| Basic Information | |
|---|---|
| Family ID | F080059 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 49 residues |
| Representative Sequence | DFNHQVDHVMTRDPKEIKLKASAVTGRQPVNGFWDSDHAGLFSALRFAH |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.02 % |
| % of genes near scaffold ends (potentially truncated) | 82.61 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.870 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.913 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.348 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.217 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.08% Coil/Unstructured: 77.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF13442 | Cytochrome_CBB3 | 20.87 |
| PF00034 | Cytochrom_C | 13.91 |
| PF00012 | HSP70 | 6.09 |
| PF12697 | Abhydrolase_6 | 5.22 |
| PF00730 | HhH-GPD | 3.48 |
| PF03372 | Exo_endo_phos | 1.74 |
| PF00561 | Abhydrolase_1 | 1.74 |
| PF08240 | ADH_N | 0.87 |
| PF13487 | HD_5 | 0.87 |
| PF13683 | rve_3 | 0.87 |
| PF01547 | SBP_bac_1 | 0.87 |
| PF00296 | Bac_luciferase | 0.87 |
| PF02594 | DUF167 | 0.87 |
| PF00144 | Beta-lactamase | 0.87 |
| PF12242 | Eno-Rase_NADH_b | 0.87 |
| PF00270 | DEAD | 0.87 |
| PF13011 | LZ_Tnp_IS481 | 0.87 |
| PF09423 | PhoD | 0.87 |
| PF03681 | Obsolete Pfam Family | 0.87 |
| PF03703 | bPH_2 | 0.87 |
| PF00196 | GerE | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 6.09 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 3.48 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 3.48 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 3.48 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 3.48 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 3.48 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.87 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.87 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.87 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.87 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.87 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.87 % |
| Unclassified | root | N/A | 19.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502000|ACOD_GAKN62C01EY1QU | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 2170459002|FZY7DQ102HMGGG | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 2170459021|G14TP7Y02G3QIA | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300000956|JGI10216J12902_102705786 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300000956|JGI10216J12902_109146406 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300002568|C688J35102_119406875 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300002568|C688J35102_119621677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300002568|C688J35102_119954645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
| 3300003992|Ga0055470_10122925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300004004|Ga0055451_10075357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1316 | Open in IMG/M |
| 3300004016|Ga0058689_10103208 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300004113|Ga0065183_10105608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1080 | Open in IMG/M |
| 3300004153|Ga0063455_101278997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 557 | Open in IMG/M |
| 3300004156|Ga0062589_102884274 | Not Available | 502 | Open in IMG/M |
