| Basic Information | |
|---|---|
| Family ID | F080016 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRL |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.47 % |
| % of genes near scaffold ends (potentially truncated) | 98.26 % |
| % of genes from short scaffolds (< 2000 bps) | 90.43 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.783 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.304 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.783 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.217 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF11706 | zf-CGNR | 7.83 |
| PF01522 | Polysacc_deac_1 | 4.35 |
| PF02583 | Trns_repr_metal | 3.48 |
| PF00248 | Aldo_ket_red | 2.61 |
| PF01833 | TIG | 2.61 |
| PF03631 | Virul_fac_BrkB | 2.61 |
| PF07336 | ABATE | 2.61 |
| PF12697 | Abhydrolase_6 | 2.61 |
| PF00702 | Hydrolase | 1.74 |
| PF09922 | DUF2154 | 1.74 |
| PF05437 | AzlD | 1.74 |
| PF02776 | TPP_enzyme_N | 0.87 |
| PF03706 | LPG_synthase_TM | 0.87 |
| PF09880 | DUF2107 | 0.87 |
| PF12681 | Glyoxalase_2 | 0.87 |
| PF10282 | Lactonase | 0.87 |
| PF13683 | rve_3 | 0.87 |
| PF11139 | SfLAP | 0.87 |
| PF00484 | Pro_CA | 0.87 |
| PF13539 | Peptidase_M15_4 | 0.87 |
| PF13240 | zinc_ribbon_2 | 0.87 |
| PF04350 | PilO | 0.87 |
| PF02515 | CoA_transf_3 | 0.87 |
| PF13692 | Glyco_trans_1_4 | 0.87 |
| PF00211 | Guanylate_cyc | 0.87 |
| PF01694 | Rhomboid | 0.87 |
| PF04337 | DUF480 | 0.87 |
| PF14333 | DUF4389 | 0.87 |
| PF09754 | PAC2 | 0.87 |
| PF00027 | cNMP_binding | 0.87 |
| PF01569 | PAP2 | 0.87 |
| PF06480 | FtsH_ext | 0.87 |
| PF03364 | Polyketide_cyc | 0.87 |
| PF06441 | EHN | 0.87 |
| PF00072 | Response_reg | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 4.35 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 3.48 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.61 |
| COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 2.61 |
| COG3167 | Type IV pilus assembly protein PilO | Cell motility [N] | 1.74 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.87 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.87 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.87 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.87 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.78 % |
| Unclassified | root | N/A | 25.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02H3JYM | Not Available | 506 | Open in IMG/M |
| 3300000956|JGI10216J12902_102127675 | Not Available | 610 | Open in IMG/M |
| 3300004081|Ga0063454_102030700 | Not Available | 509 | Open in IMG/M |
| 3300004114|Ga0062593_101306732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300004156|Ga0062589_101970125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300005093|Ga0062594_100481408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1041 | Open in IMG/M |
| 3300005332|Ga0066388_102882807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300005333|Ga0070677_10873759 | Not Available | 518 | Open in IMG/M |
| 3300005334|Ga0068869_101159552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300005338|Ga0068868_100430586 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300005340|Ga0070689_100123464 | Not Available | 2070 | Open in IMG/M |
| 3300005355|Ga0070671_100330119 | Not Available | 1300 | Open in IMG/M |
| 3300005406|Ga0070703_10042502 | Not Available | 1421 | Open in IMG/M |
| 3300005434|Ga0070709_11037327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300005435|Ga0070714_102330159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 521 | Open in IMG/M |
