Basic Information | |
---|---|
Family ID | F079977 |
Family Type | Metagenome |
Number of Sequences | 115 |
Average Sequence Length | 46 residues |
Representative Sequence | MSDLYSILADWYPEGNYTEADLWEAIAESEGVDVNEIMDRDLAEFI |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 72.17 % |
% of genes near scaffold ends (potentially truncated) | 21.74 % |
% of genes from short scaffolds (< 2000 bps) | 68.70 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (45.217 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (16.522 % of family members) |
Environment Ontology (ENVO) | Unclassified (65.217 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.304 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 14.91 |
PF07275 | ArdA | 2.63 |
PF11171 | DUF2958 | 1.75 |
PF04488 | Gly_transf_sug | 0.88 |
PF13578 | Methyltransf_24 | 0.88 |
PF04820 | Trp_halogenase | 0.88 |
PF00877 | NLPC_P60 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 2.63 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.22 % |
Unclassified | root | N/A | 34.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000268|M3P_10057023 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
3300002091|JGI24028J26656_1012908 | Not Available | 956 | Open in IMG/M |
3300002408|B570J29032_108760241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300002835|B570J40625_100792298 | Not Available | 834 | Open in IMG/M |
3300003493|JGI25923J51411_1040510 | Not Available | 865 | Open in IMG/M |
3300003802|Ga0007840_1007869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 662 | Open in IMG/M |
3300003804|Ga0007817_1004644 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
3300003804|Ga0007817_1004652 | Not Available | 1016 | Open in IMG/M |
3300003815|Ga0007856_1009506 | Not Available | 657 | Open in IMG/M |
3300004692|Ga0065171_1061843 | Not Available | 594 | Open in IMG/M |
3300004770|Ga0007804_1106881 | Not Available | 710 | Open in IMG/M |
3300005527|Ga0068876_10036571 | All Organisms → Viruses → Predicted Viral | 3040 | Open in IMG/M |
3300005527|Ga0068876_10694023 | Not Available | 544 | Open in IMG/M |
3300005581|Ga0049081_10289829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300005581|Ga0049081_10318370 | Not Available | 533 | Open in IMG/M |
3300005662|Ga0078894_10268834 | All Organisms → Viruses → Predicted Viral | 1547 | Open in IMG/M |
3300005662|Ga0078894_11112525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300006071|Ga0007876_1011170 | Not Available | 2580 | Open in IMG/M |
3300006100|Ga0007806_1003655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4203 | Open in IMG/M |
3300006115|Ga0007816_1001475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6617 | Open in IMG/M |
3300006117|Ga0007818_1100276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300006119|Ga0007866_1046149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300006639|Ga0079301_1049433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
3300006805|Ga0075464_10729562 | Not Available | 614 | Open in IMG/M |
3300006805|Ga0075464_10729562 | Not Available | 614 | Open in IMG/M |
3300006862|Ga0079299_1011661 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
3300008107|Ga0114340_1038940 | All Organisms → Viruses → Predicted Viral | 2136 | Open in IMG/M |
3300008107|Ga0114340_1247735 | Not Available | 547 | Open in IMG/M |
3300008110|Ga0114343_1114295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300008113|Ga0114346_1149066 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
