| Basic Information | |
|---|---|
| Family ID | F080038 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 45 residues |
| Representative Sequence | DVAFYAPKEIYKNQKTVDNVRALRQLSSDRLHQEMVNQQYK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.17 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (93.913 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.870 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.696 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.348 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF06941 | NT5C | 4.35 |
| PF14235 | DUF4337 | 2.61 |
| PF13609 | Porin_4 | 0.87 |
| PF00497 | SBP_bac_3 | 0.87 |
| PF10902 | WYL_2 | 0.87 |
| PF09293 | RNaseH_C | 0.87 |
| PF01177 | Asp_Glu_race | 0.87 |
| PF00293 | NUDIX | 0.87 |
| PF13439 | Glyco_transf_4 | 0.87 |
| PF01176 | eIF-1a | 0.87 |
| PF00768 | Peptidase_S11 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 4.35 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.26 % |
| Unclassified | root | N/A | 1.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10047786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1409 | Open in IMG/M |
| 3300002408|B570J29032_109493184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300002476|metazooDRAFT_10775835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300002835|B570J40625_100024109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10021 | Open in IMG/M |
| 3300002835|B570J40625_100749512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
| 3300002835|B570J40625_101525131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300003806|Ga0007864_1002764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1765 | Open in IMG/M |
| 3300004112|Ga0065166_10481668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300005581|Ga0049081_10023968 | All Organisms → Viruses → Predicted Viral | 2317 | Open in IMG/M |
| 3300006484|Ga0070744_10091424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300007539|Ga0099849_1246607 | Not Available | 658 | Open in IMG/M |
| 3300007541|Ga0099848_1081197 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300007708|Ga0102859_1271588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300008108|Ga0114341_10484464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300008113|Ga0114346_1007447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10138 | Open in IMG/M |
| 3300008267|Ga0114364_1051179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1481 | Open in IMG/M |
| 3300008962|Ga0104242_1056533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300008996|Ga0102831_1229703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300009124|Ga0118687_10175560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300009155|Ga0114968_10168638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1287 | Open in IMG/M |
| 3300009158|Ga0114977_10576724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300009159|Ga0114978_10133999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
