| Basic Information | |
|---|---|
| Family ID | F080027 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | EIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 99.13 % |
| % of genes from short scaffolds (< 2000 bps) | 86.96 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (69.565 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (27.826 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.348 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.696 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 50.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 1.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.00 % |
| Unclassified | root | N/A | 20.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109245902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300002408|B570J29032_109316319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300003430|JGI25921J50272_10024416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1576 | Open in IMG/M |
| 3300005517|Ga0070374_10255734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300005517|Ga0070374_10376193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300005527|Ga0068876_10280192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300005581|Ga0049081_10099229 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300005662|Ga0078894_10672017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300005662|Ga0078894_10968027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300006484|Ga0070744_10142078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300006484|Ga0070744_10207696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300006639|Ga0079301_1125075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300007547|Ga0102875_1134875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300007548|Ga0102877_1166483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300007551|Ga0102881_1156163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300007551|Ga0102881_1230577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300007561|Ga0102914_1096570 | Not Available | 923 | Open in IMG/M |
| 3300007562|Ga0102915_1312523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300007606|Ga0102923_1067247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
| 3300007624|Ga0102878_1039355 | Not Available | 1460 | Open in IMG/M |
| 3300007627|Ga0102869_1211511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300007629|Ga0102895_1032835 | Not Available | 1321 | Open in IMG/M |
| 3300007632|Ga0102894_1112858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300007632|Ga0102894_1169378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300007634|Ga0102901_1101619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300007692|Ga0102823_1129615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300008107|Ga0114340_1260920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300008111|Ga0114344_1047973 | All Organisms → Viruses → Predicted Viral | 1652 | Open in IMG/M |
| 3300008116|Ga0114350_1072323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2206 | Open in IMG/M |
| 3300008116|Ga0114350_1181343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300008117|Ga0114351_1278943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300008259|Ga0114841_1176548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300008261|Ga0114336_1152155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
| 3300008261|Ga0114336_1334529 | Not Available | 550 | Open in IMG/M |
| 3300008262|Ga0114337_1157811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
| 3300008266|Ga0114363_1189581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300008996|Ga0102831_1008645 | Not Available | 3648 | Open in IMG/M |
| 3300008996|Ga0102831_1104267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300008996|Ga0102831_1130779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
| 3300008999|Ga0102816_1255385 | Not Available | 553 | Open in IMG/M |