3300008113|Ga0114346_1332028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300008259|Ga0114841_1070963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1611 | Open in IMG/M |
3300008261|Ga0114336_1087452 | All Organisms → Viruses → Predicted Viral | 1495 | Open in IMG/M |
3300009151|Ga0114962_10007902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8051 | Open in IMG/M |
3300009158|Ga0114977_10010558 | Not Available | 5856 | Open in IMG/M |
3300009165|Ga0105102_10145711 | Not Available | 1151 | Open in IMG/M |
3300009182|Ga0114959_10432043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300009182|Ga0114959_10601621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300009183|Ga0114974_10002650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13751 | Open in IMG/M |
3300009183|Ga0114974_10229398 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
3300009194|Ga0114983_1012946 | Not Available | 2373 | Open in IMG/M |
3300010157|Ga0114964_10314854 | Not Available | 741 | Open in IMG/M |
3300010388|Ga0136551_1009737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2015 | Open in IMG/M |
3300010885|Ga0133913_10159732 | Not Available | 6027 | Open in IMG/M |
3300010885|Ga0133913_11063059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2087 | Open in IMG/M |
3300012000|Ga0119951_1026405 | Not Available | 1969 | Open in IMG/M |
3300012667|Ga0157208_10001943 | All Organisms → Viruses → Predicted Viral | 4244 | Open in IMG/M |
3300012667|Ga0157208_10012354 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
3300013004|Ga0164293_10024533 | Not Available | 5034 | Open in IMG/M |
3300013004|Ga0164293_10301341 | Not Available | 1111 | Open in IMG/M |
3300013004|Ga0164293_10551831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300013005|Ga0164292_10061656 | Not Available | 2915 | Open in IMG/M |
3300013006|Ga0164294_10005647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10752 | Open in IMG/M |
3300013285|Ga0136642_1000470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21361 | Open in IMG/M |
3300013286|Ga0136641_1010387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3097 | Open in IMG/M |
3300013286|Ga0136641_1016991 | All Organisms → Viruses → Predicted Viral | 2291 | Open in IMG/M |
3300020048|Ga0207193_1239736 | All Organisms → Viruses → Predicted Viral | 1383 | Open in IMG/M |
3300020141|Ga0211732_1242571 | Not Available | 5591 | Open in IMG/M |
3300020161|Ga0211726_10576354 | Not Available | 2150 | Open in IMG/M |
3300020164|Ga0194037_1037960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1917 | Open in IMG/M |
3300020562|Ga0208597_1000898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11690 | Open in IMG/M |
3300020575|Ga0208053_1082043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300021354|Ga0194047_10176480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300021438|Ga0213920_1001123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15966 | Open in IMG/M |
3300021438|Ga0213920_1001657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11883 | Open in IMG/M |
3300021600|Ga0194059_1056448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1276 | Open in IMG/M |
3300021961|Ga0222714_10012931 | Not Available | 6968 | Open in IMG/M |
3300022594|Ga0236340_1090586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300023174|Ga0214921_10409467 | Not Available | 688 | Open in IMG/M |
