NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080059

Metagenome / Metatranscriptome Family F080059

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080059
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 49 residues
Representative Sequence DFNHQVDHVMTRDPKEIKLKASAVTGRQPVNGFWDSDHAGLFSALRFAH
Number of Associated Samples 102
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.02 %
% of genes near scaffold ends (potentially truncated) 82.61 %
% of genes from short scaffolds (< 2000 bps) 80.00 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.870 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.913 % of family members)
Environment Ontology (ENVO) Unclassified
(24.348 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.217 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 22.08%    Coil/Unstructured: 77.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF13442Cytochrome_CBB3 20.87
PF00034Cytochrom_C 13.91
PF00012HSP70 6.09
PF12697Abhydrolase_6 5.22
PF00730HhH-GPD 3.48
PF03372Exo_endo_phos 1.74
PF00561Abhydrolase_1 1.74
PF08240ADH_N 0.87
PF13487HD_5 0.87
PF13683rve_3 0.87
PF01547SBP_bac_1 0.87
PF00296Bac_luciferase 0.87
PF02594DUF167 0.87
PF00144Beta-lactamase 0.87
PF12242Eno-Rase_NADH_b 0.87
PF00270DEAD 0.87
PF13011LZ_Tnp_IS481 0.87
PF09423PhoD 0.87
PF03681Obsolete Pfam Family 0.87
PF03703bPH_2 0.87
PF00196GerE 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 6.09
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 3.48
COG0177Endonuclease IIIReplication, recombination and repair [L] 3.48
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 3.48
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 3.48
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 3.48
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.87
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.87
COG1872Uncharacterized conserved protein YggU, UPF0235/DUF167 familyFunction unknown [S] 0.87
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.87
COG2367Beta-lactamase class ADefense mechanisms [V] 0.87
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.87
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.87 %
UnclassifiedrootN/A19.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502000|ACOD_GAKN62C01EY1QUAll Organisms → cellular organisms → Bacteria529Open in IMG/M
2170459002|FZY7DQ102HMGGGAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
2170459021|G14TP7Y02G3QIAAll Organisms → cellular organisms → Bacteria716Open in IMG/M
3300000956|JGI10216J12902_102705786All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300000956|JGI10216J12902_109146406All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300002568|C688J35102_119406875All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300002568|C688J35102_119621677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300002568|C688J35102_119954645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia825Open in IMG/M
3300003992|Ga0055470_10122925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300004004|Ga0055451_10075357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1316Open in IMG/M
3300004016|Ga0058689_10103208All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300004113|Ga0065183_10105608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1080Open in IMG/M
