Basic Information | |
---|---|
Family ID | F079934 |
Family Type | Metagenome |
Number of Sequences | 115 |
Average Sequence Length | 40 residues |
Representative Sequence | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEVVD |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 98.18 % |
% of genes near scaffold ends (potentially truncated) | 95.65 % |
% of genes from short scaffolds (< 2000 bps) | 83.48 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | unclassified viruses (58.261 % of family members) |
NCBI Taxonomy ID | 12429 |
Taxonomy | All Organisms → Viruses → unclassified viruses |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.696 % of family members) |
Environment Ontology (ENVO) | Unclassified (60.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.130 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.31% β-sheet: 0.00% Coil/Unstructured: 67.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF01443 | Viral_helicase1 | 5.22 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.74 % |
Unclassified | root | N/A | 18.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000162|TB03JUN2009H_c020966 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 733 | Open in IMG/M |
3300002161|JGI24766J26685_10029007 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
3300003491|JGI25924J51412_1076443 | Not Available | 507 | Open in IMG/M |
3300003789|Ga0007835_1012353 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 742 | Open in IMG/M |
3300003813|Ga0007879_1001641 | All Organisms → Viruses → Predicted Viral | 3878 | Open in IMG/M |
3300005581|Ga0049081_10016197 | All Organisms → Viruses → Predicted Viral | 2817 | Open in IMG/M |
3300005581|Ga0049081_10330145 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 520 | Open in IMG/M |
3300005914|Ga0075117_1008594 | All Organisms → Viruses → Predicted Viral | 4663 | Open in IMG/M |
3300006105|Ga0007819_1097872 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 585 | Open in IMG/M |
3300006737|Ga0098037_1006688 | All Organisms → Viruses → Predicted Viral | 4662 | Open in IMG/M |
3300006802|Ga0070749_10642061 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 570 | Open in IMG/M |
3300006921|Ga0098060_1083538 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 914 | Open in IMG/M |
3300007171|Ga0102977_1031235 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
3300007538|Ga0099851_1170101 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 804 | Open in IMG/M |
3300007559|Ga0102828_1102510 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 697 | Open in IMG/M |
3300007972|Ga0105745_1180393 | Not Available | 658 | Open in IMG/M |
3300008221|Ga0114916_1077992 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 845 | Open in IMG/M |
3300008267|Ga0114364_1168662 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 575 | Open in IMG/M |
3300008448|Ga0114876_1104192 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1122 | Open in IMG/M |
3300009009|Ga0105105_10697495 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 603 | Open in IMG/M |
3300009075|Ga0105090_10886055 | Not Available | 543 | Open in IMG/M |
3300009154|Ga0114963_10618996 | Not Available | 566 | Open in IMG/M |
3300009164|Ga0114975_10378793 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 774 | Open in IMG/M |
3300009180|Ga0114979_10325325 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 909 | Open in IMG/M |
