NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F079927

Metagenome Family F079927

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079927
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 74 residues
Representative Sequence MSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGANSNE
Number of Associated Samples 79
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 80.87 %
% of genes near scaffold ends (potentially truncated) 24.35 %
% of genes from short scaffolds (< 2000 bps) 80.00 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (48.696 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(26.087 % of family members)
Environment Ontology (ENVO) Unclassified
(69.565 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.826 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 74.67%    β-sheet: 0.00%    Coil/Unstructured: 25.33%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF13155Toprim_2 0.87
PF00476DNA_pol_A 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.78 %
UnclassifiedrootN/A25.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10204708Not Available659Open in IMG/M
3300000116|DelMOSpr2010_c10017544All Organisms → Viruses → Predicted Viral3543Open in IMG/M
3300000116|DelMOSpr2010_c10067274All Organisms → Viruses → Predicted Viral1473Open in IMG/M
3300000116|DelMOSpr2010_c10106249All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300000116|DelMOSpr2010_c10132997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.878Open in IMG/M
3300004097|Ga0055584_100694109All Organisms → Viruses → Predicted Viral1064Open in IMG/M
3300005941|Ga0070743_10020256All Organisms → Viruses → Predicted Viral2318Open in IMG/M
3300006026|Ga0075478_10013374All Organisms → Viruses → Predicted Viral2792Open in IMG/M
3300006752|Ga0098048_1024740All Organisms → Viruses → Predicted Viral1984Open in IMG/M
3300006752|Ga0098048_1159068Not Available672Open in IMG/M
3300006793|Ga0098055_1100214All Organisms → Viruses → Predicted Viral1132Open in IMG/M
3300006793|Ga0098055_1357088Not Available543Open in IMG/M
3300006802|Ga0070749_10522867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.645Open in IMG/M
3300006810|Ga0070754_10024662All Organisms → Viruses → Predicted Viral3449Open in IMG/M
3300006810|Ga0070754_10076888All Organisms → Viruses → Predicted Viral1692Open in IMG/M
3300006810|Ga0070754_10079977All Organisms → Viruses → Predicted Viral1650Open in IMG/M
3300006810|Ga0070754_10176572All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300006916|Ga0070750_10060263All Organisms → Viruses → Predicted Viral1818Open in IMG/M
3300006919|Ga0070746_10337425Not Available685Open in IMG/M
3300006920|Ga0070748_1243635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.648Open in IMG/M
3300006924|Ga0098051_1087428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.841Open in IMG/M
3300006924|Ga0098051_1102330Not Available768Open in IMG/M
3300006925|Ga0098050_1171459Not Available544Open in IMG/M
3300007229|Ga0075468_10195504Not Available593Open in IMG/M
3300007234|Ga0075460_10258343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.579Open in IMG/M
3300007276|Ga0070747_1352625Not Available503Open in IMG/M
3300007345|Ga0070752_1037725All Organisms → Viruses → Predicted Viral2303Open in IMG/M
3300007539|Ga0099849_1052800All Organisms → Viruses → Predicted Viral1688Open in IMG/M
3300007539|Ga0099849_1170609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.832Open in IMG/M
3300007539|Ga0099849_1178401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.809Open in IMG/M
3300007539|Ga0099849_1226936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.694Open in IMG/M
3300007540|Ga0099847_1032216All Organisms → Viruses → Predicted Viral1681Open in IMG/M
3300007551|Ga0102881_1229277Not Available514Open in IMG/M
3300007558|Ga0102822_1099805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.684Open in IMG/M
3300007640|Ga0070751_1341249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.551Open in IMG/M
3300007658|Ga0102898_1030065All Organisms → Viruses → Predicted Viral1216Open in IMG/M
3300008012|Ga0075480_10268945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.875Open in IMG/M
3300009052|Ga0102886_1114004Not Available816Open in IMG/M
3300009079|Ga0102814_10108446All Organisms → Viruses → Predicted Viral1523Open in IMG/M
3300009079|Ga0102814_10252173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.960Open in IMG/M
3300009086|Ga0102812_10823240Not Available515Open in IMG/M
3300009507|Ga0115572_10021637All Organisms → Viruses → Predicted Viral4445Open in IMG/M