3300004153|Ga0063455_101278997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae557Open in IMG/M
3300004156|Ga0062589_102884274Not Available502Open in IMG/M
3300005168|Ga0066809_10171591All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005184|Ga0066671_10639696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300005329|Ga0070683_101031679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia790Open in IMG/M
3300005337|Ga0070682_100178027All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300005337|Ga0070682_102085942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300005339|Ga0070660_101001752All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300005343|Ga0070687_101064289Not Available590Open in IMG/M
3300005347|Ga0070668_101585293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300005367|Ga0070667_100861006All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300005440|Ga0070705_101410379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300005530|Ga0070679_101152922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia720Open in IMG/M
3300005546|Ga0070696_101825266Not Available526Open in IMG/M
3300005560|Ga0066670_10434978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300005589|Ga0070729_10748808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300005590|Ga0070727_10739939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300005600|Ga0070726_10425385All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005600|Ga0070726_10469575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium → Intrasporangium calvum635Open in IMG/M
3300005601|Ga0070722_10009303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2887Open in IMG/M
3300005719|Ga0068861_100046402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3275Open in IMG/M
3300006038|Ga0075365_10140613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli1676Open in IMG/M
3300006049|Ga0075417_10547849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300006467|Ga0099972_12227224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300006755|Ga0079222_10822888All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300006804|Ga0079221_10491247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300006804|Ga0079221_11227526Not Available584Open in IMG/M
3300006847|Ga0075431_101020426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300006954|Ga0079219_10005790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3769Open in IMG/M
3300007619|Ga0102947_1153510All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300009148|Ga0105243_11480716All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300009176|Ga0105242_12156597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300009840|Ga0126313_11292261All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300010037|Ga0126304_10577110All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300010044|Ga0126310_11741037All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300010044|Ga0126310_11813590All Organisms → cellular organisms → Bacteria → Terrabacteria group509Open in IMG/M
3300010045|Ga0126311_10026719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3507Open in IMG/M
