 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F079999 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGK |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.74 % |
| % of genes near scaffold ends (potentially truncated) | 14.78 % |
| % of genes from short scaffolds (< 2000 bps) | 57.39 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.609 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (35.652 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.522 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (45.217 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.73% β-sheet: 0.00% Coil/Unstructured: 27.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF02767 | DNA_pol3_beta_2 | 2.61 |
| PF07659 | DUF1599 | 1.74 |
| PF00145 | DNA_methylase | 1.74 |
| PF07275 | ArdA | 1.74 |
| PF05869 | Dam | 0.87 |
| PF02945 | Endonuclease_7 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 2.61 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.74 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 1.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.61 % |
| All Organisms | root | All Organisms | 37.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 35.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 14.78% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.96% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.09% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.35% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.61% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.74% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.87% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.87% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.87% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.87% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.87% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0007787_100481031 | 3300004240 | Freshwater Lake | VRDIFELSFRWQDGFIQVLIYALVIYLGLVILSKITDKREREGKR* |
| Ga0068876_100608662 | 3300005527 | Freshwater Lake | VGYQGERGRESVKDIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKREGK* |
| Ga0068876_105703392 | 3300005527 | Freshwater Lake | MSDLFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKRKGEGR* |
| Ga0049081_1001819410 | 3300005581 | Freshwater Lentic | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGK* |
| Ga0049081_100324457 | 3300005581 | Freshwater Lentic | MGDLFELSFRWQDGAAQVIIYALVIYLGLVIISKIS |
| Ga0049081_100973522 | 3300005581 | Freshwater Lentic | VSDIFELSFRWQDGAVQVLIYALVIYLGLVILSKITDKREREGKK* |
| Ga0079957_104324110 | 3300005805 | Lake | VSDLFELSFRWQDGAVQVLIYCAIITGGLYLLSKINIKEREGDNE* |
| Ga0075461_100104658 | 3300006637 | Aqueous | VRDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNG* |
| Ga0070749_101985453 | 3300006802 | Aqueous | VRDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKRERGR* |
| Ga0075472_100397514 | 3300006917 | Aqueous | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGKK* |
| Ga0075458_100029985 | 3300007363 | Aqueous | MRGGEQVRDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNG* |
| Ga0099848_11608093 | 3300007541 | Aqueous | VSDIFELSFRWQDGAIQVIIYALAIYLGLVAISKITDKREREG* |
| Ga0104986_127613 | 3300007734 | Freshwater | VGYQGERGRESVKDIFELSFRWQDGAVQVIIYALVIYLGLVIISKITDKRKREGK* |
| Ga0099850_12189552 | 3300007960 | Aqueous | MRGGEQVRDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREG* |
| Ga0105746_10438392 | 3300007973 | Estuary Water | MGDLFELSFRWQDGAAQVIIYALVIYLGLVIISKITDKRKGKR* |
| Ga0108970_100069886 | 3300008055 | Estuary | MGDIFELSFRWQDGFIQFLIYCAIITGGLYLLSKIEIKEREGDND* |