3300024346|Ga0244775_10076176 | Not Available | 2872 | Open in IMG/M |
3300025336|Ga0208619_100236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3359 | Open in IMG/M |
3300025391|Ga0208740_1036965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300025401|Ga0207955_1037872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300025413|Ga0208614_1059452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300025424|Ga0208617_1016506 | All Organisms → Viruses → Predicted Viral | 1661 | Open in IMG/M |
3300025598|Ga0208379_1159933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300025785|Ga0208498_1002493 | Not Available | 5291 | Open in IMG/M |
3300027114|Ga0208009_1005811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3237 | Open in IMG/M |
3300027114|Ga0208009_1025964 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
3300027365|Ga0209300_1031045 | Not Available | 1056 | Open in IMG/M |
3300027499|Ga0208788_1003243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7325 | Open in IMG/M |
3300027563|Ga0209552_1079757 | Not Available | 895 | Open in IMG/M |
3300027593|Ga0255118_1054582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1281444 | Not Available | 572 | Open in IMG/M |
3300027733|Ga0209297_1205865 | Not Available | 777 | Open in IMG/M |
3300027734|Ga0209087_1003322 | Not Available | 8891 | Open in IMG/M |
3300027741|Ga0209085_1014681 | All Organisms → Viruses → Predicted Viral | 3851 | Open in IMG/M |
3300027741|Ga0209085_1064308 | Not Available | 1673 | Open in IMG/M |
3300027747|Ga0209189_1183561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
3300027759|Ga0209296_1413376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300027777|Ga0209829_10021348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3809 | Open in IMG/M |
3300027777|Ga0209829_10039408 | All Organisms → Viruses → Predicted Viral | 2581 | Open in IMG/M |
3300027793|Ga0209972_10248306 | Not Available | 804 | Open in IMG/M |
3300027805|Ga0209229_10057592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1735 | Open in IMG/M |
3300028025|Ga0247723_1023483 | All Organisms → Viruses → Predicted Viral | 2041 | Open in IMG/M |
3300028025|Ga0247723_1039684 | All Organisms → Viruses → Predicted Viral | 1411 | Open in IMG/M |
3300028025|Ga0247723_1072568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300028025|Ga0247723_1104675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300028027|Ga0247722_10110536 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
3300028393|Ga0304728_1172066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300031857|Ga0315909_10551474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300031857|Ga0315909_10935502 | Not Available | 531 | Open in IMG/M |
3300032092|Ga0315905_11209456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300033816|Ga0334980_0069258 | Not Available | 1482 | Open in IMG/M |
3300033981|Ga0334982_0002664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10989 | Open in IMG/M |
3300033993|Ga0334994_0114021 | All Organisms → Viruses → Predicted Viral | 1569 | Open in IMG/M |
3300034066|Ga0335019_0343537 | Not Available | 926 | Open in IMG/M |
3300034082|Ga0335020_0430857 | Not Available | 632 | Open in IMG/M |
3300034093|Ga0335012_0232366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 963 | Open in IMG/M |
3300034093|Ga0335012_0314437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300034103|Ga0335030_0290389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1100 | Open in IMG/M |