3300010301|Ga0134070_10234057All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300010375|Ga0105239_11884306All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300010392|Ga0118731_102618414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300010392|Ga0118731_107604869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1389Open in IMG/M
3300010400|Ga0134122_12098545Not Available606Open in IMG/M
3300010400|Ga0134122_13258426All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010430|Ga0118733_106991651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300012212|Ga0150985_102221627All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300012212|Ga0150985_109590479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria694Open in IMG/M
3300012891|Ga0157305_10114689All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012913|Ga0157298_10144275All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria704Open in IMG/M
3300012914|Ga0157297_10371279All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300012914|Ga0157297_10413302All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012940|Ga0164243_10390451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria941Open in IMG/M
3300012943|Ga0164241_10275438All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300012955|Ga0164298_10608454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria751Open in IMG/M
3300013307|Ga0157372_12889315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300013772|Ga0120158_10133993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1405Open in IMG/M
3300014267|Ga0075313_1062618All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300014325|Ga0163163_12421249All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300015374|Ga0132255_106251256Not Available504Open in IMG/M
3300017966|Ga0187776_11093394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300018027|Ga0184605_10545861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300018465|Ga0190269_11200711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300018476|Ga0190274_11609500All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300018920|Ga0190273_12090769All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300020020|Ga0193738_1058005All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300021475|Ga0210392_10986593All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300022195|Ga0222625_1566499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter701Open in IMG/M
3300022886|Ga0247746_1038372All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300023266|Ga0247789_1002344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2859Open in IMG/M
3300024347|Ga0179591_1184812All Organisms → cellular organisms → Bacteria2562Open in IMG/M
3300025921|Ga0207652_10953809All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300025934|Ga0207686_10104721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1896Open in IMG/M
3300025944|Ga0207661_10897872All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300026075|Ga0207708_12025240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300027517|Ga0209113_1012020All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300027560|Ga0207981_1030933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300027909|Ga0209382_11561457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium SCSIO 66511655Open in IMG/M
3300028381|Ga0268264_12202429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300028589|Ga0247818_11071251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9572Open in IMG/M