| Ga0114350_10296936 | 3300008116 | Freshwater, Plankton | VGYQGERGRESVKDIFELSFRWQDGAAQVIIYALVIYLGLVIISKISDKRKGKR* |
| Ga0114350_10779764 | 3300008116 | Freshwater, Plankton | VGYQGERGRESVSDIFELSFRWQDGAVQVIIYALVIYLGLVIISKITDKREGK* |
| Ga0114351_10261656 | 3300008117 | Freshwater, Plankton | VSDIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKREGKR* |
| Ga0114841_10296357 | 3300008259 | Freshwater, Plankton | MGDLFELSFRWQDGAAQVIIYALVIYLGLVIISKISDKRKR* |
| Ga0114349_10506445 | 3300008263 | Freshwater, Plankton | VREIFELSFRWQDGAIQVIIYALVIYLGLVIISKISDKREGK* |
| Ga0114349_11362341 | 3300008263 | Freshwater, Plankton | VGYQGERGRESVREIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKREGKR* |
| Ga0114363_10789572 | 3300008266 | Freshwater, Plankton | MGDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGDNERN* |
| Ga0114363_11517702 | 3300008266 | Freshwater, Plankton | MGDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKRERGR* |
| Ga0127391_10140014 | 3300009450 | Meromictic Pond | MSDIFELSFRWQDGFIQVLIYCAIIIGGLYLLSKINIKEREGDNE* |
| Ga0129333_1012590310 | 3300010354 | Freshwater To Marine Saline Gradient | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREG |
| Ga0129333_102566394 | 3300010354 | Freshwater To Marine Saline Gradient | VRDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKK* |
| Ga0151514_1047334 | 3300011115 | Freshwater | VGYQGERGRESVKDIFELSFRWQDGAVQVIIYALVIYLGLVIISKITDKRKREGKR* |
| Ga0153799_10472244 | 3300012012 | Freshwater | SMRGGERVSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGKR* |
| Ga0164293_105204613 | 3300013004 | Freshwater | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGKR* |
| Ga0164292_103773283 | 3300013005 | Freshwater | VSDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGKK* |
| (restricted) Ga0172374_12573372 | 3300013122 | Freshwater | VCRERGGESVSDLFELSFRWQDGAIQIIIYAAVIYLGLVVISKITDKREGKR* |
| (restricted) Ga0172367_105347942 | 3300013126 | Freshwater | MGDLFEISFRWQDGAVQVIIYAAVIYLGLVVISKISDKREGKR* |
| Ga0177922_107723202 | 3300013372 | Freshwater | VGYQGERGRESVREIFELSFRWQDGAIQVIIYALVIYLGLVIISKITDKREGKR* |
| (restricted) Ga0172376_105024082 | 3300014720 | Freshwater | MGDLFELSFRWQDGAVQVIIYAAVIYLGLVIISKISDKREGKR* |
| Ga0169931_110303242 | 3300017788 | Freshwater | MGDLFELSFRWQDGAVQVIIYALVIYLGLVVISKITDKRKRER |
| Ga0211729_110942264 | 3300020172 | Freshwater | MGDIFELSFRWQDGAIQVIIYALVIYLGLVIISKISDKRKR |
| Ga0194115_100553615 | 3300020183 | Freshwater Lake | VSDLFELSFRWQDGAVQVIIYAIVIYLGLVIATSLTDKRERKKDENA |
| Ga0222714_101306581 | 3300021961 | Estuarine Water | VRDLFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKK |
| Ga0222714_101992176 | 3300021961 | Estuarine Water | VRDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKK |
| Ga0222713_100651528 | 3300021962 | Estuarine Water | VSDLFELSFRWQDGAVQVIIYALVIYLGLVIISKITDKREREGKK |
| Ga0222713_103562374 | 3300021962 | Estuarine Water | VRDIFELSFRWQDGFVQVLIYALVIYLGLVIISKITDKREREGKR |
| Ga0222713_103600324 | 3300021962 | Estuarine Water | MGDLFELSFRWQDGAAQVIIYALVIYLGLVIISKISDKRERKK |
| Ga0222713_107830882 | 3300021962 | Estuarine Water | VRDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKR |
| Ga0222712_105981534 | 3300021963 | Estuarine Water | VRDLFELSFRWQDGFIQVLIYALVIYLGLVILSKITDKR |
| Ga0196905_11132343 | 3300022198 | Aqueous | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKRERGR |
| Ga0214917_101749524 | 3300022752 | Freshwater | MRGGEQVKDIFELSFRWQDGFIQVLIYALVIYLGLVILSKITDKREREGK |
| Ga0214923_100684014 | 3300023179 | Freshwater | VKDIFELSFRWQDGFIQVLIYALVIYLGLVILSKITDKREREGK |
| Ga0214923_106252123 | 3300023179 | Freshwater | VRDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGDNG |
| Ga0255186_10316331 | 3300024512 | Freshwater | VRDIFELSFRWQDGFIQVLIYVLVIYLGLVIISKITD |
| Ga0208004_10087248 | 3300025630 | Aqueous | VRDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNG |
| Ga0208644_10560295 | 3300025889 | Aqueous | MRGGEQVRDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNG |
| Ga0208644_11369425 | 3300025889 | Aqueous | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGKK |
| Ga0255072_10648594 | 3300027508 | Freshwater | FELSFRWQDGFIQFLIYALVIYLGLVIISKITDKREREGKR |
| Ga0255077_10986491 | 3300027529 | Freshwater | VRDLFELSFRWQDGFIQFLIYALVIYLGLVIISKITDK |
| Ga0208975_10119453 | 3300027659 | Freshwater Lentic | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGK |
| Ga0208975_10220171 | 3300027659 | Freshwater Lentic | MGDLFELSFRWQDGAAQVIIYALVIYLGLVIISKI |
| Ga0208975_10597592 | 3300027659 | Freshwater Lentic | VRGGERVSDIFELSFRWQDGAVQVLIYALVIYLGLVILSKITDKREREGKK |
| Ga0209033_10235552 | 3300027697 | Freshwater Lake | VRDIFELSFRWQDGFIQVLIYALVIYLGLVILSKITDKREREGKR |
| Ga0209972_1000618615 | 3300027793 | Freshwater Lake | VKDIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKREGK |
| Ga0209972_100245549 | 3300027793 | Freshwater Lake | MSDLFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKRKGEGR |
| Ga0209358_104003542 | 3300027804 | Freshwater Lake | MSDLFELSFRWQDGAVQVIIYALVIYLGLVIISKMSDKRKGEGR |
| Ga0209229_103856962 | 3300027805 | Freshwater And Sediment | VGYQGEKGRESVRDIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKRKR |
| Ga0209985_100249958 | 3300027806 | Freshwater Lake | VGYQGERGRESVKDIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKREGK |
| Ga0315907_100816365 | 3300031758 | Freshwater | VGYQGERGRESVREIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKREGKR |
| Ga0315907_101453532 | 3300031758 | Freshwater | VREIFELSFRWQDGAIQVIIYALVIYLGLVIISKISDKREGK |
| Ga0315907_107784264 | 3300031758 | Freshwater | LSFRWQDGAVQVIIYALAIWLGLVIISKISDKRKRER |
| Ga0315909_100395114 | 3300031857 | Freshwater | VSDIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKREGKR |
| Ga0315909_100749645 | 3300031857 | Freshwater | VSDIFELSFRWQDGAVQVIIYALAIWLGLVIISKISDKRKRER |
| Ga0315909_100769427 | 3300031857 | Freshwater | MGDLFELSFRWQDGAAQVIIYALVIYLGLVIISKISDKRKR |
| Ga0315909_100947653 | 3300031857 | Freshwater | VSDIFELSFRWQDGAVQVIIYALVIYLGLVIISKISDKREGK |
| Ga0315909_101861423 | 3300031857 | Freshwater | MGDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGDNERN |
| Ga0315909_108768441 | 3300031857 | Freshwater | VRDIFELSFRWQDGAVQVLIYALVIYLGLVILSKITDKREREGKR |
| Ga0315904_102152925 | 3300031951 | Freshwater | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGKR |
| Ga0315904_104963333 | 3300031951 | Freshwater | VSDMFELSFRWQDGFIQVLIYALVIYLGLVILSKITDKREREGKR |
| Ga0315904_109829503 | 3300031951 | Freshwater | MREGGEQVRDIFELSFRWQDGFIQVLIYALVIYLGLVILSKITDKKEREGK |
| Ga0315904_114594721 | 3300031951 | Freshwater | VGYQGERGRESVSDIFELSFRWQDGAVQVIIYALVIYLGLVIISKITDKREGK |
| Ga0315901_103471805 | 3300031963 | Freshwater | VSDMFELSFRWQDGFIQVLIYALVIYLGLVILSKITDKREREGK |
| Ga0315906_102839501 | 3300032050 | Freshwater | MGDIFELSFRWQDGFIQVLIYCAIITGGLYLLSKIQIKERE |
| Ga0315905_107642622 | 3300032092 | Freshwater | VGYQGERGRESVREIFELSFRWQDGAVQVIIYALVIYLGLVIISKITDKREGK |
| Ga0315902_105306541 | 3300032093 | Freshwater | VGYQGEKGRESVRDIFELSFRWQDGAVQVIIYALVIYLGLVIISKITDKREGK |
| Ga0334977_0257136_45_194 | 3300033978 | Freshwater | VSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGDNEGKK |
| Ga0334977_0550192_336_473 | 3300033978 | Freshwater | MSDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKK |
| Ga0334978_0020817_2419_2544 | 3300033979 | Freshwater | MFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGK |
| Ga0334978_0322888_409_549 | 3300033979 | Freshwater | MSDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGDNE |
| Ga0334982_0022050_1919_2068 | 3300033981 | Freshwater | MSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGDNEGKK |
| Ga0334982_0028915_773_910 | 3300033981 | Freshwater | MRDIFELSFRWQDGAVQVLIYCAIITGGLYLLSKINIKEREGDNE |
| Ga0334994_0014109_1453_1590 | 3300033993 | Freshwater | MSDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGKR |
| Ga0334979_0497155_356_535 | 3300033996 | Freshwater | MREGGKRVSDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNEYKPDRP |
| Ga0334998_0073884_20_157 | 3300034019 | Freshwater | MSDIFELSFRWQDGAVQVLIYCAIITGGLYLLSKINIKEREGDNE |
| Ga0335004_0063655_2384_2521 | 3300034021 | Freshwater | MRDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKK |
| Ga0335004_0456648_8_145 | 3300034021 | Freshwater | MSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGKK |
| Ga0335021_0324945_335_469 | 3300034023 | Freshwater | MGDIFELSFRWQDGAVQVLIYALVIYLGLVILSKITDKREREGK |
| Ga0335001_0018396_2133_2270 | 3300034064 | Freshwater | MRDIFELSFRWQDGAVQVLIYALVIYLGLVILSKITDKREREGKK |
| Ga0335001_0176574_837_977 | 3300034064 | Freshwater | MSDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNE |
| Ga0335028_0024769_2225_2362 | 3300034071 | Freshwater | MGDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKK |
| Ga0310130_0196393_378_536 | 3300034073 | Fracking Water | VYRRGKVKDLFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGDNG |
| Ga0335025_0029927_483_620 | 3300034096 | Freshwater | MSDIFELSFRWQDGLVQVIIYALVIYLGLVIISKITDKREREGKR |
| Ga0335025_0048399_2616_2786 | 3300034096 | Freshwater | MREGGKRVSDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNEYKPD |
| Ga0335025_0474139_1_132 | 3300034096 | Freshwater | SDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGE |
| Ga0335027_0012117_4180_4317 | 3300034101 | Freshwater | MRDIFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKR |
| Ga0335027_0080512_1123_1272 | 3300034101 | Freshwater | MSDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNEGKK |
| Ga0335030_0012845_4206_4361 | 3300034103 | Freshwater | MGDIFELSFRWQDGFVQFLIYCAIITGGLYLLSKIQIKEREGDNEYKPNKP |
| Ga0335030_0069326_667_804 | 3300034103 | Freshwater | MGDIFELSFRWQDGFIQFLIYALVIYLGLVIISKITDKREREGKK |
| Ga0335035_0213349_866_1000 | 3300034105 | Freshwater | MSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGK |
| Ga0335036_0106300_142_279 | 3300034106 | Freshwater | MRDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGKR |
| Ga0335066_0050677_1864_2010 | 3300034112 | Freshwater | MSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKREREGDNEGR |
| Ga0335066_0274453_3_122 | 3300034112 | Freshwater | MRDLFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKRE |
| Ga0335066_0544290_133_267 | 3300034112 | Freshwater | MSDIFELSFRWQDGLVQVLIYALVIYLGLVILSKITDKREREGK |
| Ga0335066_0587791_373_510 | 3300034112 | Freshwater | MSDLFELSFRWQDGFIQVLIYALVIYLGLVIISKITDKREREGKK |
| Ga0335068_0007480_1408_1545 | 3300034116 | Freshwater | MSDIFELSFRWQDGAVQVLIYALVIYLGLVILSKITDKREREGKR |
| Ga0335060_0163149_651_788 | 3300034122 | Freshwater | MSDIFELSFRWQDGAVQVLIYALVIYLGLVILSKITDKREREGKK |
| Ga0335039_0032106_341_520 | 3300034355 | Freshwater | MREGGKRVSDIFELSFRWQDGLVQVLIYALVIYLGLVIISKITDKREREGDNEYKPDRA |
| Ga0335048_0191816_263_397 | 3300034356 | Freshwater | MGDIFELSFRWQDGFVQFLIYALVIYLGLVIISKITDKREREGK |
| Ga0348335_077445_3_125 | 3300034374 | Aqueous | MSDIFELSFRWQDGAVQVLIYALVIYLGLVIISKITDKRER |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |