NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080013

Metagenome / Metatranscriptome Family F080013

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080013
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 41 residues
Representative Sequence TPKWVAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD
Number of Associated Samples 100
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.87 %
% of genes near scaffold ends (potentially truncated) 93.91 %
% of genes from short scaffolds (< 2000 bps) 93.04 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.391 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(12.174 % of family members)
Environment Ontology (ENVO) Unclassified
(26.087 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.957 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.48%    β-sheet: 0.00%    Coil/Unstructured: 56.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00528BPD_transp_1 43.48
PF04199Cyclase 1.74
PF00501AMP-binding 0.87
PF01547SBP_bac_1 0.87
PF12680SnoaL_2 0.87
PF11225DUF3024 0.87
PF07969Amidohydro_3 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 1.74

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.39 %
UnclassifiedrootN/A2.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0532563All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300000955|JGI1027J12803_103935857All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300000955|JGI1027J12803_106029174All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300004114|Ga0062593_101374889All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300004268|Ga0066398_10165719All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300004479|Ga0062595_101789053All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300004479|Ga0062595_102540965All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300004782|Ga0062382_10530186All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005174|Ga0066680_10113502All Organisms → cellular organisms → Bacteria1670Open in IMG/M
3300005174|Ga0066680_10827838All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005178|Ga0066688_10547887All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300005295|Ga0065707_10195478All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300005332|Ga0066388_104652096All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300005332|Ga0066388_106593822All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005345|Ga0070692_11325545All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005459|Ga0068867_100216619All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300005518|Ga0070699_100164800All Organisms → cellular organisms → Bacteria1963Open in IMG/M
3300005545|Ga0070695_101124895All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005556|Ga0066707_10732327All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005558|Ga0066698_10563921All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005566|Ga0066693_10064063All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300005764|Ga0066903_101006370All Organisms → cellular organisms → Bacteria1524Open in IMG/M
3300005764|Ga0066903_104479338All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300005841|Ga0068863_100092899All Organisms → cellular organisms → Bacteria2863Open in IMG/M
3300006579|Ga0074054_11717362All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300006804|Ga0079221_10259344All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300006854|Ga0075425_101659659All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300006854|Ga0075425_101749093All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300006854|Ga0075425_102419021All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300006881|Ga0068865_100776190All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300006894|Ga0079215_10946865All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300006904|Ga0075424_100497581All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300006904|Ga0075424_102151688All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300006914|Ga0075436_100096860All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300006930|Ga0079303_10118806All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300007076|Ga0075435_102026787All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300009091|Ga0102851_11716198All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300009091|Ga0102851_12954700Not Available546Open in IMG/M