| 3300009050|Ga0102909_1102013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300009051|Ga0102864_1205051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300009079|Ga0102814_10217805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300009079|Ga0102814_10390612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300009079|Ga0102814_10508935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300009155|Ga0114968_10699142 | Not Available | 531 | Open in IMG/M |
| 3300009161|Ga0114966_10551440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300009164|Ga0114975_10050154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2460 | Open in IMG/M |
| 3300009180|Ga0114979_10684631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300009184|Ga0114976_10457419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300009419|Ga0114982_1082475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300010309|Ga0102890_1006786 | All Organisms → Viruses → Predicted Viral | 2329 | Open in IMG/M |
| 3300010374|Ga0114986_1044331 | Not Available | 810 | Open in IMG/M |
| 3300010885|Ga0133913_12152923 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300011010|Ga0139557_1018495 | Not Available | 1291 | Open in IMG/M |
| 3300012716|Ga0157605_1141404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
| 3300017766|Ga0181343_1195336 | Not Available | 555 | Open in IMG/M |
| 3300020048|Ga0207193_1600715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300020205|Ga0211731_11255587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3431 | Open in IMG/M |
| 3300020498|Ga0208050_1001141 | All Organisms → Viruses → Predicted Viral | 3807 | Open in IMG/M |
| 3300020519|Ga0208223_1027676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300020552|Ga0207940_1029357 | Not Available | 847 | Open in IMG/M |
| 3300020559|Ga0208083_1038449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300020572|Ga0207909_1030483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300021141|Ga0214163_1066373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
| 3300024343|Ga0244777_10067177 | Not Available | 2301 | Open in IMG/M |
| 3300024343|Ga0244777_10690188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300024346|Ga0244775_10528824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300024346|Ga0244775_11348219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300024483|Ga0255224_1084125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300027130|Ga0255089_1025175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
| 3300027139|Ga0255082_1027792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300027141|Ga0255076_1027850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
| 3300027142|Ga0255065_1072870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300027148|Ga0255115_1095238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300027153|Ga0255083_1001613 | Not Available | 5658 | Open in IMG/M |
| 3300027222|Ga0208024_1036002 | Not Available | 961 | Open in IMG/M |
| 3300027232|Ga0208803_1079057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300027240|Ga0208444_1011435 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300027260|Ga0208027_1079149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300027281|Ga0208440_1114869 | Not Available | 526 | Open in IMG/M |
| 3300027320|Ga0208923_1064530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300027538|Ga0255085_1029054 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300027600|Ga0255117_1031448 | Not Available | 1142 | Open in IMG/M |
| 3300027659|Ga0208975_1195795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300027782|Ga0209500_10210427 | Not Available | 872 | Open in IMG/M |
| 3300027793|Ga0209972_10022355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3829 | Open in IMG/M |
| 3300027793|Ga0209972_10385058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300027797|Ga0209107_10497863 | Not Available | 541 | Open in IMG/M |