| 3300009159|Ga0114978_10512584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300009159|Ga0114978_10547408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300009159|Ga0114978_10777898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300009181|Ga0114969_10638908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300009182|Ga0114959_10336525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300009183|Ga0114974_10280890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300009187|Ga0114972_10544532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300009187|Ga0114972_10779784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300009684|Ga0114958_10433898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300010156|Ga0068873_1030131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300010158|Ga0114960_10214920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300010354|Ga0129333_10132900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2288 | Open in IMG/M |
| 3300010354|Ga0129333_11605969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300010885|Ga0133913_10705597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2639 | Open in IMG/M |
| 3300011995|Ga0153800_1002128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1801 | Open in IMG/M |
| 3300012017|Ga0153801_1036602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300012348|Ga0157140_10001484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2702 | Open in IMG/M |
| 3300013004|Ga0164293_10591027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300013005|Ga0164292_10579652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300013372|Ga0177922_10139530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300017697|Ga0180120_10152852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300017754|Ga0181344_1029312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1686 | Open in IMG/M |
| 3300020048|Ga0207193_1343835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300020151|Ga0211736_10233468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300020151|Ga0211736_10576944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1318 | Open in IMG/M |
| 3300020151|Ga0211736_11026194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300020159|Ga0211734_11027616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1292 | Open in IMG/M |
| 3300020160|Ga0211733_10153434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300020160|Ga0211733_10719465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300020161|Ga0211726_10721842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300020161|Ga0211726_10722313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300020162|Ga0211735_11348305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300020498|Ga0208050_1006502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1405 | Open in IMG/M |
| 3300020513|Ga0208090_1038161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300020540|Ga0208227_1042966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300020554|Ga0208599_1033817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300020562|Ga0208597_1018850 | All Organisms → Viruses → Predicted Viral | 1615 | Open in IMG/M |
| 3300020573|Ga0208485_1085368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300020716|Ga0214207_1014493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300021140|Ga0214168_1135259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300021962|Ga0222713_10757382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300022179|Ga0181353_1154008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300022752|Ga0214917_10148088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1247 | Open in IMG/M |
| 3300023179|Ga0214923_10204508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
| 3300023311|Ga0256681_12521805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300024514|Ga0255177_1034308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300024548|Ga0256342_1137755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300025357|Ga0208383_1024045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300025655|Ga0208795_1024400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1963 | Open in IMG/M |
| 3300025872|Ga0208783_10354437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300027162|Ga0255212_1057789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300027659|Ga0208975_1081523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300027697|Ga0209033_1250048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300027741|Ga0209085_1150491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300027754|Ga0209596_1269355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300027759|Ga0209296_1065637 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300027759|Ga0209296_1242966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300027760|Ga0209598_10003771 | Not Available | 11351 | Open in IMG/M |
| 3300027760|Ga0209598_10195693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300027782|Ga0209500_10193298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300027804|Ga0209358_10566022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300027969|Ga0209191_1110496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
| 3300027969|Ga0209191_1209673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300028286|Ga0256331_1104405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300028394|Ga0304730_1067465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1663 | Open in IMG/M |
| 3300031758|Ga0315907_10046326 | All Organisms → Viruses → Predicted Viral | 3841 | Open in IMG/M |
| 3300031758|Ga0315907_10395213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300031857|Ga0315909_10111278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2336 | Open in IMG/M |
| 3300031963|Ga0315901_10901835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300032050|Ga0315906_10972586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300032092|Ga0315905_10807894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300032116|Ga0315903_10188705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1845 | Open in IMG/M |
| 3300032116|Ga0315903_10247309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1544 | Open in IMG/M |
| 3300032665|Ga0316221_1136192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300033984|Ga0334989_0533709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300034018|Ga0334985_0012348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6745 | Open in IMG/M |
| 3300034018|Ga0334985_0665319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300034018|Ga0334985_0673670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300034019|Ga0334998_0662414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300034062|Ga0334995_0704705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300034064|Ga0335001_0455111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300034066|Ga0335019_0326651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300034082|Ga0335020_0581875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300034093|Ga0335012_0591017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300034104|Ga0335031_0204403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1335 | Open in IMG/M |
| 3300034105|Ga0335035_0494241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300034106|Ga0335036_0445157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300034107|Ga0335037_0276087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300034107|Ga0335037_0312777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
| 3300034108|Ga0335050_0474090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300034120|Ga0335056_0464106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300034121|Ga0335058_0346060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300034121|Ga0335058_0405086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.48% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.48% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.48% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.61% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.61% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.74% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.87% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.87% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.87% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.87% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.87% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020540 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300024548 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027162 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100477864 | 3300000756 | Freshwater And Sediment | YAPKEIYKNQVNVDNARVLRQLSSDRLHQDLVNLQYK* |
| B570J29032_1094931841 | 3300002408 | Freshwater | AFYAPKEIYKGQKNVDNVRALRQMSSDRLHQEMVNQQYKRN* |
| metazooDRAFT_107758351 | 3300002476 | Lake | KEIYRNQRIVDNARTQRLLSGASDRLHQDLVNSQYNLGK* |
| B570J40625_1000241091 | 3300002835 | Freshwater | LALKDGQLYKPEEIYKNQVTVDNVRALRQLSSDRVHQEMVNQQYRN* |
| B570J40625_1007495123 | 3300002835 | Freshwater | YAPKEIYKNQVNVDNARTLRGLQRGSDSLHQEMVNQQYRLGK* |
| B570J40625_1015251313 | 3300002835 | Freshwater | VAFYAPREIYRNQVNVDNARLLRGLGSDRLHQEMVNQQYKTGN* |
| Ga0007864_10027641 | 3300003806 | Freshwater | AAFYAPKEIYRNQSTVDNSRALRKLSSDSLFEKMVELQYKESKQ* |
| Ga0065166_104816681 | 3300004112 | Freshwater Lake | VAFYAPKEIYKNQKVVDNARTLRGLQGGSDKLHQEMVNQQYK* |
| Ga0049081_100239687 | 3300005581 | Freshwater Lentic | ALADAPFYAPKEIYRNQVNVDNVRVLRQLSSDRLHQDLVNLQYK* |
| Ga0070744_100914241 | 3300006484 | Estuarine | YAPKEIYRNQINVDNVRLLRSLGNDRLHQEMVNQQYKLRE* |
| Ga0099849_12466073 | 3300007539 | Aqueous | KEIYKGQVNVDNRRAMRGLGSDRLHQEMVRQQYQ* |
| Ga0099848_10811971 | 3300007541 | Aqueous | YRGQVNVDNARALRGLGTDRLHQEMVEQQYNRGVR* |
| Ga0102859_12715881 | 3300007708 | Estuarine | APKEIYRNQVNVDNVRVLRQLSSDKLHQDLVNLQYK* |
| Ga0114341_104844641 | 3300008108 | Freshwater, Plankton | QAYSTMMPDVAFYAPKEIYKNQVNVDNVRVLRQLSSDRLHQDLVNLQYK* |
| Ga0114346_100744739 | 3300008113 | Freshwater, Plankton | YFVMMPDVAFYAPKEIYKNQKTVDNVRALRQLSSDRLHQEMVNQQYK* |
| Ga0114364_10511791 | 3300008267 | Freshwater, Plankton | QGYQAYSMMMPDVAFYAPREIYRNQVNVDNVRLLRGLASDRLHQELVNLQYK* |
| Ga0104242_10565332 | 3300008962 | Freshwater | FVMMPDVAFYAPKEIYKNQTTVDNVRALRQLSSDRLHQQMVDQQYK* |
| Ga0102831_12297031 | 3300008996 | Estuarine | QGYGNYLNLALRDASFYEPKEVYRNQTVIDNVRVLRGLGSDQKHQDLVNLQYK* |
| Ga0118687_101755601 | 3300009124 | Sediment | DASFYAPKEIYKGQVNVDNRRAMRALGSDRLHQEMVGQQYRR* |
| Ga0114968_101686383 | 3300009155 | Freshwater Lake | DVAFYAPKEIYKNQVNVDNARVLRQLSSDKLHQDLVNLQYK* |
| Ga0114977_105767242 | 3300009158 | Freshwater Lake | MMPDVAFYAPKEIYRNQKTVDNVRALRQMSSDRLHQQMVDQQYK* |
| Ga0114978_101339995 | 3300009159 | Freshwater Lake | VSIKDSPFYDIKEVYKNQVNVDNVRLLRSLGSDRLHQEMVNQQYKVGR* |
| Ga0114978_105125841 | 3300009159 | Freshwater Lake | AAFYTPKEIYRNQTTVDNARALRQLSSDRLHQQMIDQQYK* |
| Ga0114978_105474081 | 3300009159 | Freshwater Lake | KDVAFYKVEEVYKNQKTVDNMRLLRGLTTGSDRLHQEMINQQYKN* |
| Ga0114978_107778981 | 3300009159 | Freshwater Lake | KEIYKNQTPVDNARALRQLSTDRLHQQMIEQQYRR* |
| Ga0114969_106389081 | 3300009181 | Freshwater Lake | YAPKEIYKNQVNVDNARVLRQLSSDKLHQDLINLQYKLRD* |
| Ga0114959_103365251 | 3300009182 | Freshwater Lake | PKEVYKNQKTVDNVRLLRGLTGGSDRLHQEMVDQQYKRGE* |
| Ga0114974_102808902 | 3300009183 | Freshwater Lake | QAYSMMMPDVAFYAPKEIYKNQVNVDNARVLRQLSSDRLHQDLVNSQYKLRQ* |
| Ga0114972_105445322 | 3300009187 | Freshwater Lake | TLKDASFYAPKEIYKNQRTVDNARALRVLSSDRLHQEMIDQQYKGK* |
| Ga0114972_107797842 | 3300009187 | Freshwater Lake | YRNQVNVDNARLLRALGSDKLHQDLVNLQYKQGE* |
| Ga0114958_104338981 | 3300009684 | Freshwater Lake | KMYEPREIYKNQKTVDNARALRQLSTDRLHQQMIEQQYRR* |
| Ga0068873_10301312 | 3300010156 | Freshwater Lake | AFYAPKEIYKNQKIIDNTRVLRQMSSDKLHQDMINLQYK* |
| Ga0114960_102149201 | 3300010158 | Freshwater Lake | GFDVYSITVMKDGTFYAPKDIYGNQKTIDNARALRSLSSDRLHQEMVDQQYKGK* |
| Ga0129333_101329003 | 3300010354 | Freshwater To Marine Saline Gradient | MVALTDVAFYAPKEIYRNQKNVDNARALRQLASDRLHQQMVDQQYLPR* |
| Ga0129333_116059691 | 3300010354 | Freshwater To Marine Saline Gradient | FYAPKEIYRSQKTVDNARALRQLASDRLHQEMVDQQYLPR* |
| Ga0133913_107055971 | 3300010885 | Freshwater Lake | AVSIKDSPFYDIKEVYKNQVNVDNVRLLRSLGSDRLHQEMVNQQYKVGR* |
| Ga0153800_10021281 | 3300011995 | Freshwater | FYAPKEIYRNQKTVDNVRALRQMSSDRLHQQMVDQQYK* |
| Ga0153801_10366021 | 3300012017 | Freshwater | PDASFYAPREIYRNQVNVDNVRLLRGLASDRLHQELVNLQYK* |
| Ga0157140_100014848 | 3300012348 | Freshwater | VLRDASFYEPKEVYKNQTVVDNIRVLRGLGSDQKHRDLVNLQYK* |
| Ga0164293_105910273 | 3300013004 | Freshwater | VDIARMATQPQGYQAYSMMMPDVAFYAPREIYRNQVNVDNARVLHQLSSDRLHQDLVNLQYK* |
| Ga0164292_105796522 | 3300013005 | Freshwater | SQYFFMMPDVAFYAPKEIYRNQTVTDNVRLLRGLGSDRLHQEMVNRQYKLGE* |
| Ga0177922_101395302 | 3300013372 | Freshwater | YAPKEIYKNQVNVDNARVLRQLSSDKLHQDLVNLQYK* |
| Ga0180120_101528521 | 3300017697 | Freshwater To Marine Saline Gradient | AQFYAARDIYKGQRTVDNARALRGLGTDRLHQEMINQQYGR |
| Ga0181344_10293121 | 3300017754 | Freshwater Lake | ITRMAIQPAGYQAYAVAMPDASFYAPREIYRNQVNVDNVRLLRGLASDRLHQELVNLQYK |
| Ga0207193_13438352 | 3300020048 | Freshwater Lake Sediment | MMPDVAFYAPKEIYKNQKTVDNARALRQMSSDRLHQEMINQQYKIGN |
| Ga0211736_102334681 | 3300020151 | Freshwater | AFYAPKEIYKNQTNVDNVRLLRSLGSDRLHQEMVNQQYKLGQ |
| Ga0211736_105769441 | 3300020151 | Freshwater | AFYAPKEIYKNQVNVDNVRLLRGLGSDRLHREMVNQQYAPRN |
| Ga0211736_110261941 | 3300020151 | Freshwater | ANYSQYFFMLPDVAFYAPKEIYRNQKTVDNVRALRQMSSDSLHQRMVDQQYK |
| Ga0211734_110276161 | 3300020159 | Freshwater | QAYSFALADAPFYAPKEIYRNQVNVDNVRVLRQLSSDRLHQEMVNQQYAPRN |