3300009100|Ga0075418_12479033All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300009111|Ga0115026_11476513All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300009137|Ga0066709_102101605All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300009147|Ga0114129_10327776All Organisms → cellular organisms → Bacteria2034Open in IMG/M
3300009162|Ga0075423_11174316All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300009176|Ga0105242_11320291All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300009545|Ga0105237_11842559All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300009792|Ga0126374_10454845All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300009792|Ga0126374_11012782All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300009792|Ga0126374_11792514All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300010047|Ga0126382_11034150All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300010304|Ga0134088_10176688All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300010321|Ga0134067_10356944All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300010325|Ga0134064_10118615All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300010358|Ga0126370_12365689All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010359|Ga0126376_10721770All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300010360|Ga0126372_10353760All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300010360|Ga0126372_11025500Not Available838Open in IMG/M
3300010361|Ga0126378_10069206All Organisms → cellular organisms → Bacteria3373Open in IMG/M
3300010362|Ga0126377_10951773All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300010366|Ga0126379_12466910All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300010366|Ga0126379_13631732All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300010397|Ga0134124_12711430All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010398|Ga0126383_11114897All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300012198|Ga0137364_10497116All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300012203|Ga0137399_10727006All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300012209|Ga0137379_11330678All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300012210|Ga0137378_10939509Not Available778Open in IMG/M
3300012350|Ga0137372_10167893All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300012360|Ga0137375_11190007All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012360|Ga0137375_11207690All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012582|Ga0137358_11040077All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012925|Ga0137419_10033726All Organisms → cellular organisms → Bacteria3165Open in IMG/M
3300012971|Ga0126369_12207853All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300012972|Ga0134077_10313857All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300012977|Ga0134087_10174194All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300013297|Ga0157378_10672218All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300015359|Ga0134085_10363203All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300017659|Ga0134083_10576080All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300018058|Ga0187766_11267712All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300018059|Ga0184615_10064646All Organisms → cellular organisms → Bacteria2042Open in IMG/M
3300018422|Ga0190265_11314135All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300018431|Ga0066655_11253639All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300024330|Ga0137417_1032897All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300025922|Ga0207646_11388903All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300025933|Ga0207706_11021383All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300025960|Ga0207651_10970445All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300026035|Ga0207703_10440618All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300026118|Ga0207675_100810320All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300026313|Ga0209761_1135985All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300026326|Ga0209801_1348339All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300026333|Ga0209158_1085209All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300026342|Ga0209057_1240011All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300026480|Ga0257177_1021067All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300026532|Ga0209160_1016181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5186Open in IMG/M
