| Basic Information | |
|---|---|
| Family ID | F080013 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TPKWVAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 93.91 % |
| % of genes from short scaffolds (< 2000 bps) | 93.04 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.391 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.174 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.087 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.957 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 43.48 |
| PF04199 | Cyclase | 1.74 |
| PF00501 | AMP-binding | 0.87 |
| PF01547 | SBP_bac_1 | 0.87 |
| PF12680 | SnoaL_2 | 0.87 |
| PF11225 | DUF3024 | 0.87 |
| PF07969 | Amidohydro_3 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.39 % |
| Unclassified | root | N/A | 2.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0532563 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300000955|JGI1027J12803_103935857 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300000955|JGI1027J12803_106029174 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300004114|Ga0062593_101374889 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300004268|Ga0066398_10165719 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300004479|Ga0062595_101789053 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300004479|Ga0062595_102540965 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300004782|Ga0062382_10530186 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005174|Ga0066680_10113502 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300005174|Ga0066680_10827838 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005178|Ga0066688_10547887 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005295|Ga0065707_10195478 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300005332|Ga0066388_104652096 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005332|Ga0066388_106593822 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005345|Ga0070692_11325545 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005459|Ga0068867_100216619 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300005518|Ga0070699_100164800 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300005545|Ga0070695_101124895 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005556|Ga0066707_10732327 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005558|Ga0066698_10563921 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005566|Ga0066693_10064063 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300005764|Ga0066903_101006370 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300005764|Ga0066903_104479338 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005841|Ga0068863_100092899 | All Organisms → cellular organisms → Bacteria | 2863 | Open in IMG/M |
| 3300006579|Ga0074054_11717362 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006804|Ga0079221_10259344 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300006854|Ga0075425_101659659 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300006854|Ga0075425_101749093 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006854|Ga0075425_102419021 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006881|Ga0068865_100776190 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300006894|Ga0079215_10946865 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300006904|Ga0075424_100497581 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300006904|Ga0075424_102151688 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006914|Ga0075436_100096860 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300006930|Ga0079303_10118806 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300007076|Ga0075435_102026787 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300009091|Ga0102851_11716198 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300009091|Ga0102851_12954700 | Not Available | 546 | Open in IMG/M |