3300034104|Ga0335031_0580221 | Not Available | 666 | Open in IMG/M |
3300034120|Ga0335056_0400763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frigoribacterium → unclassified Frigoribacterium → Frigoribacterium sp. CG_9.8 | 739 | Open in IMG/M |
3300034120|Ga0335056_0722429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300034167|Ga0335017_0127199 | All Organisms → Viruses → Predicted Viral | 1493 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 16.52% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.09% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.09% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.09% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 6.09% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 4.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.61% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.61% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.61% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.74% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.87% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.87% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.87% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.87% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.87% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.87% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.87% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003802 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 | Environmental | Open in IMG/M |
3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006862 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025424 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
M3P_100570233 | 3300000268 | Lotic | MEWHPDGSFSEDDLWEAIAESHGVDVSEISDRDLTEFI* |
JGI24028J26656_10129082 | 3300002091 | Lentic | MEILAQWHPDGDFTEEDLWDAIAESEGVDVNEIMDGDLLEYI* |
B570J29032_1087602413 | 3300002408 | Freshwater | MKNLYSILADWYPEGNYTEADLWEAIAESEGLDVNEIRDRDMAEFI* |
B570J40625_1007922982 | 3300002835 | Freshwater | MSNLYSILADWYPEGNYTEADLWEAIAESEGLDVNEIMDRDLAEFI* |
JGI25923J51411_10405102 | 3300003493 | Freshwater Lake | MSDFYSILMDWFPEGNYTETDLWEAIAESEGLDMNEIMDRDLAEFI* |
Ga0007840_10078693 | 3300003802 | Freshwater | MSKSLDEVLMQWYPDGDFNEQDLWDAIAEVNGVDVNEIMDQDLTLFI* |
Ga0007817_10046444 | 3300003804 | Freshwater | MNKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLIDFI* |
Ga0007817_10046521 | 3300003804 | Freshwater | MNKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLVDFI* |
Ga0007856_10095061 | 3300003815 | Freshwater | MSKSVEAILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLVDFI* |
Ga0065171_10618432 | 3300004692 | Freshwater | MMNKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLVDFI* |
Ga0007804_11068813 | 3300004770 | Freshwater | MSKSVEAILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQD |
Ga0068876_100365715 | 3300005527 | Freshwater Lake | MGKDYLSILMEWKPDGSFTEEDLWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0068876_106940233 | 3300005527 | Freshwater Lake | MSDLYSILADWYPEGNYTEADLWEAIAESEGVDVNEIMDRDLAEFI* |
Ga0049081_102898292 | 3300005581 | Freshwater Lentic | MSRGYLEILMDWFPDGNYTEQDLWDAIAEAEGVDVNEISDRCLTEFI* |
Ga0049081_103183703 | 3300005581 | Freshwater Lentic | MSDLYSVLADWYPEGNYTEADLWEAIAEVEGVDVNEIMDRDLVEFI* |
Ga0078894_102688342 | 3300005662 | Freshwater Lake | VERDYLSILMEWHPDGSFSEDDLWEAIAESHGVDVSEISDRDLTEFI* |