3300027880|Ga0209481_10306807All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300027910|Ga0209583_10187546All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300028596|Ga0247821_10678522All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300028814|Ga0307302_10283283All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300028889|Ga0247827_11133297All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300030336|Ga0247826_10167606All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300031740|Ga0307468_100436603All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300031740|Ga0307468_102433588All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031780|Ga0318508_1160626All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300031799|Ga0318565_10238990All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300031819|Ga0318568_10632234All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300031949|Ga0214473_10207581All Organisms → cellular organisms → Bacteria2265Open in IMG/M
3300032039|Ga0318559_10182016All Organisms → cellular organisms → Bacteria → Terrabacteria group963Open in IMG/M
3300032174|Ga0307470_11336841All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300032180|Ga0307471_103725083All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300032421|Ga0310812_10331963All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300033416|Ga0316622_103022810All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300033433|Ga0326726_11206004All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300033482|Ga0316627_100622282All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300033486|Ga0316624_11125187All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300033557|Ga0316617_100455775All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300034164|Ga0364940_0053520All Organisms → cellular organisms → Bacteria1091Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.35%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.61%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.74%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.87%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.87%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.87%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_053256323300000033SoilQVGQGTPKWVAAENVTRPVIEAVYTGQKAPKAAMEDLARQINALPE*
JGI1027J12803_10393585713300000955SoilQSTPKWVAAENVTRPVIESMYTGQKPAKAAMEDLAKQINALPE*
JGI1027J12803_10602917423300000955SoilVGQPTPKWVAAENVTRPLIESMYTGQKPAKAAMEELAKQINALPE*
Ga0062593_10137488923300004114SoilPNWQAGQPTPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD*
Ga0066398_1016571923300004268Tropical Forest SoilGQPTPKWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0062595_10178905313300004479SoilWQGGQPTPKWVAAENLTRPVIETIYIGQKPAKAAMEDLARQINALPE*
Ga0062595_10254096523300004479SoilQPTPRWVAAENLTRPVIESVYIGQKPGKAAMEDLVRQINALPV*
Ga0062382_1053018613300004782Wetland SedimentQPTPKWVAAGNLTRPEIENVYIGQKAAKVAMEGLARQIDALPD*
Ga0066680_1011350213300005174SoilVGQPTPKWVAAENLTRPVIESVYTGQKPAKAAMEDLARQINALPE*
Ga0066680_1082783813300005174SoilNWQVGQPTPKWVAAENITRPMIDSIYTGQKPAKVAMEELARQINALPD*
Ga0066688_1054788723300005178SoilNWQVGQPTPKWVAAENITRPVIDSIYTGQKPAKVAMEELARQINALPD*
Ga0065707_1019547813300005295Switchgrass RhizosphereGQPTPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD*
Ga0066388_10465209613300005332Tropical Forest SoilGGQPTPKWVAAENLTRPVIETIYIGQKPAGSAMSDLAKQVNALPD*
Ga0066388_10659382223300005332Tropical Forest SoilKWVAAENLTRPVIETVYIGQKPGRPAMEDLARQINALPE*
Ga0070692_1132554523300005345Corn, Switchgrass And Miscanthus RhizospherePTPKWVAAENITRPVIENVYIGQKPAAAAMGELARQINALPD*
Ga0068867_10021661933300005459Miscanthus RhizosphereQPTPRWVAAENLTRPVIESIYIAQKPPRAAMEDLARQINALPV*
Ga0070699_10016480013300005518Corn, Switchgrass And Miscanthus RhizosphereRWVAAENLTRPVIESIYIAQKPPRGAMEDLARQINALPV*
Ga0070695_10112489523300005545Corn, Switchgrass And Miscanthus RhizosphereVGQPTPRWVAAENLTRPVIESIYIAQKPPRGAMEDLARQINALPV*