| 3300027797|Ga0209107_10533025 | Not Available | 517 | Open in IMG/M |
| 3300027804|Ga0209358_10044385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2657 | Open in IMG/M |
| 3300027892|Ga0209550_10154524 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300027892|Ga0209550_10571344 | Not Available | 668 | Open in IMG/M |
| 3300027892|Ga0209550_10593771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300027963|Ga0209400_1005322 | Not Available | 8870 | Open in IMG/M |
| 3300029697|Ga0256301_1023250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
| 3300031758|Ga0315907_10520539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300031857|Ga0315909_10449405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
| 3300032050|Ga0315906_10582781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
| 3300032093|Ga0315902_10110225 | All Organisms → Viruses → Predicted Viral | 2959 | Open in IMG/M |
| 3300032116|Ga0315903_10607446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
| 3300033996|Ga0334979_0528025 | Not Available | 635 | Open in IMG/M |
| 3300034012|Ga0334986_0156076 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300034018|Ga0334985_0729229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300034066|Ga0335019_0292585 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300034092|Ga0335010_0056358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2795 | Open in IMG/M |
| 3300034108|Ga0335050_0034908 | All Organisms → Viruses → Predicted Viral | 3230 | Open in IMG/M |
| 3300034116|Ga0335068_0282960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300034117|Ga0335033_0600181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300034272|Ga0335049_0231686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1280 | Open in IMG/M |
| 3300034272|Ga0335049_0728347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300034280|Ga0334997_0134373 | Not Available | 1650 | Open in IMG/M |
| 3300034355|Ga0335039_0033278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3164 | Open in IMG/M |
| 3300034356|Ga0335048_0299512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300034356|Ga0335048_0538997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 27.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.04% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.30% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.70% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.35% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.48% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.74% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.74% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.87% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010309 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3 | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020552 | Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020559 | Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027130 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027148 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027153 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027222 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027232 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027240 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027260 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1092459021 | 3300002408 | Freshwater | RSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE* |
| B570J29032_1093163194 | 3300002408 | Freshwater | YRSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE* |
| JGI25921J50272_100244161 | 3300003430 | Freshwater Lake | SAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE* |
| Ga0070374_102557346 | 3300005517 | Freshwater Lake | KPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE* |