| 3300005445|Ga0070708_100210728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1820 | Open in IMG/M |
| 3300005451|Ga0066681_10734869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300005471|Ga0070698_100303302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1528 | Open in IMG/M |
| 3300005544|Ga0070686_100403070 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005553|Ga0066695_10661495 | Not Available | 617 | Open in IMG/M |
| 3300005558|Ga0066698_10764365 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005563|Ga0068855_101198521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 790 | Open in IMG/M |
| 3300005569|Ga0066705_10152647 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300005598|Ga0066706_10959859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 662 | Open in IMG/M |
| 3300005614|Ga0068856_102560342 | Not Available | 516 | Open in IMG/M |
| 3300005718|Ga0068866_10698279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300006028|Ga0070717_12004528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300006034|Ga0066656_10375507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 919 | Open in IMG/M |
| 3300006042|Ga0075368_10204293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300006058|Ga0075432_10189723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300006574|Ga0074056_11791162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1589 | Open in IMG/M |
| 3300006576|Ga0074047_11579075 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006755|Ga0079222_10592828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 844 | Open in IMG/M |
| 3300006791|Ga0066653_10051789 | Not Available | 1712 | Open in IMG/M |
| 3300006791|Ga0066653_10135863 | Not Available | 1176 | Open in IMG/M |
| 3300006796|Ga0066665_11404739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus | 540 | Open in IMG/M |
| 3300006797|Ga0066659_10202100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1455 | Open in IMG/M |
| 3300006854|Ga0075425_101400510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
| 3300009147|Ga0114129_10226241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2521 | Open in IMG/M |
| 3300009147|Ga0114129_10969330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
| 3300009162|Ga0075423_11784507 | Not Available | 663 | Open in IMG/M |
| 3300009162|Ga0075423_12909580 | Not Available | 525 | Open in IMG/M |
| 3300009176|Ga0105242_10073174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2848 | Open in IMG/M |
| 3300009177|Ga0105248_11288776 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300010048|Ga0126373_11593135 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 718 | Open in IMG/M |
| 3300010227|Ga0136219_1019129 | Not Available | 752 | Open in IMG/M |
| 3300010325|Ga0134064_10239416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300010336|Ga0134071_10451319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300010401|Ga0134121_11127870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300010403|Ga0134123_11642843 | Not Available | 692 | Open in IMG/M |
| 3300011107|Ga0151490_1765812 | Not Available | 588 | Open in IMG/M |
| 3300011119|Ga0105246_12042002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300011269|Ga0137392_11198195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300012010|Ga0120118_1077265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300012204|Ga0137374_10827298 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012208|Ga0137376_10295057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1407 | Open in IMG/M |