Ga0078894_111125252 | 3300005662 | Freshwater Lake | MSKGYLEILMEWHPDGNFTEQDMWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0007876_10111709 | 3300006071 | Freshwater | MLNKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLIDFI* |
Ga0007806_100365511 | 3300006100 | Freshwater | WYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLVDFI* |
Ga0007816_100147516 | 3300006115 | Freshwater | MLNKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLVDFI* |
Ga0007818_11002762 | 3300006117 | Freshwater | KSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDIAAFI* |
Ga0007866_10461493 | 3300006119 | Freshwater | NKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLVDFI* |
Ga0079301_10494332 | 3300006639 | Deep Subsurface | VGKDYLSILMEWKPEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0075464_107295622 | 3300006805 | Aqueous | MSDIYSILAEWFPDGDYSEQDLWEAIAESEGVDINEIMDKDLTEFI* |
Ga0075464_107295624 | 3300006805 | Aqueous | MTDIYSVLAEWYPDGDFTEDDLWEAIAESEGVDVNEIM |
Ga0079299_10116616 | 3300006862 | Deep Subsurface | MGKDYLSILMEWKPEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0114340_103894010 | 3300008107 | Freshwater, Plankton | MSDLYSVLADWYPEGNYTEADLWEAIAEVEGVDVNEIMDRDLAEFI* |
Ga0114340_12477353 | 3300008107 | Freshwater, Plankton | MSNLYSVLADWYPEGNYTEADLWEAIAEVEGVDVNEIMDRDLAEFI* |
Ga0114343_11142952 | 3300008110 | Freshwater, Plankton | MKRKRGKKMGKDYLSILMEWKPEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0114346_11490661 | 3300008113 | Freshwater, Plankton | MSKGYLEILMEWHPDGNFTEQDMWDAIAEAEGVDVNEISDRDLTEFI* |
Ga0114346_13320281 | 3300008113 | Freshwater, Plankton | KMGKDYLSILMEWKPDGSFTEEDLWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0114841_10709635 | 3300008259 | Freshwater, Plankton | LYSVLADWYPEGNYTEADLWEAIAEVERVDVNEIMDRDLAEFI* |
Ga0114336_10874523 | 3300008261 | Freshwater, Plankton | MSRGYLEILMDWFPDGNYSEQDLWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0114962_100079026 | 3300009151 | Freshwater Lake | MSKGLFEVLAEWHPDGDFTEEDLWEAIAESEGVDVNEISDRDLTEFI* |
Ga0114977_1001055819 | 3300009158 | Freshwater Lake | MSDLYSILADWYPEGNFTEADLWEAIAESEGVDINEIMDRDLAEFI* |
Ga0105102_101457112 | 3300009165 | Freshwater Sediment | MTDLYSILADWYPEGNYTEADLWEAIAESEGLDVNEIMDRDLAEFI* |
Ga0114959_104320431 | 3300009182 | Freshwater Lake | MNKSVAELLYQWYPDGNFTEEDLWDAIAEVNDVSVNEIMDGDLLEYI* |
Ga0114959_106016211 | 3300009182 | Freshwater Lake | MNKSVAELLYQWYPDGNFTEEDLWDAIAESEGVDVNEISDRDLIEFL* |
Ga0114974_1000265022 | 3300009183 | Freshwater Lake | MNDVMEILAKWHPNGDFTEEDLWDAIAESEGVDVNEISDQDLTEFI* |
Ga0114974_102293982 | 3300009183 | Freshwater Lake | MTRGNKMSDLYSILADWYPEGNFTEADLWEAIAESEGVDINEIMDRDLAEFI* |
Ga0114983_10129465 | 3300009194 | Deep Subsurface | MRNLYSILAEWHPDGDFTENDLWEAIAESEGLEMNEIMDRDLAEFI* |
Ga0114964_103148541 | 3300010157 | Freshwater Lake | MNNVMEILAQWHPDGDFTEEDLWDAIAESEGVDVNEISDRDLTEFL* |
Ga0136551_10097375 | 3300010388 | Pond Fresh Water | MMSDLYSVLAEWYPEGNYTEQELWDAIAEVHGVDVNEIMDGDLVEYL* |
Ga0133913_1015973211 | 3300010885 | Freshwater Lake | MSKDLFAVLAEWHPNGDFTENDLWEAIAETEGVDVNEIMDRDLTEFI* |
Ga0133913_110630596 | 3300010885 | Freshwater Lake | MSNVMEILADWYPDGEFTEEDLWDAIAESEGVDVNEISDRDLTEFL* |
Ga0119951_10264051 | 3300012000 | Freshwater | MTDLYSVLADWYPEGNYTEADLWEAIAEVEGVDVNEIMDRDLTEFI* |
Ga0157208_100019436 | 3300012667 | Freshwater | MMSDLYSVLAEWYPDGNYSEQDLWEAIAEVEGVDINEIMDRDLLEFI* |
Ga0157208_100123542 | 3300012667 | Freshwater | MSDLYSILAEWYPEGNYTEADLWEAIAEAEGVDVNEIMDRDLAEFI* |