Ga0066707_1073232723300005556SoilQPTPKWVAAENLTRPVIENVYIAQKPAAAAMQDLARQINALPD*
Ga0066698_1056392123300005558SoilKWVAAENLTRPVIETIYIGQKPARTAMEDLARQINALPE*
Ga0066693_1006406313300005566SoilQPTPKWVAAENLTRPVIESIYTGQKPAKAAMEDLARQISALPD*
Ga0066903_10100637013300005764Tropical Forest SoilENITRPIIENVYIGQRPAASAMGELAKQINALPD*
Ga0066903_10447933823300005764Tropical Forest SoilNWQGGQPTPKWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0068863_10009289913300005841Switchgrass RhizosphereGQPTPKWVAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD*
Ga0074054_1171736213300006579SoilPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD*
Ga0079221_1025934423300006804Agricultural SoilENLTRPVIETIYIGQKPARAAMEDLARQINALPE*
Ga0075425_10165965923300006854Populus RhizosphereTPKWVAAENITRPVIENVYIGQKPAAAAMGELARQINALPD*
Ga0075425_10174909313300006854Populus RhizosphereKWVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPE*
Ga0075425_10241902123300006854Populus RhizosphereWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0068865_10077619023300006881Miscanthus RhizosphereQPTPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD*
Ga0079215_1094686533300006894Agricultural SoilKWVAAENLTRPVIESVYTAQRPGKAAMEDLARQINALPD*
Ga0075424_10049758113300006904Populus RhizosphereENLTRPVIESVYIGQKPGKAAMEDLVRQINALPV*
Ga0075424_10215168823300006904Populus RhizospherePKWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0075436_10009686043300006914Populus RhizosphereAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD*
Ga0079303_1011880613300006930Deep SubsurfaceTPKWVAAENLTRPEIENVYIGQKAAKLAMEGLARQIDALPD*
Ga0075435_10202678723300007076Populus RhizosphereWVAAENLTRPVIESVYIGQKPAAAAMQDLARQINALPD*
Ga0102851_1171619813300009091Freshwater WetlandsWQNGQPTPKWVPAENLTRPVIEDMYIGRRAAKEAMADLARQINALPD*
Ga0102851_1295470023300009091Freshwater WetlandsVAAENLTRPEIENVYIGQKAAKLAMEGLARQIDALPD*
Ga0075418_1247903323300009100Populus RhizosphereAAENLTRPVIETVYIGQRPARAAMEDLARQINALPE*
Ga0115026_1147651323300009111WetlandPKWVAAENLTRPVIESLYIGQKTAQASMEDLTRQINALPD*
Ga0066709_10210160513300009137Grasslands SoilPKWVAAENITRPVIENVYIGQKPAAAAMSDLARQINALPD*
Ga0114129_1032777613300009147Populus RhizosphereTPKWVAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD*
Ga0075423_1117431623300009162Populus RhizosphereQPTPKWVAAENVTRPVIDSMYTGQKPPKAAMEDLAKQINGLPD*
Ga0105242_1132029123300009176Miscanthus RhizosphereGQPTPKWVAAENLTRPVIENVYIGQKPAPAAMTDLARQINALPD*
Ga0105237_1184255913300009545Corn RhizosphereVAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD*
Ga0126374_1045484513300009792Tropical Forest SoilPTPKWVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPE*
Ga0126374_1101278213300009792Tropical Forest SoilENITRPVIENVYIGQRPAAAAMGDLAKQINALPD*
Ga0126374_1179251423300009792Tropical Forest SoilAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0126382_1103415023300010047Tropical Forest SoilVAAENLTRPVIETVYIGQRPGSVAMTDLAKQINALPD*
Ga0134088_1017668823300010304Grasslands SoilVGQPTPKWVAAENITRPVIDSIYTGQKPAKVAMEELARQINALPD*
Ga0134067_1035694423300010321Grasslands SoilENITRPVIDSIYTGQKPAKVAIEELARQINALPD*
Ga0134064_1011861523300010325Grasslands SoilAAENITRPVIDSIYTGQKPAKVAMEELARQINALPD*
Ga0126370_1236568923300010358Tropical Forest SoilVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0126376_1072177033300010359Tropical Forest SoilNWQGGQPTPKWVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPD*
Ga0126372_1035376013300010360Tropical Forest SoilKWVAAENLTRPVIETIYIGQKPAKVAMEDLARQINALPD*
Ga0126372_1102550023300010360Tropical Forest SoilAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0126378_1006920653300010361Tropical Forest SoilENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0126377_1095177313300010362Tropical Forest SoilGQPTPKWVAAENVTRPLIESMYTGQKPPKAAMEELAKQINALPE*
Ga0126379_1246691023300010366Tropical Forest SoilKWVAAENLTRPVIENVYIGQTPARAAMEDLAKQINALPT*
Ga0126379_1363173213300010366Tropical Forest SoilKWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD*
Ga0134124_1271143023300010397Terrestrial SoilQGGQPTPKWVAAENLTRPVIENVYIGQKPAPAAMTDLARQINALPD*
Ga0126383_1111489713300010398Tropical Forest SoilVAAENITRPIIENVYIGQRPAAAAMGDLAKQINALPD*
Ga0137364_1049711623300012198Vadose Zone SoilAAENITRPVIENVYIGQKPAPAAMGELARQINALPD*
Ga0137399_1072700613300012203Vadose Zone SoilPKWVAAENLTRPVIESIYTGQKPAKAAMEDLARQINALPD*
Ga0137379_1133067823300012209Vadose Zone SoilAENITRPVIENVYIGQKPAPAAMGELARQINALPD*
Ga0137378_1093950923300012210Vadose Zone SoilENLTRPVIENVYIAQKPAAAAMQDLARQINALPD*
Ga0137372_1016789313300012350Vadose Zone SoilWVAAENLTRPVIETVYIGQKPAAAAMTDLARQINALPD*
Ga0137375_1119000713300012360Vadose Zone SoilWQGGQPTPKWVAAENLTRPVIETVYIGQKPAAAAMTDLARQINALPD*
Ga0137375_1120769023300012360Vadose Zone SoilENLTRPVIESVYTGQKPPKAAMEDLARQIDALPD*
Ga0137358_1104007723300012582Vadose Zone SoilVAAENLTRPVIESIYTGQKPAKAAMEDLARQISALPD*
Ga0137419_1003372663300012925Vadose Zone SoilVAAENLTRPVIESVYIGQKPAAAAMQDLARQINALPD*
Ga0126369_1220785313300012971Tropical Forest SoilENITRPIIENVYIGQRPAAAAMGDLAKQINALPD*
Ga0134077_1031385713300012972Grasslands SoilKWVAAENLPRPVIETVYIGQTPAPAAMTALARQINALPD*
Ga0134087_1017419423300012977Grasslands SoilGQPTPKWVAAENITRPVIDSIYTGQKPAKVAMEELARQINALPD*
Ga0157378_1067221813300013297Miscanthus RhizosphereTPKWVAAENLTRPVIETIYIGQKPAKAAMEDLARQINALPE*
Ga0134085_1036320323300015359Grasslands SoilAENLTRPVIESIYIGQKPAAAAMGDLARQINALPD*
Ga0134083_1057608013300017659Grasslands SoilAAENVTRPVIDSVYTGQRPARAAMEDLAKQITALPD
Ga0187766_1126771223300018058Tropical PeatlandVPAENLTRPVIENLYIGQKSAQASMEDLARQINALPD
Ga0184615_1006464633300018059Groundwater SedimentVAAENLTRPVIESLYIGQKAAQVSMEDLARQINALPD
Ga0190265_1131413523300018422SoilAAENVTRPVIEAVYTGQKPPKAAMEDLARQINALPD
Ga0066655_1125363923300018431Grasslands SoilTPKWVAAENLTRPVIESVYIGQKPAAAAMQDLARQINALPD
Ga0137417_103289723300024330Vadose Zone SoilWQGGQPTPKWVAAENLTRPVIESVYIGQKPAAAAMQDLARQINALPD
Ga0207646_1138890323300025922Corn, Switchgrass And Miscanthus RhizosphereNWQVGQPTPRWVAAENLTRPVIESIYIAQKPPRAAMEDLARQINALPV
Ga0207706_1102138313300025933Corn RhizospherePNWQAGQPTPKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD
Ga0207651_1097044533300025960Switchgrass RhizosphereQVGQSTPKWVAAENVTRPVIEAVYTGQKPAKAAMEDLARQINALPE
Ga0207703_1044061833300026035Switchgrass RhizospherePKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD
Ga0207675_10081032013300026118Switchgrass RhizosphereKWVAAENLTRPVIESVYTAQKPGKAAMEDLARQINALPD
Ga0209761_113598513300026313Grasslands SoilKWVAAENITRPVIENVYIGQKPAAAAMSDLARQINALPD
Ga0209801_134833913300026326SoilPTPKWVAAENLTRPVIESIYTGQKPAKAAMEDLARQINALPD
Ga0209158_108520923300026333SoilVAAENLTRPVIEAVYTGQKPAKAAMEDLARQINALPD
Ga0209057_124001113300026342SoilAAENLTRPVIESVYIGQKAAAAAMQDLARQINALPD
Ga0257177_102106713300026480SoilGQPTPKWVAAENITRPVIEAIYTGQKPAKAAMEDLARQINALPD
Ga0209160_101618113300026532SoilWQVGQPTPKWVAAENLTRPVIESIYTGQKPAKAAMEDLARQINALPD
Ga0209481_1030680723300027880Populus RhizosphereWVAAENLTRPVIDSMYTGQKPAKAAMEDLARQINALPD
Ga0209583_1018754623300027910WatershedsVPLSSLAENLTRPVIEAVYTGQKPAKSAMEDLARQINALPD
Ga0247821_1067852223300028596SoilAAENVTRPVIESMYTGQRPAKAAMEDLAKQINALPE
Ga0307302_1028328313300028814SoilAAENVTRPVIEAVYTGQKPAKAAMEDLARQINALPD
Ga0247827_1113329723300028889SoilTPKWVAAENVTRPVIETVFIGQRPARDAMEDLTKQINALPT
Ga0247826_1016760633300030336SoilAGQPTPKWVAAENLTRPVIESVYIGQRPAKAAMEDLARQINALPT
Ga0307468_10043660323300031740Hardwood Forest SoilQGGQATPKWVAAENLTRPVIENVYIGQKPAAAAMTDLAKQINALPD
Ga0307468_10243358813300031740Hardwood Forest SoilVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPE
Ga0318508_116062623300031780SoilGQPTPKWVAAENITRPIIENVYIGQRPAAAAMGDLAKQINALPD
Ga0318565_1023899013300031799SoilPKWVAAENITRPIIENVYIGQRPAAAAMGDLAKQINALPD
Ga0318568_1063223413300031819SoilAENLTRPVIENVYIGQKPAAAAMSELARQINALPD
Ga0214473_1020758143300031949SoilPKWVAAENLTRPVIESVYIAQEPAPAAMTDLARQINALPD
Ga0318559_1018201623300032039SoilWVAAENLTRPVIETVYIGQKPAGSAMSDLAKQVNALPD
Ga0307470_1133684113300032174Hardwood Forest SoilGQSTPKWVAAENVTRPMIDSMYTGQKPAKAAMEDLAKQINALPE
Ga0307471_10372508323300032180Hardwood Forest SoilPKWVAAENLTRPVIETIYIGQKPARAAMEDLARQINALPE
Ga0310812_1033196313300032421SoilWVAAENITRPVIENVYIGQKPAAAAMGELARQINALPD
Ga0316622_10302281023300033416SoilWQNGQPTPKWVAAENLTRPEIENVYIGQKAAKLAMEGLARQIDALPD
Ga0326726_1120600413300033433Peat SoilPKWVAAENLTRPEIENVYIGQKAAKPAMEGLARQIDALPD
Ga0316627_10062228213300033482SoilNGQPTPKWVPAENLTRPVIEDMYIGRKAAKEAMADLARQINALPD
Ga0316624_1112518723300033486SoilTPKWVPAENLTRPVVESVYIGQKPVKEAMEDLARQINALPD
Ga0316617_10045577523300033557SoilQHGQSTPKWVPAENLTRPVVESVYIGQKPVKEAMEDLARQINALPD
Ga0364940_0053520_956_10903300034164SedimentGQPTPKWVAAENLTRPVIETLYIGQRPARAAMEDLARQINALPV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.