| 3300005168|Ga0066809_10171591 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005184|Ga0066671_10639696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300005329|Ga0070683_101031679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300005337|Ga0070682_100178027 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300005337|Ga0070682_102085942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300005339|Ga0070660_101001752 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005343|Ga0070687_101064289 | Not Available | 590 | Open in IMG/M |
| 3300005347|Ga0070668_101585293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300005367|Ga0070667_100861006 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300005440|Ga0070705_101410379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300005530|Ga0070679_101152922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300005546|Ga0070696_101825266 | Not Available | 526 | Open in IMG/M |
| 3300005560|Ga0066670_10434978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300005589|Ga0070729_10748808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300005590|Ga0070727_10739939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300005600|Ga0070726_10425385 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005600|Ga0070726_10469575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium → Intrasporangium calvum | 635 | Open in IMG/M |
| 3300005601|Ga0070722_10009303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2887 | Open in IMG/M |
| 3300005719|Ga0068861_100046402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3275 | Open in IMG/M |
| 3300006038|Ga0075365_10140613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1676 | Open in IMG/M |
| 3300006049|Ga0075417_10547849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300006467|Ga0099972_12227224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300006755|Ga0079222_10822888 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300006804|Ga0079221_10491247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300006804|Ga0079221_11227526 | Not Available | 584 | Open in IMG/M |
| 3300006847|Ga0075431_101020426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300006954|Ga0079219_10005790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3769 | Open in IMG/M |
| 3300007619|Ga0102947_1153510 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009148|Ga0105243_11480716 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300009176|Ga0105242_12156597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300009840|Ga0126313_11292261 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010037|Ga0126304_10577110 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300010044|Ga0126310_11741037 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010044|Ga0126310_11813590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
| 3300010045|Ga0126311_10026719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3507 | Open in IMG/M |
| 3300010301|Ga0134070_10234057 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010375|Ga0105239_11884306 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300010392|Ga0118731_102618414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300010392|Ga0118731_107604869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1389 | Open in IMG/M |
| 3300010400|Ga0134122_12098545 | Not Available | 606 | Open in IMG/M |