| Ga0070374_103761931 | 3300005517 | Freshwater Lake | RPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE* |
| Ga0068876_102801921 | 3300005527 | Freshwater Lake | SAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE* |
| Ga0049081_100992291 | 3300005581 | Freshwater Lentic | ARPRPEIWYGDKTEAYLIGINYRGSIKTQYATIAVKVGE* |
| Ga0078894_106720176 | 3300005662 | Freshwater Lake | RHFSGEIVSAEPRPEIWYGENTEAFLIEVNAGGLRNKFATIAVKVGE* |
| Ga0078894_109680275 | 3300005662 | Freshwater Lake | PEIYYGEKTEAFLIEVRTGGLRNKFATIAVKVGE* |
| Ga0070744_101420781 | 3300006484 | Estuarine | IISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE* |
| Ga0070744_102076961 | 3300006484 | Estuarine | IINATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE* |
| Ga0079301_11250754 | 3300006639 | Deep Subsurface | YRSRNRHFSGEIVSAEHRPEIWYGEKTEAYLIEINAGGLRNKFATIAVKVGE* |
| Ga0102875_11348751 | 3300007547 | Estuarine | PRPEIWYGDKTEAYLIGINYRGSIKTQYATIAVKVGE* |
| Ga0102877_11664833 | 3300007548 | Estuarine | EPRPEIWYGEKTEAYLIGINYKGSIKTQYATIAVKVGE* |
| Ga0102881_11561631 | 3300007551 | Estuarine | ATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE* |
| Ga0102881_12305771 | 3300007551 | Estuarine | YRSNSRHFEGEIINATPRPEIWYGEKTEAYLIEIDTRSFRNKFATIAVKVGE* |
| Ga0102914_10965704 | 3300007561 | Estuarine | PRPAIWYGENTEAYVVEVYDRTLRNKFATVAIRVGE* |
| Ga0102915_13125231 | 3300007562 | Estuarine | ATPRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE* |
| Ga0102923_10672471 | 3300007606 | Estuarine | NRHFSGEIVSAKPRPEIWYGDKTEAFLIEVRAGGLRNKFATVAVKVGE* |
| Ga0102878_10393551 | 3300007624 | Estuarine | GEIVSAEHRPEIYYGEKTEAYLIEVRAGGLQNKFATIAVKVGE* |
| Ga0102869_12115111 | 3300007627 | Estuarine | NYRSNSRHFSGEIISAEHRPEIWYGEKTEAYLIEINAGGLRNKFATIAVKLGE* |
| Ga0102895_10328351 | 3300007629 | Estuarine | RPEIWYGEKTEAYLIEINAGGLRNKFATIAVKVGE* |
| Ga0102894_11128581 | 3300007632 | Estuarine | AIWYGENTEAYLIGINYKGSIKTQYATIAVKVGE* |
| Ga0102894_11693781 | 3300007632 | Estuarine | KNYRSRNRHFEGEIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE* |
| Ga0102901_11016191 | 3300007634 | Estuarine | TYRSNSRHFEGEIISAEPRPAIWYGENTEAYLIGINYKGSIKTQYATIAVKVGE* |
| Ga0102823_11296153 | 3300007692 | Estuarine | RSNSRHFSGEIVSAEHRPEIWYGEKTEAYLIEIRAGGLRNKFATIAVKVGE* |
| Ga0114340_12609203 | 3300008107 | Freshwater, Plankton | FSGEIVSAEPRPEIWYGENTEAFLIEVNAGGLRNKFATIAVKVGE* |
| Ga0114344_10479738 | 3300008111 | Freshwater, Plankton | GEIISAEHRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE* |
| Ga0114350_10723233 | 3300008116 | Freshwater, Plankton | MATKIISAEHRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE* |
| Ga0114350_11813431 | 3300008116 | Freshwater, Plankton | GEIISAEPRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE* |
| Ga0114351_12789434 | 3300008117 | Freshwater, Plankton | TNRHFSGEIISAEPRPAIWYGENTEAYLIEVNAGGLRNKFATIAVKVGE* |
| Ga0114841_11765485 | 3300008259 | Freshwater, Plankton | NRHFSGEIVSAEPRPEIWYGENTEAFLIEVNAGGLRNKFATIAVKVGE* |
| Ga0114336_11521555 | 3300008261 | Freshwater, Plankton | EIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE* |
| Ga0114336_13345291 | 3300008261 | Freshwater, Plankton | AEKREGIWYGENTEAYLSEVNAKGLRNKFATIAVKVGE* |
| Ga0114337_11578111 | 3300008262 | Freshwater, Plankton | HFSGEIVSAEHRPEIWDGEKTEAYLIEINAGGLRNKFATIAVKVGE* |
| Ga0114363_11895812 | 3300008266 | Freshwater, Plankton | AEPRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE* |
| Ga0102831_100864511 | 3300008996 | Estuarine | EGEIISAEPRPEIWYGEKTEAYLIGINYKGSIKTQYATIAVKVGE* |
| Ga0102831_11042671 | 3300008996 | Estuarine | NYNSRNRHFEGEIVSARPRPEIWYGDKTEAYLIEINTRSLRNKFATVAVKVGE* |
| Ga0102831_11307791 | 3300008996 | Estuarine | NYRSNSRHFSGEIVSAKPRPAIWYGDKTEAFLIEVRTGGLRNKFATIAVKVGE* |
| Ga0102816_12553854 | 3300008999 | Estuarine | RPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE* |
| Ga0102909_11020134 | 3300009050 | Estuarine | RSNSRHFSGEIVSAEPRPAIWYGEKTEAFLIEIRTGGLRNKFATIAVKVGE* |
| Ga0102864_12050511 | 3300009051 | Estuarine | SRHFEGEIISAEPRPAIWYGENTEAYLIGINYKGSIKTQYATIAVKVGE* |
| Ga0102814_102178051 | 3300009079 | Estuarine | PRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE* |
| Ga0102814_103906121 | 3300009079 | Estuarine | YNRHFSGEIVSAEPRPAIWYGEKTEAYLIEVRTGGLRNKFATIAVKVGE* |
| Ga0102814_105089353 | 3300009079 | Estuarine | RHFSGEIVSAEPRPAIWYGENTEAYLIGINYKGSIKTQYATIAVKVGE* |
| Ga0114968_106991423 | 3300009155 | Freshwater Lake | PEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE* |
| Ga0114966_105514404 | 3300009161 | Freshwater Lake | SRHFEGEIINATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE* |
| Ga0114975_100501541 | 3300009164 | Freshwater Lake | FEGEIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE* |
| Ga0114979_106846311 | 3300009180 | Freshwater Lake | KNYRSNSRHFSGEIISAKARPEIWYGDKTEAYLIEINAGGLRNKFATIAVKVGE* |
| Ga0114976_104574194 | 3300009184 | Freshwater Lake | RNRHFEGEIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE* |
| Ga0114982_10824751 | 3300009419 | Deep Subsurface | RPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE* |
| Ga0102890_10067861 | 3300010309 | Estuarine | EIVSAEHRPEIYYGEKTEAYLIEVRAGGLQNKFATIAVKVGE* |
| Ga0114986_10443313 | 3300010374 | Deep Subsurface | FQGEIIHAEPRPAIWYGENTEAYLVQVRVPHSLHDKYATIAVKVGE* |
| Ga0133913_121529235 | 3300010885 | Freshwater Lake | GEIISAKARPEIWYGDKTEAYLIEINAGGLRNKFATIAVKVGE* |
| Ga0139557_10184951 | 3300011010 | Freshwater | PRPAIWYGENTEAYVIEVYDRTLRNKFATVAIRVGE* |
| Ga0157605_11414041 | 3300012716 | Freshwater | RSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE* |
| Ga0181343_11953363 | 3300017766 | Freshwater Lake | FSGEIVSAEHRPEIYYGEKTEAYLIEVNAGGLRNKFATIAVKVGE |
| Ga0207193_16007154 | 3300020048 | Freshwater Lake Sediment | SGEIVSAKPRPAIWYGDKTEAFLIEVRTGGLRNKFATIAVKVGE |
| Ga0211731_1125558711 | 3300020205 | Freshwater | NSRHFEGEIVSATPRPEIWYGENTEAYLIEVNARGLRNKYATIAVKVGE |
| Ga0208050_100114113 | 3300020498 | Freshwater | NSRHFSGEIVSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE |
| Ga0208223_10276762 | 3300020519 | Freshwater | QNYRSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE |
| Ga0207940_10293575 | 3300020552 | Freshwater | GEIISAEPRPEIWYGENTEAYLIGIDYRGSIKTQYATVAVKVGE |
| Ga0208083_10384491 | 3300020559 | Freshwater | FAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE |
| Ga0207909_10304831 | 3300020572 | Freshwater | NYRSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE |
| Ga0214163_10663731 | 3300021141 | Freshwater | FAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE |
| Ga0244777_100671771 | 3300024343 | Estuarine | HFSGEIVSAEPRPSIWYGDKTEAYTIEVRTGGLRNKFATIAVKVGE |
| Ga0244777_106901881 | 3300024343 | Estuarine | NSRHFEGEIINATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE |
| Ga0244775_105288244 | 3300024346 | Estuarine | KPRPAIWYGDKTEAFLIEVRTGGLRNKFATIAVKVGE |
| Ga0244775_113482193 | 3300024346 | Estuarine | IINATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE |
| Ga0255224_10841251 | 3300024483 | Freshwater | YRSNSRHFSGEIVSAEHRPEIWYGEKTEAYLIEIRAGGLRNKFATIAVKVGE |
| Ga0255089_10251755 | 3300027130 | Freshwater | YRSTNRHFSGEIVSAEPRPAIWYGENTEAYVIEIRTGGLRNKFATIAVKTSD |
| Ga0255082_10277921 | 3300027139 | Freshwater | VSAEPRPAIWYGENTEAYVIEIRTGGLRNKFATIAVKTSD |
| Ga0255076_10278501 | 3300027141 | Freshwater | SAEPRPAIWYGENTEAYVIEIRTGGLRNKFATIAVKTSD |
| Ga0255065_10728704 | 3300027142 | Freshwater | TYRSTNRHFSGEIISAEHRPSIWYGENTEAYLIEIRTGGLRNKFATIAVKVGE |
| Ga0255115_10952383 | 3300027148 | Freshwater | AEHRPEIWYGEKTEAYLIEINAGGLRNKFATIAVKVGE |
| Ga0255083_100161316 | 3300027153 | Freshwater | NRHFSGEIVSAKPRPEIWYGDKTEAFLIEVRAGGLRNKFATVAVKVGE |
| Ga0208024_10360021 | 3300027222 | Estuarine | EHRPEIYYGEKTEAYLIEVRAGGLQNKFATIAVKVGE |
| Ga0208803_10790574 | 3300027232 | Estuarine | RHFSGEIVSAEPRPAIWYGEKTEAFLIEIRTGGLRNKFATIAVKVGE |
| Ga0208444_10114351 | 3300027240 | Estuarine | SRNRHFEGEIVSARPRPEIWYGDKTEAYLIGINYRGSIKTQYATIAVKVGE |
| Ga0208027_10791491 | 3300027260 | Estuarine | HFEGEIVSARPRPEIWYGDKTEAYLIGIDYRGSIKTQYATVAVKVGE |
| Ga0208440_11148691 | 3300027281 | Estuarine | NYRSNSRHFSGEIVSAEHRPEIYYGEKTEAYLIEVRAGGLQNKFATIAVKVGE |
| Ga0208923_10645304 | 3300027320 | Estuarine | RPEIWYGEKTEAYLIEIRAGGLRNKFATIAVKVGE |
| Ga0255085_10290546 | 3300027538 | Freshwater | FEGEIISATPRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE |
| Ga0255117_10314481 | 3300027600 | Freshwater | YRSRNRHFEGEIVSAEKREGIWYGENTEAYLIEVNTRGLRNKFATIAVKVGE |
| Ga0208975_11957951 | 3300027659 | Freshwater Lentic | KNYRSNSRHFSGEIVSAEHRPEIWYGEKTEAYLIEINAGGFRNKFATIAVKVGE |
| Ga0209500_102104271 | 3300027782 | Freshwater Lake | ATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE |
| Ga0209972_100223551 | 3300027793 | Freshwater Lake | YRSNSRHFSGEIVSAEPRPEIYYGEKTEAYLIEIRTGGLRNKFATIAVKVGE |
| Ga0209972_103850581 | 3300027793 | Freshwater Lake | NYRSNSRHFSGEIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE |
| Ga0209107_104978634 | 3300027797 | Freshwater And Sediment | RPEIWYGEKTEAYLIEINAGGLRNKFATIAVKVGE |
| Ga0209107_105330251 | 3300027797 | Freshwater And Sediment | EIISASPRPAIWYGENTEAYVIEIYDRTLRSKFATVAVKVGE |
| Ga0209358_100443859 | 3300027804 | Freshwater Lake | NRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE |
| Ga0209550_101545246 | 3300027892 | Freshwater Lake | YRSRNRHFEGEIVSAEKREGIWYGENTEAYLIEVNAKGLRNKFATIAVKVGE |
| Ga0209550_105713441 | 3300027892 | Freshwater Lake | ARPEIYYGEKTEAYLIEINAGGLRNKFATIAVKVGE |
| Ga0209550_105937713 | 3300027892 | Freshwater Lake | VSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE |
| Ga0209400_100532226 | 3300027963 | Freshwater Lake | NSRHFEGEIISATPRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE |
| Ga0256301_10232507 | 3300029697 | Freshwater | EIISAEPRPEIWYGEKTEAYLIGIYYRGSLKTQYATIAVKVGE |
| Ga0315907_105205394 | 3300031758 | Freshwater | IVSAKSRPAIWYGENTEAYLIEVRTGGLRNKFATVAVKVGE |
| Ga0315909_104494051 | 3300031857 | Freshwater | SAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE |
| Ga0315906_105827815 | 3300032050 | Freshwater | SAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE |
| Ga0315902_101102251 | 3300032093 | Freshwater | GEIISAEHRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE |
| Ga0315903_106074465 | 3300032116 | Freshwater | HFSGEIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE |
| Ga0334979_0528025_2_142 | 3300033996 | Freshwater | HFSGEIVSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE |
| Ga0334986_0156076_3_116 | 3300034012 | Freshwater | EHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE |
| Ga0334985_0729229_3_155 | 3300034018 | Freshwater | SNTRHFSGEIISAEARPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE |
| Ga0335019_0292585_3_140 | 3300034066 | Freshwater | FSGEIISAEHRPEIWYGENTEAYLIEINAGGLRNKFATIAVKTSD |
| Ga0335010_0056358_2652_2795 | 3300034092 | Freshwater | RHFEGEIVSAQKREGIWYGENTEAYLIEVNAKGLRNKFATIAVKVGE |
| Ga0335050_0034908_3_119 | 3300034108 | Freshwater | AEHRPEIWYGENTEAYLIEINAGGLRNKFATVAVKVGE |
| Ga0335068_0282960_2_127 | 3300034116 | Freshwater | IVSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE |
| Ga0335033_0600181_1_138 | 3300034117 | Freshwater | FEGEIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKIGE |
| Ga0335049_0231686_1_150 | 3300034272 | Freshwater | NRHFEGEIVSARPRPEIWYGDKTEAYLIGINYRGSIKTQYATIAVKVGE |
| Ga0335049_0728347_461_595 | 3300034272 | Freshwater | SGEIISAEHRPEIWYGENTEAYLIEINAGGLRNKFATIAVKTSD |
| Ga0334997_0134373_1533_1649 | 3300034280 | Freshwater | AEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKTSD |
| Ga0335039_0033278_3036_3164 | 3300034355 | Freshwater | EIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE |
| Ga0335048_0299512_699_833 | 3300034356 | Freshwater | SGEIISAEPRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE |
| Ga0335048_0538997_3_122 | 3300034356 | Freshwater | AEPRPEIYYGDNTEAYLIGFNYKGSIKTQYATVAVKVGE |
| ⦗Top⦘ |