| 3300009100|Ga0075418_12479033 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300009111|Ga0115026_11476513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300009137|Ga0066709_102101605 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300009147|Ga0114129_10327776 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300009162|Ga0075423_11174316 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300009176|Ga0105242_11320291 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300009545|Ga0105237_11842559 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009792|Ga0126374_10454845 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300009792|Ga0126374_11012782 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300009792|Ga0126374_11792514 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010047|Ga0126382_11034150 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010304|Ga0134088_10176688 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300010321|Ga0134067_10356944 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010325|Ga0134064_10118615 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300010358|Ga0126370_12365689 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010359|Ga0126376_10721770 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300010360|Ga0126372_10353760 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300010360|Ga0126372_11025500 | Not Available | 838 | Open in IMG/M |
| 3300010361|Ga0126378_10069206 | All Organisms → cellular organisms → Bacteria | 3373 | Open in IMG/M |
| 3300010362|Ga0126377_10951773 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300010366|Ga0126379_12466910 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010366|Ga0126379_13631732 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010397|Ga0134124_12711430 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010398|Ga0126383_11114897 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300012198|Ga0137364_10497116 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300012203|Ga0137399_10727006 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300012209|Ga0137379_11330678 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012210|Ga0137378_10939509 | Not Available | 778 | Open in IMG/M |
| 3300012350|Ga0137372_10167893 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300012360|Ga0137375_11190007 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012360|Ga0137375_11207690 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012582|Ga0137358_11040077 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012925|Ga0137419_10033726 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
| 3300012971|Ga0126369_12207853 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012972|Ga0134077_10313857 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012977|Ga0134087_10174194 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300013297|Ga0157378_10672218 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300015359|Ga0134085_10363203 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300017659|Ga0134083_10576080 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300018058|Ga0187766_11267712 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300018059|Ga0184615_10064646 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300018422|Ga0190265_11314135 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300018431|Ga0066655_11253639 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300024330|Ga0137417_1032897 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300025922|Ga0207646_11388903 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025933|Ga0207706_11021383 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300025960|Ga0207651_10970445 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300026035|Ga0207703_10440618 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300026118|Ga0207675_100810320 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300026313|Ga0209761_1135985 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300026326|Ga0209801_1348339 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300026333|Ga0209158_1085209 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300026342|Ga0209057_1240011 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026480|Ga0257177_1021067 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300026532|Ga0209160_1016181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5186 | Open in IMG/M |