| 3300010400|Ga0134122_13258426 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010430|Ga0118733_106991651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300012212|Ga0150985_102221627 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012212|Ga0150985_109590479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
| 3300012891|Ga0157305_10114689 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012913|Ga0157298_10144275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 704 | Open in IMG/M |
| 3300012914|Ga0157297_10371279 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012914|Ga0157297_10413302 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012940|Ga0164243_10390451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300012943|Ga0164241_10275438 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300012955|Ga0164298_10608454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300013307|Ga0157372_12889315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300013772|Ga0120158_10133993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1405 | Open in IMG/M |
| 3300014267|Ga0075313_1062618 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300014325|Ga0163163_12421249 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300015374|Ga0132255_106251256 | Not Available | 504 | Open in IMG/M |
| 3300017966|Ga0187776_11093394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300018027|Ga0184605_10545861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300018465|Ga0190269_11200711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300018476|Ga0190274_11609500 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300018920|Ga0190273_12090769 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300020020|Ga0193738_1058005 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300021475|Ga0210392_10986593 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300022195|Ga0222625_1566499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter | 701 | Open in IMG/M |
| 3300022886|Ga0247746_1038372 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300023266|Ga0247789_1002344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2859 | Open in IMG/M |
| 3300024347|Ga0179591_1184812 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
| 3300025921|Ga0207652_10953809 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300025934|Ga0207686_10104721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1896 | Open in IMG/M |
| 3300025944|Ga0207661_10897872 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300026075|Ga0207708_12025240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300027517|Ga0209113_1012020 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300027560|Ga0207981_1030933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300027909|Ga0209382_11561457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium SCSIO 66511 | 655 | Open in IMG/M |
| 3300028381|Ga0268264_12202429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300028589|Ga0247818_11071251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 572 | Open in IMG/M |
| 3300028778|Ga0307288_10470542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_68_14 | 518 | Open in IMG/M |
| 3300028793|Ga0307299_10309566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 593 | Open in IMG/M |
| 3300028878|Ga0307278_10365859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 635 | Open in IMG/M |