| Ga0211733_101534341 | 3300020160 | Freshwater | FTIKDSPFYDIKEVYKNQVNVDNARALRQMSSDRLHQQLINLQYK |
| Ga0211733_107194651 | 3300020160 | Freshwater | MAIKDTPFYEIKEVYKNQVNVDNVRVLRGLGSDRLHQELVNQQYKIRN |
| Ga0211726_107218421 | 3300020161 | Freshwater | DVAFYAPKEIYRNQKTVDNVRALRQMSSDKLHQQMVDQQYK |
| Ga0211726_107223134 | 3300020161 | Freshwater | DVAFYEPKEVYKNQKTVDNARALRQLSSDRLHQEMINQQYKLGR |
| Ga0211735_113483051 | 3300020162 | Freshwater | AGYQAYSFALADAPFYAPKEIYRNQVNVDNVRVLRQLSSDKLHQDLVNLQYK |
| Ga0208050_10065021 | 3300020498 | Freshwater | LSRMAIQPAGYQAYSMIMPDVAFYAPREIYRNQVNVDNTRLLRQLSSDRLHQDLVNLQYK |
| Ga0208090_10381612 | 3300020513 | Freshwater | LALLDAKFYATREIYGKQTTVDNQRALRQLSSDRLHQQMVNQQYR |
| Ga0208227_10429662 | 3300020540 | Freshwater | YTPKEIYKNQKTVDNARALRQLSSDKLHQDMVNQQYK |
| Ga0208599_10338171 | 3300020554 | Freshwater | ASIATQPNGYQSYSMMMPDVAFYAPKEIYKNQVNVDNARVLRGLGSDRLHQEMVNQQYRLGK |
| Ga0208597_10188501 | 3300020562 | Freshwater | YFTAIPDVAFYTPKEIYKNQKTVDNARALRQLSSDKLHQDMVNQQYK |
| Ga0208485_10853683 | 3300020573 | Freshwater | SMMMPDVAFYAPKEIYKNQVNVDNARVLRGLGSDRLHQEMVNQQYRLGK |
| Ga0214207_10144931 | 3300020716 | Freshwater | ALKDASFYAPKEVYKNQKTVDNVRALRQLANDNKHRELVELQYVR |
| Ga0214168_11352591 | 3300021140 | Freshwater | YSFALADAPFYAPKEIYRNQVNVDNVRVLRQLSSDKLHQDLVNLQYK |
| Ga0222713_107573822 | 3300021962 | Estuarine Water | APKEIYRNQVNVDNVRVLRQLSSDRLHQDLVNLQYK |
| Ga0181353_11540081 | 3300022179 | Freshwater Lake | APKEIYKNQKTVDNARTLRGLQGGSDRLHQEMVNQQYK |
| Ga0214917_101480881 | 3300022752 | Freshwater | YNVSLKDVAFYAPKEIYRNQKTVDNVRALRSLASDRLHQEMVDQQYRR |
| Ga0214923_102045083 | 3300023179 | Freshwater | LTDVAFYAPKEIYRNQRNVDNARALRQLASDRLHQQMVDQQYLPR |
| Ga0256681_125218051 | 3300023311 | Freshwater | SEAIYKDQRTVDNARALRQLSSDRLHQEMIAQQYRR |
| Ga0255177_10343081 | 3300024514 | Freshwater | VGFNSYMIALNDAAFYSPKEIYRNQKTVDNVRALRQLASDKLHQEMVDLQYRR |
| Ga0256342_11377551 | 3300024548 | Freshwater | DANFYAPKEIYRNQRTVDNARALRQLASDRLHQQMVDQQYLPR |
| Ga0208383_10240451 | 3300025357 | Freshwater | TLKDASFYEPKEIYRNQTTIDNVRALRQMASDRVYQEMLDMQYKIGEXHDRRN |
| Ga0208795_10244001 | 3300025655 | Aqueous | PKEIYKNQTTVDNATALRLLNGKSDKLHEELVNQQYGR |
| Ga0208783_103544371 | 3300025872 | Aqueous | NFNLSNIAFYEPKEIYKNQKVIDNARALRQLSSDRLHQEMVEQQYRR |
| Ga0255212_10577891 | 3300027162 | Freshwater | YAPKEIYRGQKNVDNARALRQLGSDRLHQEMVEQQYRR |
| Ga0208975_10815233 | 3300027659 | Freshwater Lentic | ADAPFYAPKEIYRNQVNVDNVRVLRQLSSDRLHQDLVNLQYK |
| Ga0209033_12500481 | 3300027697 | Freshwater Lake | FDSYMVALTDASFYSPKEIYRNQKTVDNVRALRQLASDRLHQQMVDQQYLPR |
| Ga0209085_11504911 | 3300027741 | Freshwater Lake | EPKEVYKNQKTVDNVRLLRGLTGGSDRLHQEMVDQQYKRGE |
| Ga0209596_12693551 | 3300027754 | Freshwater Lake | YAPKEIYKNQVNVDNARVLRQLSSDKLHQDLINLQYKLRD |
| Ga0209296_10656375 | 3300027759 | Freshwater Lake | MMPDVAFYAPKEIYKNQVNVDNARVLRQLSSDKLHQDLVNLQYK |
| Ga0209296_12429662 | 3300027759 | Freshwater Lake | QAYSMMMPDVAFYAPKEIYKNQVNVDNARVLRQLSSDRLHQDLVNSQYKLRQ |
| Ga0209598_100037711 | 3300027760 | Freshwater Lake | APKEIYKNQRTVDNARALRVLSSDRLHQEMIDQQYKGK |
| Ga0209598_101956933 | 3300027760 | Freshwater Lake | APKEIYKNQRTVDNARALRVLSSDRLHQEMIDQQYKVKN |
| Ga0209500_101932981 | 3300027782 | Freshwater Lake | YEPKEVYKNQKTVDNVQVLRQLSSDSLHKQMVDQQYKRGE |