| 3300027880|Ga0209481_10306807 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300027910|Ga0209583_10187546 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300028596|Ga0247821_10678522 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300028814|Ga0307302_10283283 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300028889|Ga0247827_11133297 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300030336|Ga0247826_10167606 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300031740|Ga0307468_100436603 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300031740|Ga0307468_102433588 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031780|Ga0318508_1160626 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031799|Ga0318565_10238990 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300031819|Ga0318568_10632234 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031949|Ga0214473_10207581 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300032039|Ga0318559_10182016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 963 | Open in IMG/M |
| 3300032174|Ga0307470_11336841 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300032180|Ga0307471_103725083 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300032421|Ga0310812_10331963 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300033416|Ga0316622_103022810 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300033433|Ga0326726_11206004 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300033482|Ga0316627_100622282 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300033486|Ga0316624_11125187 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300033557|Ga0316617_100455775 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300034164|Ga0364940_0053520 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.61% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.87% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.87% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.87% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_05325632 | 3300000033 | Soil | QVGQGTPKWVAAENVTRPVIEAVYTGQKAPKAAMEDLARQINALPE* |
| JGI1027J12803_1039358571 | 3300000955 | Soil | QSTPKWVAAENVTRPVIESMYTGQKPAKAAMEDLAKQINALPE* |
| JGI1027J12803_1060291742 | 3300000955 | Soil | VGQPTPKWVAAENVTRPLIESMYTGQKPAKAAMEELAKQINALPE* |
| Ga0062593_1013748892 | 3300004114 | Soil | PNWQAGQPTPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD* |
| Ga0066398_101657192 | 3300004268 | Tropical Forest Soil | GQPTPKWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0062595_1017890531 | 3300004479 | Soil | WQGGQPTPKWVAAENLTRPVIETIYIGQKPAKAAMEDLARQINALPE* |
| Ga0062595_1025409652 | 3300004479 | Soil | QPTPRWVAAENLTRPVIESVYIGQKPGKAAMEDLVRQINALPV* |
| Ga0062382_105301861 | 3300004782 | Wetland Sediment | QPTPKWVAAGNLTRPEIENVYIGQKAAKVAMEGLARQIDALPD* |
| Ga0066680_101135021 | 3300005174 | Soil | VGQPTPKWVAAENLTRPVIESVYTGQKPAKAAMEDLARQINALPE* |
| Ga0066680_108278381 | 3300005174 | Soil | NWQVGQPTPKWVAAENITRPMIDSIYTGQKPAKVAMEELARQINALPD* |
| Ga0066688_105478872 | 3300005178 | Soil | NWQVGQPTPKWVAAENITRPVIDSIYTGQKPAKVAMEELARQINALPD* |
| Ga0065707_101954781 | 3300005295 | Switchgrass Rhizosphere | GQPTPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD* |
| Ga0066388_1046520961 | 3300005332 | Tropical Forest Soil | GGQPTPKWVAAENLTRPVIETIYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0066388_1065938222 | 3300005332 | Tropical Forest Soil | KWVAAENLTRPVIETVYIGQKPGRPAMEDLARQINALPE* |
| Ga0070692_113255452 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PTPKWVAAENITRPVIENVYIGQKPAAAAMGELARQINALPD* |
| Ga0068867_1002166193 | 3300005459 | Miscanthus Rhizosphere | QPTPRWVAAENLTRPVIESIYIAQKPPRAAMEDLARQINALPV* |
| Ga0070699_1001648001 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RWVAAENLTRPVIESIYIAQKPPRGAMEDLARQINALPV* |
| Ga0070695_1011248952 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VGQPTPRWVAAENLTRPVIESIYIAQKPPRGAMEDLARQINALPV* |
| Ga0066707_107323272 | 3300005556 | Soil | QPTPKWVAAENLTRPVIENVYIAQKPAAAAMQDLARQINALPD* |
| Ga0066698_105639212 | 3300005558 | Soil | KWVAAENLTRPVIETIYIGQKPARTAMEDLARQINALPE* |
| Ga0066693_100640631 | 3300005566 | Soil | QPTPKWVAAENLTRPVIESIYTGQKPAKAAMEDLARQISALPD* |
| Ga0066903_1010063701 | 3300005764 | Tropical Forest Soil | ENITRPIIENVYIGQRPAASAMGELAKQINALPD* |
| Ga0066903_1044793382 | 3300005764 | Tropical Forest Soil | NWQGGQPTPKWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0068863_1000928991 | 3300005841 | Switchgrass Rhizosphere | GQPTPKWVAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD* |
| Ga0074054_117173621 | 3300006579 | Soil | PKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD* |
| Ga0079221_102593442 | 3300006804 | Agricultural Soil | ENLTRPVIETIYIGQKPARAAMEDLARQINALPE* |
| Ga0075425_1016596592 | 3300006854 | Populus Rhizosphere | TPKWVAAENITRPVIENVYIGQKPAAAAMGELARQINALPD* |