| 3300031228|Ga0299914_11620086 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031996|Ga0308176_11372277 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300032157|Ga0315912_10014535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6580 | Open in IMG/M |
| 3300033158|Ga0335077_10251815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1957 | Open in IMG/M |
| 3300033550|Ga0247829_11167972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 638 | Open in IMG/M |
| 3300034009|Ga0334944_025037 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 5.22% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.22% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.35% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.87% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.87% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.87% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
| Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.87% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.87% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502000 | Fungus garden microbial communities from Atta colombica in Panama - dump bottom | Host-Associated | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007619 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012940 | Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034009 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACODB_5613850 | 2040502000 | Fungus Garden | VDHVMTDDPAGIALQSSAVTGLLPVNGFWSSDHAGLFSALRFAH |
| A5_c1_00113810 | 2124908044 | Soil | MTRNPSEIGLQSSAVTGLLPVNGFWDSDHAGLFSALRFAH |
| E1_09413830 | 2170459002 | Grass Soil | VLTTAGGGKTSNFDHKVDHVMTDTPDQVKLVRSTVTGRKPVNGFWDSDHAGLVSELRLP |
| 4NP_02434600 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | LRHQVDHVITANPDEVTLKTSIVTGLDPVNGFWDSDHAGLFSALNFAKXVA |
| JGI10216J12902_1027057861 | 3300000956 | Soil | EADFDHQVDHILTRDPDVVTLRDSEVSGIQPVNGYWSSDHAGVFSSLRFHR* |
| JGI10216J12902_1091464062 | 3300000956 | Soil | EADFDHQVDHILTRDPDVVTLRDSEVSGIQPVNGYWNSDHAGVFSSLLIHR* |
| C688J35102_1194068751 | 3300002568 | Soil | HKVDHIMTNIPKRLKLISSSVTGRKPVHGFWDSDHAGLFSSLRIP* |
| C688J35102_1196216772 | 3300002568 | Soil | VKNFDHQVDHVLTDRPKQVKLVSSAVTGRKPVNGFWDSDHAGLFSALAISK* |
| C688J35102_1199546451 | 3300002568 | Soil | NGGGSAADFDHKVDHVMTNSPNKVKLVKSSVLGLQPVNGFWSSDHAGLFSQLAVKK* |
| Ga0055470_101229252 | 3300003992 | Natural And Restored Wetlands | DFDHQVDHVMTRTPKKVKLKSSSVTGRQPVNGFWDSDHAGIFSALKFRP* |
| Ga0055467_101373821 | 3300003996 | Natural And Restored Wetlands | MTRDPERVALKSSTVTGLLPANGFWDSDHAGLFSALRFAHQPLER* |
| Ga0055451_100753571 | 3300004004 | Natural And Restored Wetlands | HQVDHIMTRDPSKVTLRSSTVTGRLPVNGFWDSDHAGLFSALRFAH* |
| Ga0058689_101032081 | 3300004016 | Agave | EGGSEADFDHQVDHVMTRDPETVTLERSSVSGIQPVNGFWSSDHAGVFSALRFGR* |
| Ga0055483_102949051 | 3300004063 | Natural And Restored Wetlands | HIMTRDPEEVLFNYGAVTGLEPVNGFWDSDHAGLFSALRFHTH* |
| Ga0065183_101056083 | 3300004113 | Pelagic Marine | FDHQVDHIMTRDPYNVFLRRSEVTGLEPVNGFWNSDHAGVFSTLRLRRVWPHSSK* |
| Ga0063455_1008966822 | 3300004153 | Soil | VMTNDPSGIALERSEVTGLLPVNGFWDSDHAGLFSALRFQH* |
| Ga0063455_1012789971 | 3300004153 | Soil | KRSDLDHKVDHVMTNAPKKVKLLKSTITGRSPVNGFWDSDHAGVLSVLRVS* |
| Ga0062589_1028842742 | 3300004156 | Soil | DFDHKVDHVMTNDPSQVRLVKSSVTGRYPTNGYWGSDHAGLSSVLAFK* |
| Ga0066809_101715911 | 3300005168 | Soil | ADFNHQVDHVMTRDPKEVKLTSSFVTGRQPVRGFWDSDHAGLYSSLQLRQ* |
| Ga0066671_106396962 | 3300005184 | Soil | LTTSGPGKLSDFDHKVDHVMTNRPKQITLVSSAVTGRKPVNGFWDSDHLGLFSDLTVP* |
| Ga0070683_1010316792 | 3300005329 | Corn Rhizosphere | DFDHHIDHVLTDDPDGVQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP* |
| Ga0070682_1001780271 | 3300005337 | Corn Rhizosphere | DFDHQVDHVMTANPDEITLKSSIVTGLDPVNGFWDSDHAGLFSALNFAK* |
| Ga0070682_1020859421 | 3300005337 | Corn Rhizosphere | ADFNHQVDHVMTRDPAEVKLKESAVTGLLPVNGFWDSDHAGLFSALQFTH* |
| Ga0070660_1010017521 | 3300005339 | Corn Rhizosphere | VDHVMTRDPKEVKLKASSVTGRAAVNGFWSSDHAGVFSSLLFR* |
| Ga0070687_1010642891 | 3300005343 | Switchgrass Rhizosphere | GGGASVSDFDHKVDHVMTDDPSQVRLVKSSVTGRYPTNGYWGSDHAGLSSVLAFK* |
| Ga0070668_1015852932 | 3300005347 | Switchgrass Rhizosphere | QVDHIMTADPKKVKLKSSAVTGRTPVNGFWDSDHAGVFSSLWLLR* |
| Ga0070667_1008610061 | 3300005367 | Switchgrass Rhizosphere | AVSQFDHKVDHIMTRDPKQVKEVSSSVTGRSPQNGFWDSDHAGLFSTLKIN* |
| Ga0070705_1014103791 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SDFDHKVDHVMTDDPSQVRLVKSTITGRYPMDGYWGSDHAGVLSVLDFK* |
| Ga0070679_1011529221 | 3300005530 | Corn Rhizosphere | IDHVMTDDPGGIQLVSSAVTGLLPVNGFWDSDHAGVFSSLEILP* |
| Ga0070696_1018252662 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | SDFDHKVDHVMTNDPSQVRLVKSSVTGRYPTNGYWGSDHAGLSSVLAFK* |
| Ga0066670_104349781 | 3300005560 | Soil | ASLGSVSDFDHQVDHILTNKPTKVQLVSSSVTGRSPHNNIWDSDHAGLFSALRLR* |
| Ga0070729_107488081 | 3300005589 | Marine Sediment | DFNHQVDHIMTRDPYNVLLRHSEVTGLEPVNGFWNSDHAGVFSALMLRRVSPPPFELQP* |
| Ga0070727_107399391 | 3300005590 | Marine Sediment | DFDHQVDHIMTRDPYNVFLRRSEVTGLEPVNGFWNSDHAGVFSTLRLRR* |
| Ga0070726_104253852 | 3300005600 | Marine Sediment | HQVDHIMTRDPYNVLLRHSEVTGLEPVNGFWNSDHAGVFSRLRLRR* |
| Ga0070726_104695751 | 3300005600 | Marine Sediment | GEDDGGDIADFDHQVDHIMTRDPYNVFLRHSEVTGLEPVNGFWNSDHAGVFSRLRLRR* |
| Ga0070722_100093031 | 3300005601 | Marine Sediment | DGGDITDFDHQVDHIMTRDPYNVFLRRSEVTGLEPVNGFWNSDHAGVFSALRLRRVWPHAFEVQP* |
| Ga0068861_1000464026 | 3300005719 | Switchgrass Rhizosphere | DFDHQVDHVMTNDPADVTLRDSEVTGLLPVNGFWNSDHAGLFSALKFAR* |
| Ga0075365_101406131 | 3300006038 | Populus Endosphere | QVSDFDHKVDHIMTNDPQHVGLVNSAVTGRQPINGFWDSDHAGLFSTLLFH* |
| Ga0066652_1004738001 | 3300006046 | Soil | MTRDPAEITLQNSSVSGIQPVNGFWDSDHAGLFSALRFSTH* |
| Ga0075417_105478491 | 3300006049 | Populus Rhizosphere | LTDAPTRVNLVRSSVTGRFPVNGFWSSDHAGIASVLGVGSG* |
| Ga0099972_122272241 | 3300006467 | Marine | ITDFDHQVDHIMTRDPHNVFLRHSEVTGLEPVNGFWNSDHAGVFSALMLRRVWPHGFEEQP* |
| Ga0074054_116853542 | 3300006579 | Soil | TRDPAEISLQSSDVTGLLPVNGFWDSDHAGLFSALRFAH* |
| Ga0079222_108228883 | 3300006755 | Agricultural Soil | EGDDEGENDHQVDHIMTRDPEVVTLQDSGVSGIQPVNGFWDSDHAGLFSALRFDD* |
| Ga0079221_104912472 | 3300006804 | Agricultural Soil | AGGSIADFDHQVDHVMTNEPSITLERSAVTGLLPVNGFWDSDHAGLFSALRFPR* |
| Ga0079221_112275261 | 3300006804 | Agricultural Soil | NHKVDHIMTDAPKQVKLLDSKVTGRSKTNGYWDSDHAGLFSALDLLS* |
| Ga0075431_1010204261 | 3300006847 | Populus Rhizosphere | FDHKVDHIMTDNPGEIGRVRQSVTGRKPRNGFWNSDHAGLFSVLKLR* |
| Ga0079219_100057901 | 3300006954 | Agricultural Soil | KVSDFDHQVDHVMTDTPKRIKLVKSLVTGRSPANGFWDSDHAGLFSTLSLG* |
| Ga0102947_11535102 | 3300007619 | Soil | ADFDHQVDHIMTRDPYQFFLRSSEITGLYPVDGFWNSDHAGVFSRLRFRR* |
| Ga0105243_114807162 | 3300009148 | Miscanthus Rhizosphere | DFNHQVDHVMTRDPKEIKLKASAVTGRQPVNGFWDSDHAGLFSALRFAH* |
| Ga0105242_121565971 | 3300009176 | Miscanthus Rhizosphere | DHKVDHIMTNDPHHVGLVDSAVTGLQPINGYWDSDHAGLFSTLLFH* |