3300028778|Ga0307288_10470542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_68_14518Open in IMG/M
3300028793|Ga0307299_10309566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium593Open in IMG/M
3300028878|Ga0307278_10365859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9635Open in IMG/M
3300031228|Ga0299914_11620086All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031996|Ga0308176_11372277All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300032157|Ga0315912_10014535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6580Open in IMG/M
3300033158|Ga0335077_10251815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1957Open in IMG/M
3300033550|Ga0247829_11167972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9638Open in IMG/M
3300034009|Ga0334944_025037All Organisms → cellular organisms → Bacteria1136Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.91%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment5.22%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.22%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.35%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.35%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.48%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine2.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.87%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.87%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.87%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.87%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
Fungus GardenHost-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden0.87%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.87%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502000Fungus garden microbial communities from Atta colombica in Panama - dump bottomHost-AssociatedOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004004Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2EnvironmentalOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007619Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MGEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012940Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027517Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030513Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034009Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ACODB_56138502040502000Fungus GardenVDHVMTDDPAGIALQSSAVTGLLPVNGFWSSDHAGLFSALRFAH
A5_c1_001138102124908044SoilMTRNPSEIGLQSSAVTGLLPVNGFWDSDHAGLFSALRFAH
E1_094138302170459002Grass SoilVLTTAGGGKTSNFDHKVDHVMTDTPDQVKLVRSTVTGRKPVNGFWDSDHAGLVSELRLP
4NP_024346002170459021Switchgrass, Maize And Mischanthus LitterLRHQVDHVITANPDEVTLKTSIVTGLDPVNGFWDSDHAGLFSALNFAKXVA
JGI10216J12902_10270578613300000956SoilEADFDHQVDHILTRDPDVVTLRDSEVSGIQPVNGYWSSDHAGVFSSLRFHR*
JGI10216J12902_10914640623300000956SoilEADFDHQVDHILTRDPDVVTLRDSEVSGIQPVNGYWNSDHAGVFSSLLIHR*
C688J35102_11940687513300002568SoilHKVDHIMTNIPKRLKLISSSVTGRKPVHGFWDSDHAGLFSSLRIP*
C688J35102_11962167723300002568SoilVKNFDHQVDHVLTDRPKQVKLVSSAVTGRKPVNGFWDSDHAGLFSALAISK*
C688J35102_11995464513300002568SoilNGGGSAADFDHKVDHVMTNSPNKVKLVKSSVLGLQPVNGFWSSDHAGLFSQLAVKK*
Ga0055470_1012292523300003992Natural And Restored WetlandsDFDHQVDHVMTRTPKKVKLKSSSVTGRQPVNGFWDSDHAGIFSALKFRP*
Ga0055467_1013738213300003996Natural And Restored WetlandsMTRDPERVALKSSTVTGLLPANGFWDSDHAGLFSALRFAHQPLER*
Ga0055451_1007535713300004004Natural And Restored WetlandsHQVDHIMTRDPSKVTLRSSTVTGRLPVNGFWDSDHAGLFSALRFAH*
Ga0058689_1010320813300004016AgaveEGGSEADFDHQVDHVMTRDPETVTLERSSVSGIQPVNGFWSSDHAGVFSALRFGR*
Ga0055483_1029490513300004063Natural And Restored WetlandsHIMTRDPEEVLFNYGAVTGLEPVNGFWDSDHAGLFSALRFHTH*
Ga0065183_1010560833300004113Pelagic MarineFDHQVDHIMTRDPYNVFLRRSEVTGLEPVNGFWNSDHAGVFSTLRLRRVWPHSSK*
Ga0063455_10089668223300004153SoilVMTNDPSGIALERSEVTGLLPVNGFWDSDHAGLFSALRFQH*
Ga0063455_10127899713300004153SoilKRSDLDHKVDHVMTNAPKKVKLLKSTITGRSPVNGFWDSDHAGVLSVLRVS*
Ga0062589_10288427423300004156SoilDFDHKVDHVMTNDPSQVRLVKSSVTGRYPTNGYWGSDHAGLSSVLAFK*
Ga0066809_1017159113300005168SoilADFNHQVDHVMTRDPKEVKLTSSFVTGRQPVRGFWDSDHAGLYSSLQLRQ*
Ga0066671_1063969623300005184SoilLTTSGPGKLSDFDHKVDHVMTNRPKQITLVSSAVTGRKPVNGFWDSDHLGLFSDLTVP*
Ga0070683_10103167923300005329Corn RhizosphereDFDHHIDHVLTDDPDGVQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP*
Ga0070682_10017802713300005337Corn RhizosphereDFDHQVDHVMTANPDEITLKSSIVTGLDPVNGFWDSDHAGLFSALNFAK*
Ga0070682_10208594213300005337Corn RhizosphereADFNHQVDHVMTRDPAEVKLKESAVTGLLPVNGFWDSDHAGLFSALQFTH*
Ga0070660_10100175213300005339Corn RhizosphereVDHVMTRDPKEVKLKASSVTGRAAVNGFWSSDHAGVFSSLLFR*
Ga0070687_10106428913300005343Switchgrass RhizosphereGGGASVSDFDHKVDHVMTDDPSQVRLVKSSVTGRYPTNGYWGSDHAGLSSVLAFK*
Ga0070668_10158529323300005347Switchgrass RhizosphereQVDHIMTADPKKVKLKSSAVTGRTPVNGFWDSDHAGVFSSLWLLR*
Ga0070667_10086100613300005367Switchgrass RhizosphereAVSQFDHKVDHIMTRDPKQVKEVSSSVTGRSPQNGFWDSDHAGLFSTLKIN*
Ga0070705_10141037913300005440Corn, Switchgrass And Miscanthus RhizosphereSDFDHKVDHVMTDDPSQVRLVKSTITGRYPMDGYWGSDHAGVLSVLDFK*
Ga0070679_10115292213300005530Corn RhizosphereIDHVMTDDPGGIQLVSSAVTGLLPVNGFWDSDHAGVFSSLEILP*
Ga0070696_10182526623300005546Corn, Switchgrass And Miscanthus RhizosphereSDFDHKVDHVMTNDPSQVRLVKSSVTGRYPTNGYWGSDHAGLSSVLAFK*
Ga0066670_1043497813300005560SoilASLGSVSDFDHQVDHILTNKPTKVQLVSSSVTGRSPHNNIWDSDHAGLFSALRLR*
Ga0070729_1074880813300005589Marine SedimentDFNHQVDHIMTRDPYNVLLRHSEVTGLEPVNGFWNSDHAGVFSALMLRRVSPPPFELQP*
Ga0070727_1073993913300005590Marine SedimentDFDHQVDHIMTRDPYNVFLRRSEVTGLEPVNGFWNSDHAGVFSTLRLRR*
Ga0070726_1042538523300005600Marine SedimentHQVDHIMTRDPYNVLLRHSEVTGLEPVNGFWNSDHAGVFSRLRLRR*
Ga0070726_1046957513300005600Marine SedimentGEDDGGDIADFDHQVDHIMTRDPYNVFLRHSEVTGLEPVNGFWNSDHAGVFSRLRLRR*
Ga0070722_1000930313300005601Marine SedimentDGGDITDFDHQVDHIMTRDPYNVFLRRSEVTGLEPVNGFWNSDHAGVFSALRLRRVWPHAFEVQP*
Ga0068861_10004640263300005719Switchgrass RhizosphereDFDHQVDHVMTNDPADVTLRDSEVTGLLPVNGFWNSDHAGLFSALKFAR*
Ga0075365_1014061313300006038Populus EndosphereQVSDFDHKVDHIMTNDPQHVGLVNSAVTGRQPINGFWDSDHAGLFSTLLFH*
Ga0066652_10047380013300006046SoilMTRDPAEITLQNSSVSGIQPVNGFWDSDHAGLFSALRFSTH*
Ga0075417_1054784913300006049Populus RhizosphereLTDAPTRVNLVRSSVTGRFPVNGFWSSDHAGIASVLGVGSG*
Ga0099972_1222722413300006467MarineITDFDHQVDHIMTRDPHNVFLRHSEVTGLEPVNGFWNSDHAGVFSALMLRRVWPHGFEEQP*
Ga0074054_1168535423300006579SoilTRDPAEISLQSSDVTGLLPVNGFWDSDHAGLFSALRFAH*
Ga0079222_1082288833300006755Agricultural SoilEGDDEGENDHQVDHIMTRDPEVVTLQDSGVSGIQPVNGFWDSDHAGLFSALRFDD*
Ga0079221_1049124723300006804Agricultural SoilAGGSIADFDHQVDHVMTNEPSITLERSAVTGLLPVNGFWDSDHAGLFSALRFPR*
Ga0079221_1122752613300006804Agricultural SoilNHKVDHIMTDAPKQVKLLDSKVTGRSKTNGYWDSDHAGLFSALDLLS*
Ga0075431_10102042613300006847Populus RhizosphereFDHKVDHIMTDNPGEIGRVRQSVTGRKPRNGFWNSDHAGLFSVLKLR*
Ga0079219_1000579013300006954Agricultural SoilKVSDFDHQVDHVMTDTPKRIKLVKSLVTGRSPANGFWDSDHAGLFSTLSLG*
Ga0102947_115351023300007619SoilADFDHQVDHIMTRDPYQFFLRSSEITGLYPVDGFWNSDHAGVFSRLRFRR*
Ga0105243_1148071623300009148Miscanthus RhizosphereDFNHQVDHVMTRDPKEIKLKASAVTGRQPVNGFWDSDHAGLFSALRFAH*
Ga0105242_1215659713300009176Miscanthus RhizosphereDHKVDHIMTNDPHHVGLVDSAVTGLQPINGYWDSDHAGLFSTLLFH*
Ga0126313_1129226123300009840Serpentine SoilDHVMTRNPDEVVLKSSTVTGLLPVNGFWNSDHAGVFSALRFLD*
Ga0126304_1057711013300010037Serpentine SoilGGGGSVADFDHHIDHVMTRDPKKVKLISSAVTGREPVNGFWDSDHAGVFSSLWMLR*
Ga0126310_1174103723300010044Serpentine SoilGAGGSVADFDHQVDHVMTRDPKQVKLISSSVTGRSPVNGYWDSDHAGLFSSLWLLR*
Ga0126310_1181359023300010044Serpentine SoilGKLSDFDHKVDHVMTSSPKRVKLVKSTVPGRNPVAGFWPSDHAGLFSVLTLR*
Ga0126311_1002671963300010045Serpentine SoilFDHQVDHIMTRDPELIELRSSIVTGLQPVNDFWNSDHAGVFSSLVFDR*
Ga0134070_1023405713300010301Grasslands SoilNHQVDHVMTRDPKDVKLKASFVTGRQPVNGFWDSDHAGLYSSLKLRR*
Ga0134125_1309423113300010371Terrestrial SoilDPAKVLLRRSAVTGLQPVNGFWDSDHAGMFSSLEVLP*
Ga0105239_1188430623300010375Corn RhizosphereQVDHVMTNDPAGIKLEDSGVTGLLPVNGFWNSDHAGLWSSLRFVH*
Ga0118731_10261841423300010392MarineFDHQVDHIMTRDPYNVFLRHSEVTGLEPVNGFWNSDHAGVFSRLRLRR*
Ga0118731_10760486933300010392MarineQVDHIMTRDPYNVLLRHSEVTGLEPVNGFWNSDHAGVFSALMLRRVSPFEVPP*
Ga0134122_1209854513300010400Terrestrial SoilHKVDHVMTDDPSQVRLVRSTITGRYPMDGYWGSDHAGLSSVLAFK*
Ga0134122_1325842613300010400Terrestrial SoilIDQVLTNDSEGIQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP*
Ga0118733_10699165113300010430Marine SedimentDHQVDHIMTRDPYNVLLRHSEVTGLEPVNGFWNSDHAGVFSRLRLRR*
Ga0150985_10222162723300012212Avena Fatua RhizosphereVDHIMTADPKKVKLKTSAVTGRTPVNGFWDSDHAGLFSALTLK*
Ga0150985_10959047913300012212Avena Fatua RhizosphereQFDHKVDHIMTNDPGHVRRGRVAVTGRRPHNGFWDSDHAGLFSTLKFR*
Ga0157305_1011468913300012891SoilAEMDHKVDHIMTNAPKKVKLLSSTVTGRTMQNGYWNSDHAGLFSALRFRD*
Ga0157292_1001803813300012900SoilSDPADVSLAGATVTGLQPVNGFWDSDHAGVFSALRFSR*
Ga0157298_1014427523300012913SoilDHVLTDDPDGVQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP*
Ga0157297_1037127913300012914SoilDGGEVADFDHHIDHVLTNDPDGVQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP*
Ga0157297_1041330213300012914SoilDFDHQVDHVMTNDPGRIRLERSEVTGLLPVNGFWDSDHAGVFSALRFQG*
Ga0164243_1039045113300012940CompostQFDHKVDHIMTRDPKQVKEVNSSVTGRSPQNGFWDSDHAGLFSTLKILP*
Ga0164241_1027543813300012943SoilGGSVADFDHQVDHVMTNDPSDITLRSSAVTGLLPVNGFWNSDHAGVFSSLNLR*
Ga0164298_1060845413300012955SoilHHIDQVLTNDSGGIKLLNSEVTGLLPVNGFWDSDHAGVFSSLEILP*
Ga0164306_1126081113300012988SoilGITLLSSAVTGRTPVNGFWDSDHAGVFSSLEVLP*
Ga0157370_1067217333300013104Corn RhizosphereTRNPTEVGLKESTVTGLLPVNGFWDSDHAGLFSALLFAH*
Ga0157372_1288931523300013307Corn RhizosphereGGKVTDFDHQVDHVMTDTPKKIKLVKSVVTGRSPANGFWDSDHAGLFSTLSLG*
Ga0120158_1013399333300013772PermafrostIITADRGSVSDFDHQVDHVLTNDPQIALASSSVTGRAPVNGYWDSDHAGLFSLLNIRR*
Ga0075313_106261813300014267Natural And Restored WetlandsGSVADFDHQVDHIMTRDPGKVALRSSTVTGLLPVNGFWDSDHAGLFSALRFVH*
Ga0163163_1242124913300014325Switchgrass RhizosphereQFDHKVDHIMTRDPKQVKEVNSSVTGRSPQNGFWDSDHAGLFSTLKIG*
Ga0132255_10199363513300015374Arabidopsis RhizosphereMTRDPKEVKLKSSFVTGRQPANGFWDSDHAGLFSALRFAH*
Ga0132255_10625125623300015374Arabidopsis RhizosphereQVSQFDHKVDHVMTDDPAHIKLVRSTVTGRHPYNGWWGSDHAGTASVLNFK*
Ga0187776_1109339413300017966Tropical PeatlandVLTVAGGGKRSDFDHKVDHIMTNAPSKIGLSESSLTGTRPMHGYWDSDHEGLFSSLTLP
Ga0184605_1054586113300018027Groundwater SedimentFDHLVDHVMTDDPTHVSLVRSTVTGRFPVNGFWDSDHAGIASALGVGFG
Ga0190269_1120071143300018465SoilDHKVDHVMTDDPAHVNLVRSTVTGRSPVNGFWDSDHAGIASALGVGFG
Ga0190274_1160950013300018476SoilADFDHHIDHVLTDDPDGITLLEAIVTGRNPVNGFWDSDHAGGFSSLQVLP
Ga0190273_1209076913300018920SoilGSVADFDHQVDHVMTRDPKKVKLISSAVTGRQPVNGFWDSDHAGLYSSLWLLR
Ga0193738_105800513300020020SoilGGSVADFDHHIDHVMTRDPKKVKLISSAVTGRQPVNGFWDSDHAGVFSSLWLLR
Ga0210392_1098659323300021475SoilADFDHQVDHVMTNDPTDIELQGSAVTGLLPVNGFWSSDHTGLFSSLRFDD
Ga0222625_156649923300022195Groundwater SedimentGSVSDFDHLVDHVMTDDPTHVSLVRSTVTGRFPVNGFWDSDHAGIASALSFGF
Ga0247746_103837213300022886SoilADFDHQVDHIMTRDPDQITLESSTVTGLLPVNGFWNSDHAGIFSSLRFR
Ga0247789_100234453300023266SoilGGSVADFNHQVDHVMTRDPKEVKLKSSSVTGRQPLNGFWNSDHAGLFSALSFRK
Ga0179591_118481223300024347Vadose Zone SoilMTNDPGGHRAADSEVTGLLPVNGFWDSDHAGLFSALRFER
Ga0207649_1162443823300025920Corn RhizosphereTANPDEVTLKTSIVTGLDPVNGFWDSDHAGLFSALNFAK
Ga0207652_1095380913300025921Corn RhizosphereDHHIDHVMTDDPGGIQLVSSAVTGLLPVNGFWDSDHAGVFSSLEILP
Ga0207681_1026489233300025923Switchgrass RhizosphereVMTRDPKDVKLKSSSVTGRQPVNGFWDSDHAGLFSALRFAH
Ga0207686_1010472113300025934Miscanthus RhizosphereSEADFDHQVDHVMTRDPEEIALQSSSVSGIQPVNGFWNSDHAGLFSALRFAH
Ga0207709_1142255113300025935Miscanthus RhizosphereKEIKLKASAVTGRQPVNGFWDSDHAGLFSALRFAH
Ga0207661_1089787213300025944Corn RhizosphereDFDHHIDHVLTDDPDGVQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP
Ga0207708_1202524013300026075Corn, Switchgrass And Miscanthus RhizosphereSSLLAVGEGGSEADFDHQVDHIMTRDPEEITLESSAVSGIQPVNGYWNSDHAGLFSALRF
Ga0209113_101202033300027517Forest SoilSQFNHKVDHIMTSDPKQIKLVKSSVTGRKPTNGFWDSDHAGLFSELGIHP
Ga0207981_103093313300027560SoilFNHQVDHVMTRDPKEVKLTSSFVTGRQPVRGFWDSDHAGLYSSLQLRQ
Ga0209177_1013039613300027775Agricultural SoilDHQVDHVMTNAPSIVRLVSSSVTGRTMVNGFWDSDHAGLVSELHIR
Ga0209382_1156145723300027909Populus RhizosphereVLTAGGGGSVSDFDHKVDHVLTDAPTRVNLVRSSVTGRFPVNGFWSSDHAGI
Ga0268264_1220242923300028381Switchgrass RhizosphereHTVDHVMTDTPKKIKLVTSKVTGLTKAKTGWWDSDHAGVFSSLLILR
Ga0247818_1107125123300028589SoilANGGGSVSDFDHHVDHILTNAPQAVGLVHSSVTGRQPVNGFWDSDHAGVFSNLLVH
Ga0307288_1047054223300028778SoilAGGGGSIADFDHKVDHIMTNAPNKVKLKSSTVLGRNPVNGFWPSDHAGLFSQLAFP
Ga0307299_1030956623300028793SoilDFNHQVDHVMTNAPRKVKLVSSSVTGRKPANGFWDSDHAGLFSRLSLP
Ga0307278_1036585913300028878SoilTRDGGGSRGDFDHQVDHVMTNAPNEVELVNSSVTGLYPVNGFWNSDHAGVFSELRLP
Ga0268242_109712913300030513SoilVDHVLTNAPALITPQSSLVTGLQPVNGFWNSDHAGVFSALRFHR
Ga0299914_1162008613300031228SoilQVDHILTRDPKTVTLKSSAVTGLLPVNGFWSSDHAGVYSALGFTR
Ga0308176_1137227723300031996SoilDFDHKVDHVMTNKPNKVKLVKSSVLGLQPVNGFWDSDHAGLFSSLKLFR
Ga0315912_1001453593300032157SoilDHVMTDDPTHVTLLESNVTGLFPVNGFWSSDHAGINSALRLSLLP
Ga0335077_1025181523300033158SoilVSDFDHKVDHVMTNAPRRIKLVSSSVTGRRPVNGFWDSDHAGLFSVLSLPR
Ga0247829_1116797213300033550SoilGGGSVSDFDHHVDHILTNAPQAVGLVHSSVTGRQPVNGFWDSDHAGVFSNLLVH
Ga0334944_025037_1_1563300034009Sub-Biocrust SoilVADFDHQVDHVMTDDPSGITLERSEVTGLQPVNGFWDSDHAGVYSALRFTR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.