLTARIAALEE |
| Ga0181355_12761561 | 3300017785 | Freshwater Lake | PAPEGEEPYKSVRQDLIPVLVKAIQEQQVMINELMAKFAALESK |
| Ga0181424_102368811 | 3300017786 | Seawater | LIDHWLDEPPEGEEPYKAVRADLIPTLVKAIQEQQATIEALTARVAQLENN |
| Ga0181590_110837372 | 3300017967 | Salt Marsh | RQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA |
| Ga0181606_103642251 | 3300018048 | Salt Marsh | VFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQALIQTLTDRITALEAK |
| Ga0181556_11333841 | 3300020176 | Salt Marsh | KDPAPEGEEPYKSVRQDLIPVLVKAIQEQQATITALEARIAALEAN |
| Ga0208050_10049047 | 3300020498 | Freshwater | IAQEFEQVFPNLIDEWKDEAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAK |
| Ga0213862_102435892 | 3300021347 | Seawater | DPAPEGEEPYKSVRQDLIPVLVKAIQEQQETITALTARIEQLENN |
| Ga0213868_106583211 | 3300021389 | Seawater | PDLVDEWLDEAPEGEEPYKSVRPDLIPVLVKAIQEQQEQIEQLKVEIQTLKGE |
| Ga0213922_10799801 | 3300021956 | Freshwater | PDMIETWKDPAPEGEEPYKAVNANLIPSLVKAIQELKAELDELKQKVN |
| Ga0222714_104483983 | 3300021961 | Estuarine Water | DEWKDNAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA |
| Ga0196887_10888653 | 3300022178 | Aqueous | SPEGEEPYKSVRQDLIPVLVKAIQELSAKNDALEARITALESA |
| Ga0181353_10602724 | 3300022179 | Freshwater Lake | PAPEGEEPYKSVRADLIPVLVKAIQELNAKVEAQAAEIALLKSK |
| Ga0196905_10330441 | 3300022198 | Aqueous | RDPAPEGEEPYKSVRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA |
| Ga0196905_10653852 | 3300022198 | Aqueous | MVDKSAIIPLLTAAIQEQQALITALTARVAALEGTQP |
| Ga0214921_100716271 | 3300023174 | Freshwater | FPDMVSNWIDEPPEGEEPYKAVNANLIPSLVKAIQEQQALITQLQADVAALKGTK |
| Ga0214919_100603201 | 3300023184 | Freshwater | TPPEGEKPYKSVRADLIPVLVKAIQEQQTIINDLKARIIALEGAK |
| Ga0214919_101479525 | 3300023184 | Freshwater | FEEVLPDLIDEWKDTPPEGEKPYKSVRADLIPVLVKAIQEQQIIINDLKARVTALEGASL |
| Ga0214919_102099384 | 3300023184 | Freshwater | FEEVLPDLIDEWKDTPPEGEKPYKSVRADLIPVLVKAIQEQQTIINDLKARVTALEAK |
| Ga0214919_104815152 | 3300023184 | Freshwater | IDEWKDTPPEGEKPYKSVRADLIPVLVKAIQEQQTIINDLTARITALEGAA |
| Ga0214919_106560961 | 3300023184 | Freshwater | PAPEGEEPYKSVRQDLIPVLVKAIQEQSALITQLTARITALEARNG |
| Ga0255142_100008762 | 3300024352 | Freshwater | EWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIIEQLKARLDAANL |
| Ga0255231_10400271 | 3300024539 | Freshwater | EFETVFPNLVDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAR |
| Ga0255238_10030731 | 3300024568 | Freshwater | APEGEEPYKSVRADLIPVLVKAIQELKAEVDSLKAQLEAK |
| Ga0255278_11202701 | 3300024859 | Freshwater | LVDEWKDNAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA |
| Ga0208147_11263352 | 3300025635 | Aqueous | GFIAQEFEQVFPDLIDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELKAQNDDLRARLAAAGI |
| Ga0208643_11012831 | 3300025645 | Aqueous | KDPAPEGEEPYKAVRADLIPTLVKAIQEQQATIESQAAAITDLTTRLTALENN |
| Ga0208643_11538841 | 3300025645 | Aqueous | VFPDLIDEWKDASPEGEEPYKSVRQDLIPVLVKAIQELSAKNDALEARITALESA |
| Ga0208161_10237841 | 3300025646 | Aqueous | PYKSVRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA |
| Ga0208795_10495861 | 3300025655 | Aqueous | QEFEQVFPEMIGEWLDPAPEGEEPYKSVRADLIPVLVKAIQEQQAIINGLEARLTALEAS |
| Ga0209251_11595921 | 3300025668 | Marine | QVFPDLVDEWKDAAPEGEEHYKSVRQDLIPVLVKAIQELSAKNDELEARITALEGA |
| Ga0208784_12573932 | 3300025732 | Aqueous | QEFETVFPNLIDEWKDAAPEGETPYKSVRQDLIPVLVKAIQELTARVQTLEAK |
| Ga0255239_10092981 | 3300025756 | Freshwater | PAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAR |
| Ga0208899_10928055 | 3300025759 | Aqueous | TDLIPLLTAAIQEQQELITAQQTAIETLEARVAALEAA |
| Ga0208644_13573891 | 3300025889 | Aqueous | QEFEQVFPDLVDEWKEPAPEGEEPYKSVRADLIPTLVKAIQEQQDIIKALETRIQTLENQ |
| Ga0255166_10205871 | 3300026473 | Freshwater | DEWKDNAPEGEVPYKSVRQDLIPVLVKAIQELTARVAALEA |