3300009183|Ga0114974_10764265 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 521 | Open in IMG/M |
3300010148|Ga0098043_1148556 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 664 | Open in IMG/M |
3300010160|Ga0114967_10116145 | All Organisms → Viruses → Predicted Viral | 1531 | Open in IMG/M |
3300010160|Ga0114967_10609169 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 524 | Open in IMG/M |
3300010354|Ga0129333_10771642 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 822 | Open in IMG/M |
3300010354|Ga0129333_11614059 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 529 | Open in IMG/M |
3300013094|Ga0164297_10396251 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 528 | Open in IMG/M |
3300013286|Ga0136641_1098559 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 814 | Open in IMG/M |
3300015050|Ga0181338_1045701 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 645 | Open in IMG/M |
3300017716|Ga0181350_1054179 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1058 | Open in IMG/M |
3300017716|Ga0181350_1131656 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 594 | Open in IMG/M |
3300017716|Ga0181350_1135822 | Not Available | 582 | Open in IMG/M |
3300017723|Ga0181362_1002846 | All Organisms → Viruses → Predicted Viral | 3647 | Open in IMG/M |
3300017736|Ga0181365_1139963 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 576 | Open in IMG/M |
3300017736|Ga0181365_1170926 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 510 | Open in IMG/M |
3300017747|Ga0181352_1078919 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 922 | Open in IMG/M |
3300017747|Ga0181352_1096961 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 811 | Open in IMG/M |
3300017750|Ga0181405_1002882 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5335 | Open in IMG/M |
3300017754|Ga0181344_1061634 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
3300017754|Ga0181344_1224501 | Not Available | 523 | Open in IMG/M |
3300017761|Ga0181356_1017023 | All Organisms → Viruses → Predicted Viral | 2698 | Open in IMG/M |
3300017761|Ga0181356_1096469 | Not Available | 967 | Open in IMG/M |
3300017761|Ga0181356_1213413 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 565 | Open in IMG/M |
3300017761|Ga0181356_1226374 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 542 | Open in IMG/M |
3300017766|Ga0181343_1219476 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 518 | Open in IMG/M |
3300017766|Ga0181343_1229101 | Not Available | 505 | Open in IMG/M |
3300017777|Ga0181357_1214078 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 682 | Open in IMG/M |
3300017777|Ga0181357_1329506 | Not Available | 512 | Open in IMG/M |
3300017780|Ga0181346_1172539 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 796 | Open in IMG/M |
3300017784|Ga0181348_1093570 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
3300017784|Ga0181348_1299666 | Not Available | 539 | Open in IMG/M |
3300017785|Ga0181355_1290694 | Not Available | 616 | Open in IMG/M |
3300017949|Ga0181584_10190576 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
3300018876|Ga0181564_10271128 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 956 | Open in IMG/M |
3300019459|Ga0181562_10141658 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
3300019751|Ga0194029_1054098 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 665 | Open in IMG/M |