3300010300|Ga0129351_1008618All Organisms → Viruses → Predicted Viral4247Open in IMG/M
3300010300|Ga0129351_1078888All Organisms → Viruses → Predicted Viral1332Open in IMG/M
3300010392|Ga0118731_101678977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.890Open in IMG/M
3300011253|Ga0151671_1040971Not Available807Open in IMG/M
3300011258|Ga0151677_1052543Not Available683Open in IMG/M
3300017697|Ga0180120_10023381All Organisms → Viruses → Predicted Viral2885Open in IMG/M
3300017709|Ga0181387_1016163All Organisms → Viruses → Predicted Viral1443Open in IMG/M
3300017714|Ga0181412_1037755All Organisms → Viruses → Predicted Viral1271Open in IMG/M
3300017719|Ga0181390_1018353All Organisms → Viruses → Predicted Viral2321Open in IMG/M
3300017724|Ga0181388_1123112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.618Open in IMG/M
3300017727|Ga0181401_1069310Not Available934Open in IMG/M
3300017727|Ga0181401_1075011Not Available888Open in IMG/M
3300017728|Ga0181419_1025380All Organisms → Viruses → Predicted Viral1643Open in IMG/M
3300017728|Ga0181419_1147923Not Available563Open in IMG/M
3300017731|Ga0181416_1066512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.852Open in IMG/M
3300017742|Ga0181399_1042861All Organisms → Viruses → Predicted Viral1198Open in IMG/M
3300017743|Ga0181402_1046371All Organisms → Viruses → Predicted Viral1180Open in IMG/M
3300017749|Ga0181392_1089165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.926Open in IMG/M
3300017749|Ga0181392_1093122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.903Open in IMG/M
3300017749|Ga0181392_1206250Not Available563Open in IMG/M
3300017750|Ga0181405_1144430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.589Open in IMG/M
3300017753|Ga0181407_1023647All Organisms → Viruses → Predicted Viral1683Open in IMG/M
3300017758|Ga0181409_1226543Not Available534Open in IMG/M
3300017760|Ga0181408_1006090All Organisms → Viruses → Predicted Viral3486Open in IMG/M
3300017770|Ga0187217_1087265All Organisms → Viruses → Predicted Viral1067Open in IMG/M
3300017772|Ga0181430_1159582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.654Open in IMG/M
3300017773|Ga0181386_1011315All Organisms → Viruses → Predicted Viral3027Open in IMG/M
3300017773|Ga0181386_1031059All Organisms → Viruses → Predicted Viral1755Open in IMG/M
3300017773|Ga0181386_1141234Not Available739Open in IMG/M
3300017773|Ga0181386_1186127Not Available628Open in IMG/M
3300017782|Ga0181380_1014194All Organisms → Viruses → Predicted Viral3025Open in IMG/M
3300017782|Ga0181380_1014282All Organisms → Viruses → Predicted Viral3015Open in IMG/M
3300017783|Ga0181379_1229299Not Available646Open in IMG/M
3300018416|Ga0181553_10476442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.669Open in IMG/M
3300020169|Ga0206127_1133192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.987Open in IMG/M
3300020176|Ga0181556_1104711All Organisms → Viruses → Predicted Viral1271Open in IMG/M
3300021335|Ga0213867_1089981All Organisms → Viruses → Predicted Viral1111Open in IMG/M
3300021356|Ga0213858_10002211Not Available9285Open in IMG/M
3300021356|Ga0213858_10016560All Organisms → Viruses → Predicted Viral3496Open in IMG/M
3300021356|Ga0213858_10218499Not Available922Open in IMG/M
3300021373|Ga0213865_10062422All Organisms → Viruses → Predicted Viral2043Open in IMG/M
3300021373|Ga0213865_10094228All Organisms → Viruses → Predicted Viral1605Open in IMG/M
3300021373|Ga0213865_10220188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.927Open in IMG/M
3300021375|Ga0213869_10338572Not Available631Open in IMG/M
3300021957|Ga0222717_10040673All Organisms → Viruses → Predicted Viral3044Open in IMG/M
3300022187|Ga0196899_1011248All Organisms → Viruses → Predicted Viral3520Open in IMG/M
3300022187|Ga0196899_1127530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.727Open in IMG/M
3300022308|Ga0224504_10140480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.990Open in IMG/M
(restricted) 3300024059|Ga0255040_10174599Not Available872Open in IMG/M
(restricted) 3300024059|Ga0255040_10176230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.869Open in IMG/M
(restricted) 3300024062|Ga0255039_10284128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.704Open in IMG/M
3300024346|Ga0244775_10032822All Organisms → Viruses → Predicted Viral4612Open in IMG/M
3300024346|Ga0244775_11348026Not Available550Open in IMG/M
3300025070|Ga0208667_1041142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.779Open in IMG/M
3300025098|Ga0208434_1037839All Organisms → Viruses → Predicted Viral1104Open in IMG/M
3300025108|Ga0208793_1158050Not Available594Open in IMG/M