| Ga0209358_105660221 | 3300027804 | Freshwater Lake | MVVPQGYASYTNLALRDANFYEPKEVYRNQQVVDNVRVLRGLGSDQKHRDLVNLQYK |
| Ga0209191_11104961 | 3300027969 | Freshwater Lake | APKEIYRNQVNVDNVRLLRGLGSDRLHQDLVNQQYKLRN |
| Ga0209191_12096731 | 3300027969 | Freshwater Lake | KEIYKNQKVVDNARTLRGLQGGSDKLHQDMVNQQYK |
| Ga0256331_11044052 | 3300028286 | Freshwater | MVALTDASFYSPKEIYRNQKTFDNVRALRQLASDRLHQQMVDQQYLPR |
| Ga0304730_10674651 | 3300028394 | Freshwater Lake | YSMALPDVAFYAPREIYRNQVNVDNARVLRQLSSDRLHQDLVNLQYK |
| Ga0315907_1004632611 | 3300031758 | Freshwater | NAYNIALKDVAFYAPKEIYRNQKTIDNARALRQLASDKLHQEMVDMQYRR |
| Ga0315907_103952134 | 3300031758 | Freshwater | FYAPKEIYKNQKTVDNVRALRQLSSDRLHQEMVNQQYK |
| Ga0315909_101112781 | 3300031857 | Freshwater | DVAFYAPKEIYKNQKTVDNVRALRQLSSDRLHQEMVNQQYK |
| Ga0315901_109018352 | 3300031963 | Freshwater | FYAPKEIYKGQKTVDNARALRQLSSDTLHQRMIEQQYNRR |
| Ga0315906_109725863 | 3300032050 | Freshwater | QFYAPREIYRNQRTVDNARALRQLTNDGRHREMVEQQYKRN |
| Ga0315905_108078941 | 3300032092 | Freshwater | TQPQGYQAYSFALADAPFYAPKEIYRNQVNVDNVRVLRQLSSDRLHQDLVNLQYK |
| Ga0315903_101887051 | 3300032116 | Freshwater | SILRDVAFYKPDEIYKGQRTVDNVRALRQLSSDRLHQEMVNQQYRD |
| Ga0315903_102473095 | 3300032116 | Freshwater | APFYAPKEIYRNQVNVDNVRVLRQLSSDKLHQDLVNLQYK |
| Ga0316221_11361923 | 3300032665 | Freshwater | LNFTLKDAAFYAPKEIYRNQSTVDNSRALRKLSSDSLFEKMVELQYKESKQ |
| Ga0334989_0533709_1_108 | 3300033984 | Freshwater | PKEIYRNQKTVDNVRALRQMSSDRLHQQMVDQQYK |
| Ga0334985_0012348_6633_6743 | 3300034018 | Freshwater | APKEIYRNQVNVDNARVLRQLSSDRLHQELVNLQYK |
| Ga0334985_0665319_3_128 | 3300034018 | Freshwater | AFYAPKEIYKNQKVVDNARTLRGLQGGSDRLHQEMVNQQYK |
| Ga0334985_0673670_407_541 | 3300034018 | Freshwater | MMPDVAFYAPKEIYKNQKTVDNVRALRQLSSDRLHQEMVNQQYK |
| Ga0334998_0662414_27_170 | 3300034019 | Freshwater | MIPDVAFYAPKEIYKNQKTIDNARALRLLSSDRLHQQMIDKQYKLGE |
| Ga0334995_0704705_403_567 | 3300034062 | Freshwater | QPPGYQAYSMMMPDVAFYAPKEIYRNQVNVDNVRVLRQLSSDRLHQDLVNLQYK |
| Ga0335001_0455111_8_181 | 3300034064 | Freshwater | MATQPQGYQAYSFALADAPFYAPKEIYRNQVNVDNVRVLRQLSSDKLHQDLVNLQYK |
| Ga0335019_0326651_842_955 | 3300034066 | Freshwater | YAPKEIYKNQKTVDNVRALRQLSSDRLHQEMVNQQYK |
| Ga0335020_0581875_3_176 | 3300034082 | Freshwater | IARQPAGYQTYSVAMPDVAFYAPKEIYRNQVNVDNVRLLRGLSSDRLHQQMIDMQYK |
| Ga0335012_0591017_26_199 | 3300034093 | Freshwater | MATQPQGYQAYSMMMPDVAFYAPKEIYRNQVNVDNVRVLRQLSSDKLHQDLVNLQYK |
| Ga0335031_0204403_1221_1334 | 3300034104 | Freshwater | YATREIYGRQTTVDNQRALRQLSSDRLHQQMVNQQYK |
| Ga0335035_0494241_543_671 | 3300034105 | Freshwater | PDVAFYAPREIYRNQVNVDNARVLRQLSSDRLHQELVNLQYK |
| Ga0335036_0445157_1_150 | 3300034106 | Freshwater | SQYFFMLQDVAFYAPKEIYKNQKTVDNVRALRQMSSDKLHQDLVNLQYK |
| Ga0335037_0276087_664_798 | 3300034107 | Freshwater | MLQDVAFYAPKEIYKNQKTVDNVRALRQMSSDKLHQDLVNLQYK |
| Ga0335037_0312777_688_852 | 3300034107 | Freshwater | QPANYAQYFTAIPDVAFYTPKEIYKNQKTVDNARALRQLSSDKLHQDMVNQQYK |
| Ga0335050_0474090_365_541 | 3300034108 | Freshwater | SIAKQPANYAQYFVMMPDVAFYAPKEIYRNQKTVDNVRALRQMSSDKLHQDLVNLQYK |
| Ga0335056_0464106_547_672 | 3300034120 | Freshwater | DAPFYAPKEIYRNQVNVDNVRVLRQLSSDRLHQDLVNLQYK |
| Ga0335058_0346060_723_857 | 3300034121 | Freshwater | DVAFYAPKEIYRNQKNVDNTRLLRQLASDAKHQQMVNLQYGEKQ |
| Ga0335058_0405086_619_753 | 3300034121 | Freshwater | MMPDVAFYAPKEIYRNQKTVDNVRALRQMSSDKLHQDMVNQQYK |
| ⦗Top⦘ |