3300019784|Ga0181359_1051833 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
3300019784|Ga0181359_1235771 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 565 | Open in IMG/M |
3300020183|Ga0194115_10261460 | Not Available | 812 | Open in IMG/M |
3300020595|Ga0206126_10033868 | All Organisms → Viruses → Predicted Viral | 3039 | Open in IMG/M |
3300020718|Ga0214178_1033057 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 652 | Open in IMG/M |
3300021091|Ga0194133_10061142 | All Organisms → Viruses → Predicted Viral | 3142 | Open in IMG/M |
3300021519|Ga0194048_10137160 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 925 | Open in IMG/M |
3300022176|Ga0212031_1010575 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
3300022200|Ga0196901_1021710 | All Organisms → Viruses → Predicted Viral | 2580 | Open in IMG/M |
3300022407|Ga0181351_1189041 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 700 | Open in IMG/M |
3300023119|Ga0255762_10476658 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 593 | Open in IMG/M |
3300023180|Ga0255768_10411360 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 714 | Open in IMG/M |
3300025413|Ga0208614_1057670 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 568 | Open in IMG/M |
3300025417|Ga0208616_1020369 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1040 | Open in IMG/M |
3300025426|Ga0208739_1035198 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 845 | Open in IMG/M |
3300025598|Ga0208379_1091426 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 735 | Open in IMG/M |
3300025712|Ga0209305_1171630 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 649 | Open in IMG/M |
3300025789|Ga0208499_1019656 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
3300027084|Ga0208443_1071821 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 693 | Open in IMG/M |
3300027144|Ga0255102_1045866 | Not Available | 710 | Open in IMG/M |
3300027644|Ga0209356_1167366 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 606 | Open in IMG/M |
3300027693|Ga0209704_1103007 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 812 | Open in IMG/M |
3300027733|Ga0209297_1272654 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 641 | Open in IMG/M |
3300027744|Ga0209355_1237679 | Not Available | 722 | Open in IMG/M |
3300027760|Ga0209598_10103379 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
3300027772|Ga0209768_10240182 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 791 | Open in IMG/M |
3300027772|Ga0209768_10333458 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 626 | Open in IMG/M |
3300027808|Ga0209354_10369803 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 561 | Open in IMG/M |
3300027973|Ga0209298_10033760 | All Organisms → Viruses → Predicted Viral | 2461 | Open in IMG/M |
3300031707|Ga0315291_10088863 | All Organisms → Viruses → Predicted Viral | 3363 | Open in IMG/M |
3300031772|Ga0315288_11367006 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 596 | Open in IMG/M |
3300031787|Ga0315900_10216790 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
3300031951|Ga0315904_10096078 | All Organisms → Viruses → Predicted Viral | 3128 | Open in IMG/M |
3300031952|Ga0315294_11400926 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 553 | Open in IMG/M |
3300031963|Ga0315901_10601845 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 834 | Open in IMG/M |
3300031999|Ga0315274_10755571 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
3300032092|Ga0315905_11133690 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 645 | Open in IMG/M |
3300032093|Ga0315902_11282913 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 518 | Open in IMG/M |
3300032116|Ga0315903_10683582 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 771 | Open in IMG/M |
3300032156|Ga0315295_12200696 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 513 | Open in IMG/M |
3300032164|Ga0315283_11710514 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 636 | Open in IMG/M |
3300032462|Ga0335396_10169893 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
3300032668|Ga0316230_1029041 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2703 | Open in IMG/M |
3300033742|Ga0314858_159912 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 579 | Open in IMG/M |
3300033981|Ga0334982_0180884 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
3300033993|Ga0334994_0536523 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 536 | Open in IMG/M |
3300034061|Ga0334987_0546562 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 695 | Open in IMG/M |
3300034066|Ga0335019_0474456 | Not Available | 752 | Open in IMG/M |
3300034104|Ga0335031_0634580 | Not Available | 625 | Open in IMG/M |
3300034375|Ga0348336_174555 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 607 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 8.70% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.22% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.22% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.22% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.22% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.35% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.61% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.61% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.74% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.74% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.87% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.87% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.87% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.87% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.87% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.87% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.87% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.87% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.87% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.87% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.87% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB03JUN2009H_0209661 | 3300000162 | Freshwater | MQVKNKQEVRLKKAHIALMKHHETALYSGVMLMGKSEV |
JGI24766J26685_100290072 | 3300002161 | Freshwater And Sediment | MAITQETRLKKAHIALMKHRETALYSGVMLMGKNSVIED |
JGI25924J51412_10764433 | 3300003491 | Freshwater Lake | MLKDAQTARIKRAHMTMFKHPQTALYSGVMLMGTSAVVDHC |
Ga0007835_10123533 | 3300003789 | Freshwater | MQGKQETRLKKAHIALMKHPQTALYSGVMLMGKSEVIDGDG |
Ga0007879_10016411 | 3300003813 | Freshwater | MIANNRQEVRLKKAHIALMKHPETALYSGVMLMGKSEVSDEMF |
Ga0065168_10634262 | 3300004684 | Freshwater | MLTQEERIKKAHITMMKHPETALYSGVMMMGTTSVIDNKNVTAYT |
Ga0049081_100161976 | 3300005581 | Freshwater Lentic | MITEEQRIKKGHIMLMKHPETALWSGVLMMGTTEIVDDPK |
Ga0049081_103301453 | 3300005581 | Freshwater Lentic | MITEEQRIKKGHIALMKHPETALWGGVMMMGSTEVVDEA |
Ga0075117_10085941 | 3300005914 | Saline Lake | MTKDAQETRIKRGHMTLMKHRDTALYSGVMLMGSSEV |
Ga0007819_10978721 | 3300006105 | Freshwater | MLTQEERIKKAHITMMKHPETALYSGVMMMGTTSVIDNKNVT |
Ga0098037_10066881 | 3300006737 | Marine | MTTHRLSPEDRIKKAHIALMKHPETALYSGVMMLGKSEVVDDCPTA |
Ga0070749_106420613 | 3300006802 | Aqueous | MIKDTQETRVKRSHVALMKHPETALYSGVMLMGKSEVVDGIPT |
Ga0098060_10835381 | 3300006921 | Marine | MTIHKLSPEDRIKKAHIALMKHPETALYSGVMMLGKSEV |
Ga0102977_10312353 | 3300007171 | Freshwater Lake | MTSEETRIKRGHITLMKHPETALYSGVMLMGNNEVVDGNFTAY |
Ga0099851_11701011 | 3300007538 | Aqueous | MQQETRLKKAHIALMKHKDTALYSGVVLMGTSKVIDNCPT |
Ga0102828_11025101 | 3300007559 | Estuarine | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEVVDSGCPT |
Ga0105745_11803933 | 3300007972 | Estuary Water | MEITQEVRIKRGHIAMMKHPETALYSGVMMMGETSV |
Ga0114916_10779921 | 3300008221 | Deep Ocean | MTIHKLSPEDRIKKAHIALMKHPETALYSGVMMLGKSEVVDD |
Ga0114364_11686621 | 3300008267 | Freshwater, Plankton | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEVV |
Ga0114876_11041921 | 3300008448 | Freshwater Lake | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEV |
Ga0105105_106974952 | 3300009009 | Freshwater Sediment | MSQETRLKRNHIALMKHPETAWYSGIMMMGENEVIDK |
Ga0105090_108860551 | 3300009075 | Freshwater Sediment | MLSEEQRVKKGHIALMKHPETALWSGVMMMGTTSVV |
Ga0114963_106189962 | 3300009154 | Freshwater Lake | MSSQETLLKQAHIALMKHPQTALYAGVMLMGESAVEDG |
Ga0114970_104488631 | 3300009163 | Freshwater Lake | MITEEQRIKKGHIALMKHPETALWGGVMMMGSTEVVDEAITAYTDG |
Ga0114975_103787932 | 3300009164 | Freshwater Lake | MRLKKAHVALMKHQETALYSGIMLMGKSVVVDEEITAYT |
Ga0114979_103253253 | 3300009180 | Freshwater Lake | MLINKQETRLKKGHIALMKHPETALYSGVMLMGVSE |
Ga0114974_107642651 | 3300009183 | Freshwater Lake | MITEEQRIKKGHIALMKHPETALWGGVMMMGSTEVVD |
Ga0098043_11485561 | 3300010148 | Marine | MTIHKLSPEDRIKKAHIALMKHPETALYSGVMMLGKSEVVDDCPTA |
Ga0114967_101161453 | 3300010160 | Freshwater Lake | MSSQETLLKQAHIALMKHPQTALYSGVMLMGESAVE |
Ga0114967_106091693 | 3300010160 | Freshwater Lake | MITEEQRIKKGHIALMKHPETALWGGVMMMGSTEVVDEAI |
Ga0129333_107716421 | 3300010354 | Freshwater To Marine Saline Gradient | MSTTEETRIKRGHITLMKHPDTALYSGVMLMGSTEVAEGKFT |
Ga0129333_116140592 | 3300010354 | Freshwater To Marine Saline Gradient | MMKLTEEQRVKKAHIALMKHPETALYSGVMMMGTTEVIDDA |
Ga0164297_103962511 | 3300013094 | Freshwater | MSLHKQETRLKKAHIALMKHPMTALYSGVMLMGKSEVSE |
Ga0136641_10985592 | 3300013286 | Freshwater | MTNNKQEVRLKKAHIALMKHPETALYSGVMLMGKSE |
Ga0181338_10457013 | 3300015050 | Freshwater Lake | MMDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEV |
Ga0181350_10541791 | 3300017716 | Freshwater Lake | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEVVDDGCP |
Ga0181350_11316561 | 3300017716 | Freshwater Lake | MSITQETRLKKAHIALMKHRETALYSGVMLMGKNA |
Ga0181350_11358221 | 3300017716 | Freshwater Lake | MSKQETRIKRGHITLIKHPQTALYSGVMLMGISAVEEN |
Ga0181362_10028461 | 3300017723 | Freshwater Lake | MMDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTLLF |
Ga0181365_11399631 | 3300017736 | Freshwater Lake | MDDILATQITQLKKAHLRLMRHPETCLYSGIILMGKSEV |
Ga0181365_11709263 | 3300017736 | Freshwater Lake | MDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTSSFPFPSS |
Ga0181352_10789191 | 3300017747 | Freshwater Lake | MITEEQRIKKGHIMLMKHPETALWSGVLMMGTTEIVDDPKV |
Ga0181352_10969611 | 3300017747 | Freshwater Lake | MSNVDKQLMRVKKAHITLMKHPETALYSGVMLMGRSDVS |
Ga0181405_100288212 | 3300017750 | Seawater | MTTHRLSPEDRIKKAHIALMKHPETALYSGVMMLGKSEVV |
Ga0181344_10616342 | 3300017754 | Freshwater Lake | MLEVKDKQETRVKKAHIALMKHPETALYSGVMLMG |
Ga0181344_12245012 | 3300017754 | Freshwater Lake | MAVSQETRLKKAHIALLRHKDTCLYGGVILMGESTV |
Ga0181356_10170231 | 3300017761 | Freshwater Lake | MDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTLSS |
Ga0181356_10964691 | 3300017761 | Freshwater Lake | MKDKQTTRIKRAHMTMFKHPQTALYSGVMLMGTSEVIDDCP |
Ga0181356_12134133 | 3300017761 | Freshwater Lake | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEVVDD |
Ga0181356_12263741 | 3300017761 | Freshwater Lake | MDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTFY |
Ga0181343_12194762 | 3300017766 | Freshwater Lake | MMTKDKQETRIKRGHIALMKHPETALYSGVMLMGKTEVVDANFT |
Ga0181343_12291011 | 3300017766 | Freshwater Lake | MSKQETRIKRGHIALMKHPQTALYSGVMLMGTSAVEEGV |
Ga0181357_12140781 | 3300017777 | Freshwater Lake | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEVVDDGCPTA |
Ga0181357_13295062 | 3300017777 | Freshwater Lake | MSKQEIRIKRGHITLMKHPQTALYSGVMLMGVSAVEENVS |
Ga0181346_11725391 | 3300017780 | Freshwater Lake | MLTEEQRIKKGHIALMKHPETALWGGVMMMGSTEVVDE |
Ga0181348_10935701 | 3300017784 | Freshwater Lake | MLINKQETRLKKGHIALMKHPETALYSGVMLMGVSEV |
Ga0181348_12996664 | 3300017784 | Freshwater Lake | MEMTEEVRIKRGHIAMMKHMETALYSGVMMMGESS |
Ga0181355_12906943 | 3300017785 | Freshwater Lake | MSKQETRIKRGHVTLMKHPQTALYSGVMLMGTSSVE |
Ga0181584_101905761 | 3300017949 | Salt Marsh | MNQETRLKKAHIALMRHPETALYSGIMMMGDSTVVDD |
Ga0181564_102711282 | 3300018876 | Salt Marsh | MNQETRLKKAHIALMRHPETALYSGIMMMGDSTVVDDCPTAY |
Ga0181562_101416584 | 3300019459 | Salt Marsh | MTPEMRLKKAHVRLMNHPETALYSGIILMGQSTVVDNCPT |
Ga0194029_10540982 | 3300019751 | Freshwater | MSITEETRLKKAHIALMRHPETALYSGVIMMGENKIVDDCPTAC |
Ga0181359_10518331 | 3300019784 | Freshwater Lake | MDISQETRLKKAHVALMKHQETSLYSSIFLMGTNVVEDGIPTAYTDA |
Ga0181359_10836712 | 3300019784 | Freshwater Lake | MSTDQEKRIKRAHITLMKHPDTALYSGVMMMGDTEVVDGKFTAYT |
Ga0181359_12357711 | 3300019784 | Freshwater Lake | MDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTP |
Ga0194115_102614603 | 3300020183 | Freshwater Lake | MISEETRIKRGHITMMKHHDTALYAGVFLMGVSEVVDGNF |
Ga0206126_100338686 | 3300020595 | Seawater | MQYNEDQRLKRAHVALMKHQETALYSGIIMMGKSEVKDDIPTACTD |
Ga0214178_10330573 | 3300020718 | Freshwater | MIANNRQEVRLKKAHIALMKHPETALYSGVMLMGKSEV |
Ga0194133_100611427 | 3300021091 | Freshwater Lake | MLTTEQRIKKAHVALMKHPETALFSGVLMLGESHVVDEEGITAY |
Ga0194048_101371604 | 3300021519 | Anoxic Zone Freshwater | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEVVD |
Ga0212030_10500162 | 3300022053 | Aqueous | MTTHKLSPEDRIKKAHIALMKHPETALYSGVMMLGESEVVDDCPTAK |
Ga0212031_10105751 | 3300022176 | Aqueous | MNITQETRLKKAHVSLMKHPETALYSGVMLMGSSRVVD |
Ga0196901_10217101 | 3300022200 | Aqueous | MSITQETRLKKAHITLMRHPETALYSGIMMMGKNEVVDD |
Ga0181351_11890411 | 3300022407 | Freshwater Lake | MDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTL |
Ga0255762_104766581 | 3300023119 | Salt Marsh | MNQETRLKKAHIALMRHPETALYSGIMMMGDSTVVDDCPT |
Ga0255768_104113601 | 3300023180 | Salt Marsh | MNQETRLKKAHIALMRHPETALYSGIMMMGNSTVVDDCP |
Ga0208614_10576702 | 3300025413 | Freshwater | MLTQEERIKKAHITMMKHPETALYSGVMMMGTTSVIDNKN |
Ga0208616_10203691 | 3300025417 | Freshwater | MNEETRLKKAHVALMKHPETALYSGVILMGENSIIEE |
Ga0208739_10351982 | 3300025426 | Freshwater | MLTQEERIKKAHITMMKHPETALYSGVMMMGTTSV |
Ga0208379_10914261 | 3300025598 | Freshwater | MEVKNKQEVRLKKAHIALMKHHETALYSGVMLMGKSEVS |
Ga0209305_11716301 | 3300025712 | Pelagic Marine | MEQETRLKKAHIALMKHKDTALYSGVVLMGTSKVIDNCPTA |
Ga0208741_100411891 | 3300025723 | Freshwater | MLTQEERIKKAHITMMKHPETALYSGVMMMGTTSVIDDKNVTAY |
Ga0208499_10196561 | 3300025789 | Freshwater | MLTQEERIKKAHITMMKHPETALYSGVMMMGTTSVIDDKNV |
Ga0208443_10718213 | 3300027084 | Estuarine | MDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTGGKFTAYTD |
Ga0255102_10458663 | 3300027144 | Freshwater | MSKQETRIKRGHVTLMKHPQTALYSGVMLMGTSSVEDNVS |
Ga0209356_11673662 | 3300027644 | Freshwater Lake | MHNKQELRIKKAHIALMKHPETALYSGVLLMGVSEVVEKASFTA |
Ga0209704_11030072 | 3300027693 | Freshwater Sediment | MIKDKQETLIKRGHVALMKHPETALYSGVMLMGKSDVAD |
Ga0209297_12726541 | 3300027733 | Freshwater Lake | MQANKQETRIKRGHVALMKHPETALYSGVMLMGTTKVVDE |
Ga0209355_12376792 | 3300027744 | Freshwater Lake | MEMTEEVRIKRGHIAMMKHMETALYSGVMMMGETSVE |
Ga0209598_101033791 | 3300027760 | Freshwater Lake | MMDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTGGKFT |
Ga0209768_102401823 | 3300027772 | Freshwater Lake | MLTEEQRIKKGHIALMKHPETALWGGVMMMGSTEVVD |
Ga0209768_103334583 | 3300027772 | Freshwater Lake | MSKQETRVKKAHIALMKHPETALYSGVMLMGKSEVVDSGCP |
Ga0209354_103698032 | 3300027808 | Freshwater Lake | MLTEEQRIKKGHIALMKHPETALWGGVMMMGSTEVVDEAITAY |
Ga0209298_100337601 | 3300027973 | Freshwater Lake | MITEEQRIKKGHIALMKHPETALWGGVMMMGSTEVVDEAITAY |
Ga0315291_100888631 | 3300031707 | Sediment | MQKQMTRIKKAHVALMKHPQTALYSGVMLMGTSEVVEDAK |
Ga0315288_113670063 | 3300031772 | Sediment | MDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTGGKF |
Ga0315900_102167901 | 3300031787 | Freshwater | MLTEEQRIKRAHVAMMKHPETALYSGVMMMGETEVVDKQITAYTD |
Ga0315904_100960781 | 3300031951 | Freshwater | MEITQEVRIKRGHIAMMKHPETALYSGVMMMGETSVDDKPITA |
Ga0315294_114009261 | 3300031952 | Sediment | MMDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTGG |
Ga0315901_106018452 | 3300031963 | Freshwater | MEITQEVRIKRGHIAMMKHPETALYSGVMMMGETSVDDKP |
Ga0315274_107555711 | 3300031999 | Sediment | MASNISQETRLKKAHVALMKHPETALYSGVILMGKS |
Ga0315905_111336903 | 3300032092 | Freshwater | MDDKQTVRVKRAHITMMKHKDTALYSGVMLMGKSEVTGGKFT |
Ga0315902_112829133 | 3300032093 | Freshwater | MSKQEIRVKKAHIALMKHPETALYSGVMLMGKSEVVD |
Ga0315903_106835822 | 3300032116 | Freshwater | MQNNKQEVRLKKAHIALMKHPETALYSGVMLMGKSEVSDDMFTA |
Ga0315295_122006961 | 3300032156 | Sediment | MHNKQELRIKKAHIALMKHPETALYSGVLLMGVSEVVE |
Ga0315283_117105142 | 3300032164 | Sediment | MDTETKIKKAHITLMRHPETCLYSGVIMAGKVEVRDDVPT |
Ga0335396_101698933 | 3300032462 | Freshwater | MDNLQEIRIKRSHITMMKHPSTALYSGIMLMGESSVTDG |
Ga0316230_10290414 | 3300032668 | Freshwater | MSLHKQETRLKKAHIALMKHPMTALYSGVMLMGKSDVSEQSFTA |
Ga0314858_159912_459_578 | 3300033742 | Sea-Ice Brine | MNQETRLKKAHVALMKHQETALYSGIMMMGSSEVVDDCPT |
Ga0334982_0180884_1_132 | 3300033981 | Freshwater | MKDKQETRIKRAHVALMKHPETALYSGVMLMGTTEVSDEKFTAY |
Ga0334994_0536523_425_535 | 3300033993 | Freshwater | MKDKQETRIKRAHVALMKHPETALYSGVMLMGTTEVS |
Ga0334987_0546562_562_693 | 3300034061 | Freshwater | MQNKQELRIKKAHIALMKHPETALYSGVLLMGVSEVVEKASFTA |
Ga0335019_0474456_1_117 | 3300034066 | Freshwater | MSKQETRIKRGHITLMKHPSTALYSGVMLMGTSSVEENV |
Ga0335031_0634580_3_110 | 3300034104 | Freshwater | MTNLQEKRVKRAHITLMKHQDTALYSGVMLMGDTEV |
Ga0348336_174555_1_135 | 3300034375 | Aqueous | MTIHKLSPEDRIKKAHIALMKHPETALYSGVMMLGKSEVVDDCPT |
⦗Top⦘ |