3300025769|Ga0208767_1025447All Organisms → Viruses → Predicted Viral3166Open in IMG/M
3300025806|Ga0208545_1124254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.645Open in IMG/M
3300025849|Ga0209603_1031171All Organisms → Viruses → Predicted Viral3110Open in IMG/M
3300025853|Ga0208645_1042767All Organisms → Viruses → Predicted Viral2226Open in IMG/M
3300025853|Ga0208645_1052351All Organisms → Viruses → Predicted Viral1937Open in IMG/M
3300025853|Ga0208645_1146352Not Available904Open in IMG/M
3300027571|Ga0208897_1027636All Organisms → Viruses → Predicted Viral1571Open in IMG/M
3300032254|Ga0316208_1040137All Organisms → Viruses → Predicted Viral1507Open in IMG/M
3300032254|Ga0316208_1090790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.780Open in IMG/M
3300032274|Ga0316203_1046633All Organisms → Viruses → Predicted Viral1249Open in IMG/M
3300032277|Ga0316202_10016422All Organisms → Viruses → Predicted Viral3686Open in IMG/M
3300032277|Ga0316202_10069972All Organisms → Viruses → Predicted Viral1630Open in IMG/M
3300032277|Ga0316202_10116672All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300032277|Ga0316202_10395080Not Available646Open in IMG/M
3300032373|Ga0316204_10466562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.946Open in IMG/M
3300034375|Ga0348336_048013All Organisms → Viruses → Predicted Viral1789Open in IMG/M
3300034375|Ga0348336_079157All Organisms → Viruses → Predicted Viral1196Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater26.09%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous25.22%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.70%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat6.96%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.09%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.35%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.48%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.74%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.74%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.74%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.87%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.87%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.87%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300032254Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyriteEnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1020470823300000101MarineMSKDYREQSQLEDEADKKYLTMYQYFKELTDYERGEYDALHGYPVSDTDESPDYLSGYGDAYAYLQTLSGDIINE*
DelMOSpr2010_1001754443300000116MarineMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQQMGANDNE*
DelMOSpr2010_1006727443300000116MarineMSKDYREQAQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEDANKEYTEGYRTGYEYVQRMGANDNE*
DelMOSpr2010_1010624943300000116MarineMSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPEYLSGYGDAYAYLQTLSGDIINE*
DelMOSpr2010_1013299743300000116MarineEDEADKKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPDYLSGYGDAYAYLQTLSGDIIK*
Ga0055584_10069410923300004097Pelagic MarineMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNE*
Ga0070743_1002025653300005941EstuarineMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE*
Ga0075478_1001337463300006026AqueousMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGANNNE*
Ga0098048_102474033300006752MarineMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE*
Ga0098048_115906823300006752MarineMSKDYREQSQLEDDEDEKYLTMYQYFKELTDYERGEYDALHGYPVSDAEESPDYYSGYGDAYEYLQVMGADK*
Ga0098055_110021463300006793MarineMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYVQRMGANDNE*
Ga0098055_135708813300006793MarineMSKDYQEQAHLEDVADARYNMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE*
Ga0070749_1052286713300006802AqueousQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGENSNE*
Ga0070754_1002466263300006810AqueousMSKDAREQAQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYLVSDAEESPDYYSGYGDAYEYLQVMGADK*
Ga0070754_1007688873300006810AqueousMSKDYREQSQLEDDADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGANDNG*
Ga0070754_1007997733300006810AqueousVSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPDYLSGYGDAYAYLQTLSGDIINE*
Ga0070754_1017657243300006810AqueousMSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDAEESPDYYSGYGDAYAYLQTLSGDIINE*
Ga0070750_1006026373300006916AqueousMSKDYREQSQLEDIADTTYNMYQYFKELTDYERGEYDALHGYPVADDESPDYLSGYGDAYAYLQTLSGDIINE*
Ga0070746_1033742533300006919AqueousMSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDAEESPDYYSGYGDAYEYLQVMGADK*
Ga0070748_124363513300006920AqueousRDAREQAQLEDVADKTYNMYQYFKELTDYERGEYDALHGYPIADEASPDYLSGYGDAYTYLQTLSGEIIDE*