| 3300012208|Ga0137376_10725609 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012209|Ga0137379_11183573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300012210|Ga0137378_10018137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 6147 | Open in IMG/M |
| 3300012211|Ga0137377_11944797 | Not Available | 505 | Open in IMG/M |
| 3300012350|Ga0137372_11083786 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012353|Ga0137367_10766606 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012357|Ga0137384_11051658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300012960|Ga0164301_11761717 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012960|Ga0164301_11841625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300012961|Ga0164302_10943798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300012976|Ga0134076_10405966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300012985|Ga0164308_10841348 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012986|Ga0164304_10564061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300012989|Ga0164305_10313192 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300013100|Ga0157373_11216522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300013102|Ga0157371_10387085 | Not Available | 1022 | Open in IMG/M |
| 3300013297|Ga0157378_12599525 | Not Available | 559 | Open in IMG/M |
| 3300015359|Ga0134085_10551173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300015372|Ga0132256_103245462 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300016294|Ga0182041_10845864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300016371|Ga0182034_11323144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300016445|Ga0182038_10578161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
| 3300017944|Ga0187786_10479813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300017947|Ga0187785_10669047 | Not Available | 542 | Open in IMG/M |
| 3300018064|Ga0187773_10035255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2230 | Open in IMG/M |
| 3300018089|Ga0187774_10090540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300018433|Ga0066667_10056620 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
| 3300018433|Ga0066667_11565795 | Not Available | 585 | Open in IMG/M |
| 3300018468|Ga0066662_12025584 | Not Available | 603 | Open in IMG/M |
| 3300021413|Ga0193750_1017337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1755 | Open in IMG/M |
| 3300025899|Ga0207642_10193579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300025910|Ga0207684_10977430 | Not Available | 709 | Open in IMG/M |
| 3300025911|Ga0207654_10332900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
| 3300025914|Ga0207671_11451022 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300025915|Ga0207693_10132812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1957 | Open in IMG/M |
| 3300025929|Ga0207664_10508319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
| 3300025949|Ga0207667_12032011 | Not Available | 534 | Open in IMG/M |
| 3300026121|Ga0207683_10025362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5114 | Open in IMG/M |
| 3300026121|Ga0207683_11214959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 699 | Open in IMG/M |
| 3300026300|Ga0209027_1122104 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300026327|Ga0209266_1119471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1122 | Open in IMG/M |
| 3300027866|Ga0209813_10149035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300028878|Ga0307278_10546350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300031561|Ga0318528_10472590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300031682|Ga0318560_10193444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1085 | Open in IMG/M |
| 3300031819|Ga0318568_10764797 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031879|Ga0306919_11136257 | Not Available | 595 | Open in IMG/M |
| 3300031896|Ga0318551_10152624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1261 | Open in IMG/M |
| 3300032009|Ga0318563_10533751 | Not Available | 634 | Open in IMG/M |
| 3300032065|Ga0318513_10197054 | Not Available | 970 | Open in IMG/M |
| 3300032177|Ga0315276_10084344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 3195 | Open in IMG/M |
| 3300032261|Ga0306920_100164612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3306 | Open in IMG/M |
| 3300032401|Ga0315275_10153821 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
| 3300032782|Ga0335082_10229326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1746 | Open in IMG/M |
| 3300032893|Ga0335069_10390670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1634 | Open in IMG/M |
| 3300032954|Ga0335083_10429888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1121 | Open in IMG/M |
| 3300032955|Ga0335076_11004700 | Not Available | 717 | Open in IMG/M |
| 3300033412|Ga0310810_10556657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.22% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010227 | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2 | Engineered | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_02555460 | 2065487018 | Soil | MHARKDPPRSRRVLRLIALERAVRGVLLLVGGIYLLFHLHSDFGRLATRAI |
| JGI10216J12902_1021276752 | 3300000956 | Soil | MVGAMTGAADPQRSRRVLKLIALERGARGLLLLAAGVYLLFHL |
| Ga0063454_1020307001 | 3300004081 | Soil | MRAGDPPRTRLVIRLIAIERSLRGILLLAAGTYLLFHLNTDFGHLAERIIR |
| Ga0062593_1013067322 | 3300004114 | Soil | LTRAADRPRSRRILRLIAVERIARGVLLLTAGVYLLFNLNSDFGR |
| Ga0062589_1019701252 | 3300004156 | Soil | MTGAADPPRSRRVLRLIAVERAARGLLLLGAGVYLLFHLNTDF |
| Ga0062594_1004814083 | 3300005093 | Soil | VVNAAADPPRSRRFLRLIALERMVRGVLLLAAGVYLLFHLSSDFGRL |
| Ga0066388_1028828071 | 3300005332 | Tropical Forest Soil | MAAGAVHSPRSRLVLRLIAVERVGRGLLLLFAGVYLLFHLNSDLGRLGERVMRAI |
| Ga0070677_108737591 | 3300005333 | Miscanthus Rhizosphere | MTRAADRPRSRRVLRLIALERIARGVLLLSAGVYLLFNLNSDFGRLAERVMRAI |
| Ga0068869_1011595522 | 3300005334 | Miscanthus Rhizosphere | VTEATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFG |
| Ga0068868_1004305863 | 3300005338 | Miscanthus Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLGAGVYLLFHLNSDFGRLGERVMRAIELDPRRPFFHRIVV |
| Ga0070689_1001234642 | 3300005340 | Switchgrass Rhizosphere | MTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSDFGRLAERVMRAIE |
| Ga0070671_1003301191 | 3300005355 | Switchgrass Rhizosphere | MTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSDFGRLAE |
| Ga0070703_100425022 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSD |
| Ga0070709_110373271 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDF |
| Ga0070714_1023301591 | 3300005435 | Agricultural Soil | MGLDDPPRTRLVLRLIAVERSIRGLILLAAGVYLLFHLSTDLGRLSERIMRSI |
| Ga0070708_1002107281 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMRAIE |
| Ga0066681_107348692 | 3300005451 | Soil | MPVRAGDPPRTRLVLRLIAVERSVRGVILVAAGVYLLFHLSTDFGRLAERVARSID |
| Ga0070698_1003033021 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRL |
| Ga0070686_1004030703 | 3300005544 | Switchgrass Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVMRAIELDPRR |
| Ga0066695_106614952 | 3300005553 | Soil | MRAGDPPRTRLVIRLIAVERSLRGVLLLAAGVYLLFHLN |
| Ga0066698_107643651 | 3300005558 | Soil | MTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMRAIELDP |
| Ga0068855_1011985211 | 3300005563 | Corn Rhizosphere | VTEATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRL |
| Ga0066705_101526471 | 3300005569 | Soil | MTGAADPPRSRRVLRLIALERAGRGLLLLAAGGYLLFHLNSDFGRL |
| Ga0066706_109598591 | 3300005598 | Soil | MRAGDPPRTRLVLRLIAVERSLRGLLLLAAGTYLLFHLSTDFGQLAERIIR |
| Ga0068856_1025603423 | 3300005614 | Corn Rhizosphere | VTGAADPPRSRRFLRLIALERIARGVLLLAAGVYL |
| Ga0068866_106982791 | 3300005718 | Miscanthus Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVIRA |
| Ga0070717_120045281 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGADDPSRSRRFLRVIALERIARGVLLLAAGVYLLFHLSSDFGRLADHAIRAIELD |
| Ga0066656_103755073 | 3300006034 | Soil | MTKAHDQRRSRRVLRLIAAERIIRGVLLLGAGVYLLF |
| Ga0075368_102042932 | 3300006042 | Populus Endosphere | MAKADDQPRSRRVLRLIAAERIVRGVLLLAAGVYLL |
| Ga0075432_101897232 | 3300006058 | Populus Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLN |
| Ga0074056_117911621 | 3300006574 | Soil | VDALVIVMGAMTRVADRPRSRRVLRLIALERIARGVLLLSAGVYLLFNLNSDFGRLA |
| Ga0074047_115790751 | 3300006576 | Soil | MTSAGIRPRNRRVLRLIALERIVRGALLLGAGVYLLFHLNSDFGRLGER |
| Ga0079222_105928281 | 3300006755 | Agricultural Soil | MAKAHDQPRGRRVVRLIAAERLVRGVLLLSAGVYLLFHVNNDFGRVAER |
| Ga0066653_100517895 | 3300006791 | Soil | MTQARDSSRSRRVLRLIALERIARSLFLLAAGTYLVSHLG |
| Ga0066653_101358633 | 3300006791 | Soil | MRAGDPPRTRLVIRLIAIERSLRGVLLLAAGTYLLFHLNTDFGHLAERIIRSIDVD |
| Ga0066665_114047391 | 3300006796 | Soil | MTGATDPPRSRRVLRLIALERAGRGLLLLAAVVYLLFHLNSDFGRLGERVMRAIELDPR |
| Ga0066659_102021001 | 3300006797 | Soil | MRAGDPPRTRLVLRVIAIERSLRGLLLLAAGTYLLFHLSTDFGQLA |
| Ga0075425_1014005102 | 3300006854 | Populus Rhizosphere | MRAGDPPRTRLVIRLIAIERSLRGVLLLAAGVYLLFHL |
| Ga0114129_102262411 | 3300009147 | Populus Rhizosphere | MRAGDPPRTRLVLRLIALERSLRGLILLAAGTYLLFHLSTDLGQLAERVIR |
| Ga0114129_109693301 | 3300009147 | Populus Rhizosphere | MTGAADPPRSRRVLRLIAVERAARGLLLLGAGVYLLFHLNTDFGRLGERVMRAI |
| Ga0075423_117845072 | 3300009162 | Populus Rhizosphere | MAQADDQPRSRRVLRLIAAERIVRGVLLLAAGVYLLFHV |
| Ga0075423_129095802 | 3300009162 | Populus Rhizosphere | VTGAADPPRSRRFLRLIALERMARGVLLLAAGVYLLF |
| Ga0105242_100731741 | 3300009176 | Miscanthus Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGR |
| Ga0105248_112887761 | 3300009177 | Switchgrass Rhizosphere | MADAHDAPRSRRLIRLIAIERAIRGLLLAAGGIYLLAHLGADYGKL |
| Ga0126373_115931352 | 3300010048 | Tropical Forest Soil | VTRPADPPRSRRIIRLIALERAVRGVLLIGAGIYLFTHLGTDFGRLADHIMRAIEL |
| Ga0136219_10191292 | 3300010227 | Soil | MRAGDPPRTRLVLRLIAVERSLRGLLLLAAGTYLLFHLSTDF |
| Ga0134064_102394161 | 3300010325 | Grasslands Soil | MRAGDPSRTRLVLRLIAIERSLRGVLLLAAGTFLLFHL |
| Ga0134071_104513192 | 3300010336 | Grasslands Soil | MRAGDPPRTRLVIRVIAIERSLRGVLLLAAGVYLLFHLS |
| Ga0134121_111278702 | 3300010401 | Terrestrial Soil | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVIRAI |
| Ga0134123_116428432 | 3300010403 | Terrestrial Soil | MTRAADRPRSRRVLRLIAVERIARGVLLLTAGVYLLF |
| Ga0151490_17658121 | 3300011107 | Soil | MRAGDPSRTRLVLRLIAIERSVRGLLLIVAGTYLLFHLSTDFGRLAER |
| Ga0105246_120420022 | 3300011119 | Miscanthus Rhizosphere | MTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSDFG |
| Ga0137392_111981952 | 3300011269 | Vadose Zone Soil | MRAGDPPRTRLVLRLIAIERSLRGVLLLAAGTYLLFHLSTDFGQLAERIIRRI |
| Ga0120118_10772653 | 3300012010 | Permafrost | VGPVTEVRDPPRSRRILRLIALERLIRGVILIIAGAYLLTHLGSDLGRIADRLMRALE |
| Ga0137374_108272981 | 3300012204 | Vadose Zone Soil | VYALVIVVGAMTRAADRPRSRRILRLIALERIARGVLLLATGVYLLFHLNSDFGRLAERVMR |
| Ga0137376_102950573 | 3300012208 | Vadose Zone Soil | MRAGDPPRTRLVIRVIAIERSLRGVLLLAAGVYLLFHL |
| Ga0137376_107256092 | 3300012208 | Vadose Zone Soil | MTRAGDPPRSRRVLRLIALERSVRSLLLVAAGIYLLAHLGSDFGRI |
| Ga0137379_111835732 | 3300012209 | Vadose Zone Soil | MRAGDPPRTRLVLRLIAVERSLRGLLLLAAGTYLLFHLS |
| Ga0137378_100181371 | 3300012210 | Vadose Zone Soil | MTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRL |
| Ga0137377_119447971 | 3300012211 | Vadose Zone Soil | MRAGDPPRTRLVLRLIAIERSLRGMLLLAAGTYLLFHLSTDFGHLAERIIRS |
| Ga0137372_110837861 | 3300012350 | Vadose Zone Soil | LGACVVVAIVPAMATAGDAPRSRRILRLIALERSVRGVLLLAAGAYLITHLGSDFGRVADHAMRAVELDPRRPF |
| Ga0137367_107666061 | 3300012353 | Vadose Zone Soil | VGLVVAIVPAMATAGDAPRSRRILRLIALERSARGVLLLAAGAYLITHLGSDFGRVADHAMRAVELDPRR |
| Ga0137384_110516581 | 3300012357 | Vadose Zone Soil | MRAGDPSRTRLVLRVIAIERALRGLLLLAAGTYLLFHLS |
| Ga0164301_117617173 | 3300012960 | Soil | MTSASDRPRGRRVLRLIALERIVRGLLLLGAGVYLLFHLNSDF |
| Ga0164301_118416251 | 3300012960 | Soil | MGTDSAGDPPRSRRILRLIALERIVRGVLLFGAGVYLLFHLNSDF |
| Ga0164302_109437982 | 3300012961 | Soil | MTGAADPPRSRRFLRLIALERAGRGLLLLAAGGYLLFHLNSELGRLAERV |
| Ga0134076_104059661 | 3300012976 | Grasslands Soil | MTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMR |
| Ga0164308_108413482 | 3300012985 | Soil | MTSASDPPRGRRVLRLIALERIVRGLLLLGAGVYLLFHLN |
| Ga0164304_105640612 | 3300012986 | Soil | LTRAADRPRSRRILRLIALERIGRGVLLLTAGVYLLFNLNSDFGRLAERVMRAIELDP |
| Ga0164305_103131922 | 3300012989 | Soil | MGADPPRTRVVLRVIAIERCLRGLLLLAAGVYLLFHLNTDFGRLAERIIR |
| Ga0157373_112165222 | 3300013100 | Corn Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLSAGVYLLFHLNSDFGRLGERVIRA |
| Ga0157371_103870851 | 3300013102 | Corn Rhizosphere | MTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFN |
| Ga0157378_125995253 | 3300013297 | Miscanthus Rhizosphere | VAGAGDPPRSRRVIRLIAAERFLRGLVLIAAGGYLLTHLGSDLG |
| Ga0134085_105511732 | 3300015359 | Grasslands Soil | MRAGDPPRTRLVLRLIAVERSLRGLLLLAAGTYLLFHLSTDFGQLAE |
| Ga0132256_1032454621 | 3300015372 | Arabidopsis Rhizosphere | VAGAGDPQRSRVVLKLIAGERFVRGILLLAAGTYLLTHQNK |
| Ga0182041_108458641 | 3300016294 | Soil | MSSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLL |
| Ga0182034_113231443 | 3300016371 | Soil | MTSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLFHLNSDF |
| Ga0182038_105781611 | 3300016445 | Soil | MSSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLFHLNS |
| Ga0187786_104798132 | 3300017944 | Tropical Peatland | MTEASEPRRARRILWLIALERIIRGALLLAAGIYLLFHL |
| Ga0187785_106690471 | 3300017947 | Tropical Peatland | MTEASEPRRTRRVLRLIALERIIRGALLLAAGIYLLFHLNSDFGRLA |
| Ga0187773_100352551 | 3300018064 | Tropical Peatland | MTAGTASPRSRRVLRLIAAERIVRGVLLLAAGVYLL |