| Ga0075425_1017490931 | 3300006854 | Populus Rhizosphere | KWVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPE* |
| Ga0075425_1024190212 | 3300006854 | Populus Rhizosphere | WVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0068865_1007761902 | 3300006881 | Miscanthus Rhizosphere | QPTPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD* |
| Ga0079215_109468653 | 3300006894 | Agricultural Soil | KWVAAENLTRPVIESVYTAQRPGKAAMEDLARQINALPD* |
| Ga0075424_1004975811 | 3300006904 | Populus Rhizosphere | ENLTRPVIESVYIGQKPGKAAMEDLVRQINALPV* |
| Ga0075424_1021516882 | 3300006904 | Populus Rhizosphere | PKWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0075436_1000968604 | 3300006914 | Populus Rhizosphere | AAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD* |
| Ga0079303_101188061 | 3300006930 | Deep Subsurface | TPKWVAAENLTRPEIENVYIGQKAAKLAMEGLARQIDALPD* |
| Ga0075435_1020267872 | 3300007076 | Populus Rhizosphere | WVAAENLTRPVIESVYIGQKPAAAAMQDLARQINALPD* |
| Ga0102851_117161981 | 3300009091 | Freshwater Wetlands | WQNGQPTPKWVPAENLTRPVIEDMYIGRRAAKEAMADLARQINALPD* |
| Ga0102851_129547002 | 3300009091 | Freshwater Wetlands | VAAENLTRPEIENVYIGQKAAKLAMEGLARQIDALPD* |
| Ga0075418_124790332 | 3300009100 | Populus Rhizosphere | AAENLTRPVIETVYIGQRPARAAMEDLARQINALPE* |
| Ga0115026_114765132 | 3300009111 | Wetland | PKWVAAENLTRPVIESLYIGQKTAQASMEDLTRQINALPD* |
| Ga0066709_1021016051 | 3300009137 | Grasslands Soil | PKWVAAENITRPVIENVYIGQKPAAAAMSDLARQINALPD* |
| Ga0114129_103277761 | 3300009147 | Populus Rhizosphere | TPKWVAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD* |
| Ga0075423_111743162 | 3300009162 | Populus Rhizosphere | QPTPKWVAAENVTRPVIDSMYTGQKPPKAAMEDLAKQINGLPD* |
| Ga0105242_113202912 | 3300009176 | Miscanthus Rhizosphere | GQPTPKWVAAENLTRPVIENVYIGQKPAPAAMTDLARQINALPD* |
| Ga0105237_118425591 | 3300009545 | Corn Rhizosphere | VAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD* |
| Ga0126374_104548451 | 3300009792 | Tropical Forest Soil | PTPKWVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPE* |
| Ga0126374_110127821 | 3300009792 | Tropical Forest Soil | ENITRPVIENVYIGQRPAAAAMGDLAKQINALPD* |
| Ga0126374_117925142 | 3300009792 | Tropical Forest Soil | AENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0126382_110341502 | 3300010047 | Tropical Forest Soil | VAAENLTRPVIETVYIGQRPGSVAMTDLAKQINALPD* |
| Ga0134088_101766882 | 3300010304 | Grasslands Soil | VGQPTPKWVAAENITRPVIDSIYTGQKPAKVAMEELARQINALPD* |
| Ga0134067_103569442 | 3300010321 | Grasslands Soil | ENITRPVIDSIYTGQKPAKVAIEELARQINALPD* |
| Ga0134064_101186152 | 3300010325 | Grasslands Soil | AAENITRPVIDSIYTGQKPAKVAMEELARQINALPD* |
| Ga0126370_123656892 | 3300010358 | Tropical Forest Soil | VAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0126376_107217703 | 3300010359 | Tropical Forest Soil | NWQGGQPTPKWVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPD* |
| Ga0126372_103537601 | 3300010360 | Tropical Forest Soil | KWVAAENLTRPVIETIYIGQKPAKVAMEDLARQINALPD* |
| Ga0126372_110255002 | 3300010360 | Tropical Forest Soil | AAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0126378_100692065 | 3300010361 | Tropical Forest Soil | ENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0126377_109517731 | 3300010362 | Tropical Forest Soil | GQPTPKWVAAENVTRPLIESMYTGQKPPKAAMEELAKQINALPE* |
| Ga0126379_124669102 | 3300010366 | Tropical Forest Soil | KWVAAENLTRPVIENVYIGQTPARAAMEDLAKQINALPT* |
| Ga0126379_136317321 | 3300010366 | Tropical Forest Soil | KWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD* |
| Ga0134124_127114302 | 3300010397 | Terrestrial Soil | QGGQPTPKWVAAENLTRPVIENVYIGQKPAPAAMTDLARQINALPD* |
| Ga0126383_111148971 | 3300010398 | Tropical Forest Soil | VAAENITRPIIENVYIGQRPAAAAMGDLAKQINALPD* |
| Ga0137364_104971162 | 3300012198 | Vadose Zone Soil | AAENITRPVIENVYIGQKPAPAAMGELARQINALPD* |
| Ga0137399_107270061 | 3300012203 | Vadose Zone Soil | PKWVAAENLTRPVIESIYTGQKPAKAAMEDLARQINALPD* |
| Ga0137379_113306782 | 3300012209 | Vadose Zone Soil | AENITRPVIENVYIGQKPAPAAMGELARQINALPD* |
| Ga0137378_109395092 | 3300012210 | Vadose Zone Soil | ENLTRPVIENVYIAQKPAAAAMQDLARQINALPD* |
| Ga0137372_101678931 | 3300012350 | Vadose Zone Soil | WVAAENLTRPVIETVYIGQKPAAAAMTDLARQINALPD* |
| Ga0137375_111900071 | 3300012360 | Vadose Zone Soil | WQGGQPTPKWVAAENLTRPVIETVYIGQKPAAAAMTDLARQINALPD* |
| Ga0137375_112076902 | 3300012360 | Vadose Zone Soil | ENLTRPVIESVYTGQKPPKAAMEDLARQIDALPD* |
| Ga0137358_110400772 | 3300012582 | Vadose Zone Soil | VAAENLTRPVIESIYTGQKPAKAAMEDLARQISALPD* |