| Ga0247605_10890943 | 3300026503 | Seawater | WKDEPPEGEEPYKAVSQDLIPTLVKAIQELSAKNDALEARIATLEG |
| Ga0255067_10487561 | 3300027129 | Freshwater | LIDDWRDPAPEGEDPYKSVRQDLMPVLVKAIQEQQAIIESLKARLDAANL |
| Ga0208974_11906021 | 3300027608 | Freshwater Lentic | KEWLDPAPEGEKPYKAINANLIPTLVKAIQEQQALIIQLTARITALESA |
| Ga0209442_12627401 | 3300027732 | Freshwater Lake | PAPEGEEPYKSVRQDLIPVLVKAIQEQQTLITQLTARLDAANL |
| Ga0209190_13028373 | 3300027736 | Freshwater Lake | EEPYRSVRQDLMPVLVKAIQEQQALIESLTTRLTALENK |
| Ga0209107_105579183 | 3300027797 | Freshwater And Sediment | NVFPDMIKEWLDPAPEGEKPYKAINANLIPTLVKAIQEQQALIIQLTARITALESA |
| (restricted) Ga0255041_103469453 | 3300027837 | Seawater | PEGEEPYKAVSQDLIPTLVKAIQELSAKNDALEARIANLEG |
| Ga0209636_111461611 | 3300027893 | Marine Sediment | PAPEGEEPYKSVRQDLIPVLVKAIQELKAELDSVKAELAVIKGA |
| Ga0209777_105019331 | 3300027896 | Freshwater Lake Sediment | PEGEEPYKSVRADLIPTLVKAIQEQQAIITDLKARIETLEKK |
| Ga0255172_10712421 | 3300028103 | Freshwater | TVFPDMIETWQDPVPEGEEPYKAVNANLIPTLVKAIQELKAEIDALKG |
| Ga0119945_10291931 | 3300029933 | Aquatic | VFPEMIDTWLDPAPEGEEPYKAVNADLIPVLVKAIQELNAKVEAQAAEIAALKGNA |
| Ga0307488_105880643 | 3300031519 | Sackhole Brine | LIGEWKDPAPEGEEPYKSVSQDLIPTLVKAIQEQQTTIEALTARIAALES |
| Ga0315907_104467665 | 3300031758 | Freshwater | QLVDEWADPAPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA |
| Ga0315899_102725487 | 3300031784 | Freshwater | DNAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA |
| Ga0315900_108204192 | 3300031787 | Freshwater | IDEWADPAPEGEASYKSVRQDLIPVLVKAIQELAAEVNALKKA |
| Ga0315900_108562281 | 3300031787 | Freshwater | LIDEWKDPAPEGEEPYKAVRADLIPVLVKAIQEQQAMIETLKAKVAALEAK |
| Ga0315901_110294382 | 3300031963 | Freshwater | EFETVFPNLIDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA |
| Ga0316226_13814222 | 3300032562 | Freshwater | PDMIENWKDEAPEGEEPYKAINANLIPTLVKAIQEQQAIIEQLKAKVGI |
| Ga0316625_1010005901 | 3300033418 | Soil | PDMVDTWQDPAPEGEEPYKAVNADLIPVLVKAIQEQQALITDLRARVAALESN |
| Ga0316627_1002286051 | 3300033482 | Soil | FPDMIDEWKDPAPEGEEPYKSVRADLIPVLVKAIQELKAEVDSLKAQLEAK |
| Ga0334977_0466534_418_579 | 3300033978 | Freshwater | QEFETVFPNLIDEWKENAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAK |
| Ga0334981_0171749_919_1026 | 3300033980 | Freshwater | PEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA |
| Ga0334982_0140607_1077_1235 | 3300033981 | Freshwater | EFETVFPNLIDEWKDEAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLETR |
| Ga0334986_0629003_350_496 | 3300034012 | Freshwater | VFPNLVDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAR |
| Ga0335002_0529898_466_624 | 3300034020 | Freshwater | QEFEQVFPNLVDEWKDNAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA |
| Ga0335021_0234342_3_179 | 3300034023 | Freshwater | FEKVFPDLIDIAKDPVKEGETPYKTIRQDLIPVLVKAIQEQTQIIKNLEARIVSLESK |
| Ga0335027_0096090_3_152 | 3300034101 | Freshwater | EQVFPNLIDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA |
| Ga0335027_0260850_3_152 | 3300034101 | Freshwater | DTWKDEAPEGEEPYKSVRADLIPVLVKAIQEQQAIIEQLKADVAALKGA |
| Ga0335036_0485696_629_772 | 3300034106 | Freshwater | WKDPAPEGEEPYKAVNANLIPTLVKAIQEQQALITTLTDRITALEQA |
| Ga0335066_0001096_19396_19551 | 3300034112 | Freshwater | MVDQWIDPAPEGEEPYKAVNADLIPVLVKAIQELKADLDATKAELAALKGA |
| Ga0335053_0268657_963_1085 | 3300034118 | Freshwater | WADPSPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA |
| Ga0335054_0417815_3_143 | 3300034119 | Freshwater | PQLVDEWADPSPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA |
| Ga0335060_0548616_6_176 | 3300034122 | Freshwater | VFPDLIDEWKDPAPEGEEPYKSVRADLIPVLVKAIQELKSELDSVKAELATLKGNP |
| Ga0335007_0757789_3_137 | 3300034283 | Freshwater | PPEGEEPYKSVGADLIPVLVKAIQEQQQMIETLQAKVAALEGKK |
| ⦗Top⦘ |