Ga0164293_100245332 | 3300013004 | Freshwater | MKRERGKKVGKDYLSILMEWKPEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0164293_103013413 | 3300013004 | Freshwater | MTDLYSLLAEWYPDGNYTESDLWEAIAETQGVDMNEIMDRDLAEFI* |
Ga0164293_105518312 | 3300013004 | Freshwater | WHPDGNFTEQDMWDAIAEAEGVDVNEISDRDLTEFI* |
Ga0164292_100616561 | 3300013005 | Freshwater | PEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI* |
Ga0164294_1000564719 | 3300013006 | Freshwater | MEILAQWHPDGDFTEEDLWDAIAESEGVDVNEISDRDLTEFI* |
Ga0136642_100047036 | 3300013285 | Freshwater | MNRSVEEILMQWYPDGDFTEEDLWDAIAEANDVDVNEIMDQDILEFI* |
Ga0136641_10103876 | 3300013286 | Freshwater | MNKAVEEILMQWYPDGDFTEEDLWDAIAEANDVSVNEIMDGDLLEYI* |
Ga0136641_10169914 | 3300013286 | Freshwater | MSKDLYTVLAEWHPDGDFTEEDLWDAIAESEGVDVNEISDRDLTEFI* |
Ga0207193_12397361 | 3300020048 | Freshwater Lake Sediment | MNNLYSILADLHPEGNYTEADLWEAIAESEGLDVNEIMDRDLTEFI |
Ga0211732_12425719 | 3300020141 | Freshwater | MSDLYSILAEWYPEGNYTEADLWEAIAEAEGVDINEIMDRDLIEFI |
Ga0211726_105763544 | 3300020161 | Freshwater | MDLYSLLAEWYPDGNYTESDLWEAIAETQGVDMNEIMDRDLAEFI |
Ga0194037_10379605 | 3300020164 | Anoxic Zone Freshwater | MSDFMQLLAEWHPDGDFTEEDLWEAIAEAEGVDVNEISDRDLTEFI |
Ga0208597_10008982 | 3300020562 | Freshwater | MKNLYSILADWYPEGNYTEADLWEAIAESEGLDVNEIRDRDMAEFI |
Ga0208053_10820433 | 3300020575 | Freshwater | MSNLYSVLADWYPEGNYTEADLWEAIAEVEGVDVNEIMDRDLAEFI |
Ga0194047_101764801 | 3300021354 | Anoxic Zone Freshwater | MTKDLYAVLAEWYPDGDFTEEELWDAIAEVNGVDVNEIMDQDIA |
Ga0213920_100112327 | 3300021438 | Freshwater | MDLFATLAEWYPDGDFTEQDLWEAIAEVNGVDVNEIMDRDLTEFI |
Ga0213920_100165718 | 3300021438 | Freshwater | MNNLYSILAELHPNGEFTESDLWEAIAESEGVEVNEIMDRDLTEYL |
Ga0194059_10564484 | 3300021600 | Anoxic Zone Freshwater | MDIYSVLAEFHPDGDFTEDDLWAAIAESEGVDVNEIMDRDLTE |
Ga0222714_1001293116 | 3300021961 | Estuarine Water | MNNLYSILAELHPAGDFTEADLWEAIAESQGVDVNEIMDQDLTEYL |
Ga0236340_10905861 | 3300022594 | Freshwater | TMSKDLYQVLAEWYPDGDFTEEDLWDAIAEVNNVDVNEIMDQDLTLFI |
Ga0214921_104094672 | 3300023174 | Freshwater | MSNLYSVLADWYPEGNYTEADLWEAIAEVEGVDVNEIIDRDLAEFI |
Ga0244775_100761762 | 3300024346 | Estuarine | MSNLYSVLADWYPDGKYTEADLWEAIAESEGVDVNEIMDRDLTEFI |
Ga0208619_1002366 | 3300025336 | Freshwater | MSKSLDEVLMQWYPDGDFNEQDLWDAIAEVNGVDVNEIMDQDLTLFI |
Ga0208740_10369652 | 3300025391 | Freshwater | MNKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDIAAFI |
Ga0207955_10378722 | 3300025401 | Freshwater | MLNKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLVDFI |
Ga0208614_10594521 | 3300025413 | Freshwater | SVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLIDFI |
Ga0208617_10165061 | 3300025424 | Freshwater | SLDEVLMQWYPDGDFNEQDLWDAIAEVNGVDVNEIMDQDLTLFI |
Ga0208379_11599332 | 3300025598 | Freshwater | MSKSLDEVLMQWYPDGDFNEKDLWDAIAEVNGVDVNEIMDQDLTLFI |
Ga0208498_10024939 | 3300025785 | Freshwater | MLNKSVEEILMQWYPDGNFTEEDLWDAIAEANDVDVNEIMDQDLIDFI |
Ga0208009_10058118 | 3300027114 | Deep Subsurface | KRKRGKKMGKDYLSILMEWKPEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI |
Ga0208009_10259643 | 3300027114 | Deep Subsurface | MSDLYSVLADWYPEGNYTEADLWEAIAEVEGVDVNEIMDRDLVEFI |
Ga0209300_10310452 | 3300027365 | Deep Subsurface | MRNLYSILAEWHPDGDFTENDLWEAIAESEGLEMNEIMDRDLAEFI |
Ga0208788_10032432 | 3300027499 | Deep Subsurface | MGKDYLSILMEWKPEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI |
Ga0209552_10797573 | 3300027563 | Freshwater Lake | MSDFYSILMDWFPEGNYTETDLWEAIAESEGLDMNEIMDRDLAEFI |