| Ga0187774_100905401 | 3300018089 | Tropical Peatland | MPAARVRERRVTVPVAMSRADDQPRSRRVLRLIAIERMVRGALLLAAGVYLLFHLNKDFG |
| Ga0066667_100566201 | 3300018433 | Grasslands Soil | MTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFG |
| Ga0066667_115657952 | 3300018433 | Grasslands Soil | LGMTSAEDRPRSRRVLRLIGLERIVRGALLLGAGVYLLFHLNSAFARLGERVM |
| Ga0066662_120255842 | 3300018468 | Grasslands Soil | MRAGDPPRTRLVLRLIAVERSLRGALLVAAGLYLLFHLSTDLGHLAE |
| Ga0193750_10173371 | 3300021413 | Soil | MRAGDPPRTRLVLRLIAIERSLRGVLLLAAGTYLLFNLSTDF |
| Ga0207642_101935793 | 3300025899 | Miscanthus Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFG |
| Ga0207684_109774301 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGAADPPRSRRFLRLIALERAGRGVLLLAAGVYLLFHLNSDF |
| Ga0207654_103329001 | 3300025911 | Corn Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVIRAIELDPRR |
| Ga0207671_114510221 | 3300025914 | Corn Rhizosphere | MTGAADPPRSRRFLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMRAITAMATWNGNS |
| Ga0207693_101328123 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSD |
| Ga0207664_105083191 | 3300025929 | Agricultural Soil | MAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVIR |
| Ga0207667_120320111 | 3300025949 | Corn Rhizosphere | VDALVIVVGPMTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSDFGRLAERVMRA |
| Ga0207683_100253621 | 3300026121 | Miscanthus Rhizosphere | MAGATDPPRSRRVLRLIALERAGRGVLLLSAGVYLLFHLNSDF |
| Ga0207683_112149591 | 3300026121 | Miscanthus Rhizosphere | VAGAGDPPRSRRVIRLIAAERFLRGLVLIAAGGYLLTHLG |
| Ga0209027_11221041 | 3300026300 | Grasslands Soil | MTGAADPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSD |
| Ga0209266_11194711 | 3300026327 | Soil | MTHAGDTPRSRRILRLIALERTVRSLLLLAAGVYLLTHLK |
| Ga0209813_101490352 | 3300027866 | Populus Endosphere | MAKAVDQPRSRRVLRLIAAERIVRGVLLLAAGVYLL |
| Ga0307278_105463501 | 3300028878 | Soil | MTRAADPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMRAIELDPRR |
| Ga0318528_104725903 | 3300031561 | Soil | MTSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLFHLNSDFGR |
| Ga0318560_101934441 | 3300031682 | Soil | MSSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLFHLNSDF |
| Ga0318568_107647972 | 3300031819 | Soil | MTSTEAQPRSRLVLRLIALERIVRGALLLGAGVYLLFHLNSDFGRLGERVMRAI |
| Ga0306919_111362573 | 3300031879 | Soil | VARTDPPRSRRIIRLIALERMVRGVALLAAGIYLVTHSHSDF |
| Ga0318551_101526243 | 3300031896 | Soil | MSSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLF |
| Ga0306922_105691213 | 3300032001 | Soil | VAGAHDPPRSRRLLRLIALERIVRGLLLLAAGIYLLSHLGSDLGKTADRIMRAVELD |
| Ga0318563_105337511 | 3300032009 | Soil | MTGASDPPRSRRLLKVIAVERVVRSLLLLAAGVYLLK |
| Ga0318513_101970541 | 3300032065 | Soil | MTGASDPPRSRRLLKVIAVERVVRSLLLLAAGVYLLKHVTSDFGRISERIMRA |
| Ga0315276_100843444 | 3300032177 | Sediment | LTRAGDAPRSRRILRLIALERGIRGVVLLAAGAYLLFHLSTDFGRWAERAMRAVELD |
| Ga0306920_1001646121 | 3300032261 | Soil | MTSTEAQPRSRLVLRLIALERIVRGALLLGAGVYLLFHLNSDFGRLGERVMR |
| Ga0315275_101538211 | 3300032401 | Sediment | LTRAGDAPRSRRILRLIALERGIRGVVLLAAGAYL |
| Ga0335082_102293261 | 3300032782 | Soil | MGTNSAGDPPRSRRILRLIALERIVRGVLLLGAGVY |
| Ga0335069_103906703 | 3300032893 | Soil | MGTNSAGDRPRSRRILRLIALERIVRGALLLGAGVYLLFHLNSDFGRLGERVMRAIELDP |
| Ga0335083_104298881 | 3300032954 | Soil | MSGADDRPHSRRVLRLIAVERIARGALLLAAGVYLLF |
| Ga0335076_110047001 | 3300032955 | Soil | MTGAADPPRSRRLLKVIAVERALRGLLLLAAGAYLLTHV |
| Ga0310810_105566571 | 3300033412 | Soil | MAKAHDQRRSRRVLRLIAAERIVRGTLLLAAGIYLLFNVNS |
| ⦗Top⦘ |