| Ga0126313_112922612 | 3300009840 | Serpentine Soil | DHVMTRNPDEVVLKSSTVTGLLPVNGFWNSDHAGVFSALRFLD* |
| Ga0126304_105771101 | 3300010037 | Serpentine Soil | GGGGSVADFDHHIDHVMTRDPKKVKLISSAVTGREPVNGFWDSDHAGVFSSLWMLR* |
| Ga0126310_117410372 | 3300010044 | Serpentine Soil | GAGGSVADFDHQVDHVMTRDPKQVKLISSSVTGRSPVNGYWDSDHAGLFSSLWLLR* |
| Ga0126310_118135902 | 3300010044 | Serpentine Soil | GKLSDFDHKVDHVMTSSPKRVKLVKSTVPGRNPVAGFWPSDHAGLFSVLTLR* |
| Ga0126311_100267196 | 3300010045 | Serpentine Soil | FDHQVDHIMTRDPELIELRSSIVTGLQPVNDFWNSDHAGVFSSLVFDR* |
| Ga0134070_102340571 | 3300010301 | Grasslands Soil | NHQVDHVMTRDPKDVKLKASFVTGRQPVNGFWDSDHAGLYSSLKLRR* |
| Ga0134125_130942311 | 3300010371 | Terrestrial Soil | DPAKVLLRRSAVTGLQPVNGFWDSDHAGMFSSLEVLP* |
| Ga0105239_118843062 | 3300010375 | Corn Rhizosphere | QVDHVMTNDPAGIKLEDSGVTGLLPVNGFWNSDHAGLWSSLRFVH* |
| Ga0118731_1026184142 | 3300010392 | Marine | FDHQVDHIMTRDPYNVFLRHSEVTGLEPVNGFWNSDHAGVFSRLRLRR* |
| Ga0118731_1076048693 | 3300010392 | Marine | QVDHIMTRDPYNVLLRHSEVTGLEPVNGFWNSDHAGVFSALMLRRVSPFEVPP* |
| Ga0134122_120985451 | 3300010400 | Terrestrial Soil | HKVDHVMTDDPSQVRLVRSTITGRYPMDGYWGSDHAGLSSVLAFK* |
| Ga0134122_132584261 | 3300010400 | Terrestrial Soil | IDQVLTNDSEGIQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP* |
| Ga0118733_1069916511 | 3300010430 | Marine Sediment | DHQVDHIMTRDPYNVLLRHSEVTGLEPVNGFWNSDHAGVFSRLRLRR* |
| Ga0150985_1022216272 | 3300012212 | Avena Fatua Rhizosphere | VDHIMTADPKKVKLKTSAVTGRTPVNGFWDSDHAGLFSALTLK* |
| Ga0150985_1095904791 | 3300012212 | Avena Fatua Rhizosphere | QFDHKVDHIMTNDPGHVRRGRVAVTGRRPHNGFWDSDHAGLFSTLKFR* |
| Ga0157305_101146891 | 3300012891 | Soil | AEMDHKVDHIMTNAPKKVKLLSSTVTGRTMQNGYWNSDHAGLFSALRFRD* |
| Ga0157292_100180381 | 3300012900 | Soil | SDPADVSLAGATVTGLQPVNGFWDSDHAGVFSALRFSR* |
| Ga0157298_101442752 | 3300012913 | Soil | DHVLTDDPDGVQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP* |
| Ga0157297_103712791 | 3300012914 | Soil | DGGEVADFDHHIDHVLTNDPDGVQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP* |
| Ga0157297_104133021 | 3300012914 | Soil | DFDHQVDHVMTNDPGRIRLERSEVTGLLPVNGFWDSDHAGVFSALRFQG* |
| Ga0164243_103904511 | 3300012940 | Compost | QFDHKVDHIMTRDPKQVKEVNSSVTGRSPQNGFWDSDHAGLFSTLKILP* |
| Ga0164241_102754381 | 3300012943 | Soil | GGSVADFDHQVDHVMTNDPSDITLRSSAVTGLLPVNGFWNSDHAGVFSSLNLR* |
| Ga0164298_106084541 | 3300012955 | Soil | HHIDQVLTNDSGGIKLLNSEVTGLLPVNGFWDSDHAGVFSSLEILP* |
| Ga0164306_112608111 | 3300012988 | Soil | GITLLSSAVTGRTPVNGFWDSDHAGVFSSLEVLP* |
| Ga0157370_106721733 | 3300013104 | Corn Rhizosphere | TRNPTEVGLKESTVTGLLPVNGFWDSDHAGLFSALLFAH* |
| Ga0157372_128893152 | 3300013307 | Corn Rhizosphere | GGKVTDFDHQVDHVMTDTPKKIKLVKSVVTGRSPANGFWDSDHAGLFSTLSLG* |
| Ga0120158_101339933 | 3300013772 | Permafrost | IITADRGSVSDFDHQVDHVLTNDPQIALASSSVTGRAPVNGYWDSDHAGLFSLLNIRR* |
| Ga0075313_10626181 | 3300014267 | Natural And Restored Wetlands | GSVADFDHQVDHIMTRDPGKVALRSSTVTGLLPVNGFWDSDHAGLFSALRFVH* |
| Ga0163163_124212491 | 3300014325 | Switchgrass Rhizosphere | QFDHKVDHIMTRDPKQVKEVNSSVTGRSPQNGFWDSDHAGLFSTLKIG* |
| Ga0132255_1019936351 | 3300015374 | Arabidopsis Rhizosphere | MTRDPKEVKLKSSFVTGRQPANGFWDSDHAGLFSALRFAH* |
| Ga0132255_1062512562 | 3300015374 | Arabidopsis Rhizosphere | QVSQFDHKVDHVMTDDPAHIKLVRSTVTGRHPYNGWWGSDHAGTASVLNFK* |
| Ga0187776_110933941 | 3300017966 | Tropical Peatland | VLTVAGGGKRSDFDHKVDHIMTNAPSKIGLSESSLTGTRPMHGYWDSDHEGLFSSLTLP |