Ga0255118_10545821 | 3300027593 | Freshwater | MSRGYLEILMDWFPDGNYTEQDLWDAIAEAEGVDVNEISDRCLTEFI |
(restricted) Ga0247833_12814443 | 3300027730 | Freshwater | MSDIYSVLADWYPEGNYTEADLWEAIAESEGVDVNEIMDRDLAEFI |
Ga0209297_12058653 | 3300027733 | Freshwater Lake | MSDLYSILADWYPEGNFTEADLWEAIAESEGVDINEIMDRDLVE |
Ga0209087_10033229 | 3300027734 | Freshwater Lake | MSDLYSILADWYPEGNFTEADLWEAIAESEGVDINEIMDRDLAEFI |
Ga0209085_10146811 | 3300027741 | Freshwater Lake | IAMNAWCTMSDLMQLLAEWHPDGDFTEEDLWDAIAEVEGVDVNEISDRDLTEFI |
Ga0209085_10643083 | 3300027741 | Freshwater Lake | EWHPDGDFTEEDLWEAIAESEGVDVNEISDRDLTEFI |
Ga0209189_11835611 | 3300027747 | Freshwater Lake | MSKGLFEVLAEWHPDGDFTEEDLWEAIAESEGVDVN |
Ga0209296_14133761 | 3300027759 | Freshwater Lake | LYSILADWYPEGNFTEADLWEAIAESEGVDINEIMDRDLAEFI |
Ga0209829_100213481 | 3300027777 | Freshwater Lake | CTMSDLMQLLAEWHPDGDFTEEDLWDAIAEVEGVDVNEISDRDLTEFI |
Ga0209829_100394084 | 3300027777 | Freshwater Lake | MSKGLFEVLAEWHPDGDFTEEDLWEAIAESEGVDVNEISDRDLTEFI |
Ga0209972_102483063 | 3300027793 | Freshwater Lake | MSDLYSILADWYPEGNYTEADLWEAIAESEGVDVNEIMDRDLAEFI |
Ga0209229_100575924 | 3300027805 | Freshwater And Sediment | MSDLYSILADWYPEGNYTEADLWEAIAESEGLDVNDIMDRDLAEFI |
Ga0247723_10234832 | 3300028025 | Deep Subsurface Sediment | MSKGYLEILMDWFPEGDFTEQDMWDAIAEAEGVDVSEISDRDLTEFI |
Ga0247723_10396843 | 3300028025 | Deep Subsurface Sediment | MSDLYSILAEWYPEGNYTEADLWEAIAEAEGVDVNEIMDRDLIEFI |
Ga0247723_10725681 | 3300028025 | Deep Subsurface Sediment | MSKGYLEILMEWHPDGNFTEQDMWDAIAEAEGVDVNEISDRDLTEFI |
Ga0247723_11046751 | 3300028025 | Deep Subsurface Sediment | MEKDYLSILMEWKPEGDFTEADLWDAIAESHGLDVSEISDRDLTEFI |
Ga0247722_101105363 | 3300028027 | Deep Subsurface Sediment | MSDLYSILSEWYPEGNFTESDLWEAIAESEGVDMNEIMDRDLMEFI |
Ga0304728_11720662 | 3300028393 | Freshwater Lake | MNKSVAELLYQWYPDGNFTEEDLWDAIAEVNDVSVNEIMDGDLLEYI |
Ga0315909_105514742 | 3300031857 | Freshwater | LSILMEWKPEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI |
Ga0315909_109355021 | 3300031857 | Freshwater | LMEWHPDGSFSEDDLWEAIAESHGVDVSEISDRDLTEFI |
Ga0315905_112094561 | 3300032092 | Freshwater | KMGKDYLSILMEWKPDGSFTEEDLWDAIAEAEGVDVSEISDRDLTEFI |
Ga0334980_0069258_1083_1199 | 3300033816 | Freshwater | MEWHPDGSFSEDDLWEAIAESHGVDVSEISDRDLTEFI |
Ga0334982_0002664_2403_2543 | 3300033981 | Freshwater | MNNLYSILADWYPEGNYTEADLWEAIAESEGLDVSEIMDRDLTEFI |
Ga0334994_0114021_1293_1460 | 3300033993 | Freshwater | MKRERGKKVGKDYLSILMEWKPEGDFTEADLWDAIAEAEGVDVSEISDRDLTEFI |
Ga0335019_0343537_326_481 | 3300034066 | Freshwater | MRRNKISNLYSILADWYPEGNYTEADLWEAIAESEGLDVNEIMDGDLAEYI |
Ga0335020_0430857_227_367 | 3300034082 | Freshwater | MNNLYSILADLHPEGNYTEADLWEAIAESEGLDVSEIMDRDLTEFI |
Ga0335012_0232366_719_859 | 3300034093 | Freshwater | MTDLYSILADWYPEGNYTEADLWEAIAESEGVDVNDIMDRDLAEFI |
Ga0335012_0314437_599_739 | 3300034093 | Freshwater | MTDLYSILADWYPEGNYTEADLWEAIAESEGLDVNDIMDRDLAEFI |
Ga0335030_0290389_24_179 | 3300034103 | Freshwater | MRRNKMSNLYSILADWYPEGNYTEADLWEAIAESEGLDVNEIMDGDLAEYI |
Ga0335031_0580221_214_354 | 3300034104 | Freshwater | MNNLYSILADWYPEGNYTEADLWEAIAESEGLDVNEIMDGDLAEYI |
Ga0335056_0400763_627_737 | 3300034120 | Freshwater | MSKGYLEILMEWHPDGNFTEQDMWDAIAEAEGVDVNE |
Ga0335056_0722429_372_503 | 3300034120 | Freshwater | LYSILADWYPEGNYTEADLWEAIAESEGLDVNEIMDGDLAEYI |
Ga0335017_0127199_1332_1487 | 3300034167 | Freshwater | MRRNKMSNLYSILADWYPEGNYTEADLWEAIAESEGVDVNEIMDRDLAEFI |
⦗Top⦘ |