| Ga0137419_100337266 | 3300012925 | Vadose Zone Soil | VAAENLTRPVIESVYIGQKPAAAAMQDLARQINALPD* |
| Ga0126369_122078531 | 3300012971 | Tropical Forest Soil | ENITRPIIENVYIGQRPAAAAMGDLAKQINALPD* |
| Ga0134077_103138571 | 3300012972 | Grasslands Soil | KWVAAENLPRPVIETVYIGQTPAPAAMTALARQINALPD* |
| Ga0134087_101741942 | 3300012977 | Grasslands Soil | GQPTPKWVAAENITRPVIDSIYTGQKPAKVAMEELARQINALPD* |
| Ga0157378_106722181 | 3300013297 | Miscanthus Rhizosphere | TPKWVAAENLTRPVIETIYIGQKPAKAAMEDLARQINALPE* |
| Ga0134085_103632032 | 3300015359 | Grasslands Soil | AENLTRPVIESIYIGQKPAAAAMGDLARQINALPD* |
| Ga0134083_105760801 | 3300017659 | Grasslands Soil | AAENVTRPVIDSVYTGQRPARAAMEDLAKQITALPD |
| Ga0187766_112677122 | 3300018058 | Tropical Peatland | VPAENLTRPVIENLYIGQKSAQASMEDLARQINALPD |
| Ga0184615_100646463 | 3300018059 | Groundwater Sediment | VAAENLTRPVIESLYIGQKAAQVSMEDLARQINALPD |
| Ga0190265_113141352 | 3300018422 | Soil | AAENVTRPVIEAVYTGQKPPKAAMEDLARQINALPD |
| Ga0066655_112536392 | 3300018431 | Grasslands Soil | TPKWVAAENLTRPVIESVYIGQKPAAAAMQDLARQINALPD |
| Ga0137417_10328972 | 3300024330 | Vadose Zone Soil | WQGGQPTPKWVAAENLTRPVIESVYIGQKPAAAAMQDLARQINALPD |
| Ga0207646_113889032 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NWQVGQPTPRWVAAENLTRPVIESIYIAQKPPRAAMEDLARQINALPV |
| Ga0207706_110213831 | 3300025933 | Corn Rhizosphere | PNWQAGQPTPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD |
| Ga0207651_109704453 | 3300025960 | Switchgrass Rhizosphere | QVGQSTPKWVAAENVTRPVIEAVYTGQKPAKAAMEDLARQINALPE |
| Ga0207703_104406183 | 3300026035 | Switchgrass Rhizosphere | PKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD |
| Ga0207675_1008103201 | 3300026118 | Switchgrass Rhizosphere | KWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD |
| Ga0209761_11359851 | 3300026313 | Grasslands Soil | KWVAAENITRPVIENVYIGQKPAAAAMSDLARQINALPD |
| Ga0209801_13483391 | 3300026326 | Soil | PTPKWVAAENLTRPVIESIYTGQKPAKAAMEDLARQINALPD |
| Ga0209158_10852092 | 3300026333 | Soil | VAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD |
| Ga0209057_12400111 | 3300026342 | Soil | AAENLTRPVIESVYIGQKAAAAAMQDLARQINALPD |
| Ga0257177_10210671 | 3300026480 | Soil | GQPTPKWVAAENITRPVIEAIYTGQKPAKAAMEDLARQINALPD |
| Ga0209160_10161811 | 3300026532 | Soil | WQVGQPTPKWVAAENLTRPVIESIYTGQKPAKAAMEDLARQINALPD |
| Ga0209481_103068072 | 3300027880 | Populus Rhizosphere | WVAAENLTRPVIDSMYTGQKPAKAAMEDLARQINALPD |
| Ga0209583_101875462 | 3300027910 | Watersheds | VPLSSLAENLTRPVIEAVYTGQKPAKSAMEDLARQINALPD |
| Ga0247821_106785222 | 3300028596 | Soil | AAENVTRPVIESMYTGQRPAKAAMEDLAKQINALPE |
| Ga0307302_102832831 | 3300028814 | Soil | AAENVTRPVIEAVYTGQKPAKAAMEDLARQINALPD |
| Ga0247827_111332972 | 3300028889 | Soil | TPKWVAAENVTRPVIETVFIGQRPARDAMEDLTKQINALPT |
| Ga0247826_101676063 | 3300030336 | Soil | AGQPTPKWVAAENLTRPVIESVYIGQRPAKAAMEDLARQINALPT |
| Ga0307468_1004366032 | 3300031740 | Hardwood Forest Soil | QGGQATPKWVAAENLTRPVIENVYIGQKPAAAAMTDLAKQINALPD |
| Ga0307468_1024335881 | 3300031740 | Hardwood Forest Soil | VAAENLTRPVIETIYIGQKPARAAMEDLARQINALPE |
| Ga0318508_11606262 | 3300031780 | Soil | GQPTPKWVAAENITRPIIENVYIGQRPAAAAMGDLAKQINALPD |
| Ga0318565_102389901 | 3300031799 | Soil | PKWVAAENITRPIIENVYIGQRPAAAAMGDLAKQINALPD |
| Ga0318568_106322341 | 3300031819 | Soil | AENLTRPVIENVYIGQKPAAAAMSELARQINALPD |
| Ga0214473_102075814 | 3300031949 | Soil | PKWVAAENLTRPVIESVYIAQEPAPAAMTDLARQINALPD |
| Ga0318559_101820162 | 3300032039 | Soil | WVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD |
| Ga0307470_113368411 | 3300032174 | Hardwood Forest Soil | GQSTPKWVAAENVTRPMIDSMYTGQKPAKAAMEDLAKQINALPE |
| Ga0307471_1037250832 | 3300032180 | Hardwood Forest Soil | PKWVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPE |
| Ga0310812_103319631 | 3300032421 | Soil | WVAAENITRPVIENVYIGQKPAAAAMGELARQINALPD |
| Ga0316622_1030228102 | 3300033416 | Soil | WQNGQPTPKWVAAENLTRPEIENVYIGQKAAKLAMEGLARQIDALPD |
| Ga0326726_112060041 | 3300033433 | Peat Soil | PKWVAAENLTRPEIENVYIGQKAAKPAMEGLARQIDALPD |
| Ga0316627_1006222821 | 3300033482 | Soil | NGQPTPKWVPAENLTRPVIEDMYIGRKAAKEAMADLARQINALPD |
| Ga0316624_111251872 | 3300033486 | Soil | TPKWVPAENLTRPVVESVYIGQKPVKEAMEDLARQINALPD |
| Ga0316617_1004557752 | 3300033557 | Soil | QHGQSTPKWVPAENLTRPVVESVYIGQKPVKEAMEDLARQINALPD |
| Ga0364940_0053520_956_1090 | 3300034164 | Sediment | GQPTPKWVAAENLTRPVIETLYIGQRPARAAMEDLARQINALPV |
| ⦗Top⦘ |