| Ga0184605_105458611 | 3300018027 | Groundwater Sediment | FDHLVDHVMTDDPTHVSLVRSTVTGRFPVNGFWDSDHAGIASALGVGFG |
| Ga0190269_112007114 | 3300018465 | Soil | DHKVDHVMTDDPAHVNLVRSTVTGRSPVNGFWDSDHAGIASALGVGFG |
| Ga0190274_116095001 | 3300018476 | Soil | ADFDHHIDHVLTDDPDGITLLEAIVTGRNPVNGFWDSDHAGGFSSLQVLP |
| Ga0190273_120907691 | 3300018920 | Soil | GSVADFDHQVDHVMTRDPKKVKLISSAVTGRQPVNGFWDSDHAGLYSSLWLLR |
| Ga0193738_10580051 | 3300020020 | Soil | GGSVADFDHHIDHVMTRDPKKVKLISSAVTGRQPVNGFWDSDHAGVFSSLWLLR |
| Ga0210392_109865932 | 3300021475 | Soil | ADFDHQVDHVMTNDPTDIELQGSAVTGLLPVNGFWSSDHTGLFSSLRFDD |
| Ga0222625_15664992 | 3300022195 | Groundwater Sediment | GSVSDFDHLVDHVMTDDPTHVSLVRSTVTGRFPVNGFWDSDHAGIASALSFGF |
| Ga0247746_10383721 | 3300022886 | Soil | ADFDHQVDHIMTRDPDQITLESSTVTGLLPVNGFWNSDHAGIFSSLRFR |
| Ga0247789_10023445 | 3300023266 | Soil | GGSVADFNHQVDHVMTRDPKEVKLKSSSVTGRQPLNGFWNSDHAGLFSALSFRK |
| Ga0179591_11848122 | 3300024347 | Vadose Zone Soil | MTNDPGGHRAADSEVTGLLPVNGFWDSDHAGLFSALRFER |
| Ga0207649_116244382 | 3300025920 | Corn Rhizosphere | TANPDEVTLKTSIVTGLDPVNGFWDSDHAGLFSALNFAK |
| Ga0207652_109538091 | 3300025921 | Corn Rhizosphere | DHHIDHVMTDDPGGIQLVSSAVTGLLPVNGFWDSDHAGVFSSLEILP |
| Ga0207681_102648923 | 3300025923 | Switchgrass Rhizosphere | VMTRDPKDVKLKSSSVTGRQPVNGFWDSDHAGLFSALRFAH |
| Ga0207686_101047211 | 3300025934 | Miscanthus Rhizosphere | SEADFDHQVDHVMTRDPEEIALQSSSVSGIQPVNGFWNSDHAGLFSALRFAH |
| Ga0207709_114225511 | 3300025935 | Miscanthus Rhizosphere | KEIKLKASAVTGRQPVNGFWDSDHAGLFSALRFAH |
| Ga0207661_108978721 | 3300025944 | Corn Rhizosphere | DFDHHIDHVLTDDPDGVQLLNSEVTGRLPVNGFWDSDHAGVFSSLEILP |
| Ga0207708_120252401 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SSLLAVGEGGSEADFDHQVDHIMTRDPEEITLESSAVSGIQPVNGYWNSDHAGLFSALRF |
| Ga0209113_10120203 | 3300027517 | Forest Soil | SQFNHKVDHIMTSDPKQIKLVKSSVTGRKPTNGFWDSDHAGLFSELGIHP |
| Ga0207981_10309331 | 3300027560 | Soil | FNHQVDHVMTRDPKEVKLTSSFVTGRQPVRGFWDSDHAGLYSSLQLRQ |
| Ga0209177_101303961 | 3300027775 | Agricultural Soil | DHQVDHVMTNAPSIVRLVSSSVTGRTMVNGFWDSDHAGLVSELHIR |
| Ga0209382_115614572 | 3300027909 | Populus Rhizosphere | VLTAGGGGSVSDFDHKVDHVLTDAPTRVNLVRSSVTGRFPVNGFWSSDHAGI |
| Ga0268264_122024292 | 3300028381 | Switchgrass Rhizosphere | HTVDHVMTDTPKKIKLVTSKVTGLTKAKTGWWDSDHAGVFSSLLILR |
| Ga0247818_110712512 | 3300028589 | Soil | ANGGGSVSDFDHHVDHILTNAPQAVGLVHSSVTGRQPVNGFWDSDHAGVFSNLLVH |
| Ga0307288_104705422 | 3300028778 | Soil | AGGGGSIADFDHKVDHIMTNAPNKVKLKSSTVLGRNPVNGFWPSDHAGLFSQLAFP |
| Ga0307299_103095662 | 3300028793 | Soil | DFNHQVDHVMTNAPRKVKLVSSSVTGRKPANGFWDSDHAGLFSRLSLP |
| Ga0307278_103658591 | 3300028878 | Soil | TRDGGGSRGDFDHQVDHVMTNAPNEVELVNSSVTGLYPVNGFWNSDHAGVFSELRLP |
| Ga0268242_10971291 | 3300030513 | Soil | VDHVLTNAPALITPQSSLVTGLQPVNGFWNSDHAGVFSALRFHR |
| Ga0299914_116200861 | 3300031228 | Soil | QVDHILTRDPKTVTLKSSAVTGLLPVNGFWSSDHAGVYSALGFTR |
| Ga0308176_113722772 | 3300031996 | Soil | DFDHKVDHVMTNKPNKVKLVKSSVLGLQPVNGFWDSDHAGLFSSLKLFR |
| Ga0315912_100145359 | 3300032157 | Soil | DHVMTDDPTHVTLLESNVTGLFPVNGFWSSDHAGINSALRLSLLP |
| Ga0335077_102518152 | 3300033158 | Soil | VSDFDHKVDHVMTNAPRRIKLVSSSVTGRRPVNGFWDSDHAGLFSVLSLPR |
| Ga0247829_111679721 | 3300033550 | Soil | GGGSVSDFDHHVDHILTNAPQAVGLVHSSVTGRQPVNGFWDSDHAGVFSNLLVH |
| Ga0334944_025037_1_156 | 3300034009 | Sub-Biocrust Soil | VADFDHQVDHVMTDDPSGITLERSEVTGLQPVNGFWDSDHAGVYSALRFTR |
| ⦗Top⦘ |