Ga0098051_108742843300006924MarineLVKRERGFKMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNE*
Ga0098051_110233033300006924MarineMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFEESEEANKEYTEGYRTGYEYAQRMG
Ga0098050_117145923300006925MarineMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYAYAQQMGANDNG*
Ga0075468_1019550423300007229AqueousVLYIIGKEVKTMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE*
Ga0075460_1025834333300007234AqueousERIKTMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE*
Ga0070747_135262523300007276AqueousMSRDAREQAQLEDVADKTYNMYQYFKELTDYERGEYDALHGYPIADEASPDYLSGYGDAYTYLQTLSGEIIDE*
Ga0070752_103772563300007345AqueousMSKDAREQAQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDAEESPDYYSGYGDAYEYLQVMGADK*
Ga0099849_105280013300007539AqueousMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE
Ga0099849_117060913300007539AqueousDYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYAYAQQMGANDNG*
Ga0099849_117840133300007539AqueousMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGANSNE*
Ga0099849_122693643300007539AqueousGGKTMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGANDNE*
Ga0099847_103221623300007540AqueousMSKDYQEQAHLEDVADEKYLTMYQYFKELTDYERGEYNALHGYPVSDADESPEYLSGYGDAYAYLQTLSGDIINE*
Ga0102881_122927723300007551EstuarineMSKDYKEQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQKMGANSNE*
Ga0102822_109980513300007558EstuarineDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESSKDYTEGFRQSYEYAQKMGANSNE*
Ga0070751_134124913300007640AqueousQLEDDADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKDYTEGYRTGYAYAQQMGANSNEQI*
Ga0102898_103006513300007658EstuarineMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQKMGANSNE*
Ga0075480_1026894523300008012AqueousMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGANDNE*
Ga0102886_111400413300009052EstuarineMSKDYQEQAHLEDVADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNTDYTEGFRQGYEYAQKMGANSNE*
Ga0102814_1010844663300009079EstuarineEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE*
Ga0102814_1025217313300009079EstuarineDEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQRMGAKDNE
Ga0102812_1082324033300009086EstuarineYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQKMGANSNE*
Ga0115572_1002163753300009507Pelagic MarineMSKDYQEQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPEYLSGYGDAYAYLQTLSGDIINE*
Ga0129351_100861883300010300Freshwater To Marine Saline GradientMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGANSNE*
Ga0129351_107888813300010300Freshwater To Marine Saline GradientMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYAYAQQMGANDNE*
Ga0118731_10167897713300010392MarineDKTMSKDYREQSQLEDEADVKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGAKIV*
Ga0151671_104097123300011253MarineMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQIGANNNE*
Ga0151677_105254333300011258MarineMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANNNE*
Ga0180120_1002338153300017697Freshwater To Marine Saline GradientMSKDYQEQAHLEDVADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPEYLSGYGDAYAYLQTLSGDIINE
Ga0181387_101616353300017709SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDELEEANKEYTEGYRTGYEYAQRMGAKDNG
Ga0181412_103775563300017714SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDELEEANKEYTEGYRTGYEYAQRMGAKDNG
Ga0181390_101835343300017719SeawaterMSKYYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNE
Ga0181388_112311233300017724SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQKMGANSNE
Ga0181401_106931023300017727SeawaterMSKDYREQAQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYAEGYRTGYEYAQRMGANDNG
Ga0181401_107501143300017727SeawaterMSRDAREQAQLETLADKQYNLQDYWQELTDYERGEYDALHSYPFDESEEANKEYA
Ga0181419_102538043300017728SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGADDNE
Ga0181419_114792323300017728SeawaterMSKDAIQQAQLEDIADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNG
Ga0181416_106651233300017731SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGYRTGYEYVQRIGANDNE
Ga0181399_104286123300017742SeawaterVMRQVAGHGKQREAKTMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE
Ga0181402_104637153300017743SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDELEEANKEYTEGYRTGYEYAQRMGANDK
Ga0181392_108916543300017749SeawaterSKDYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGADDNE
Ga0181392_109312243300017749SeawaterSKDYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNE
Ga0181392_120625013300017749SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGAK
Ga0181405_114443013300017750SeawaterEADEKYLTMYQYYKELTDFERGEYDALHSYPFDELEESNKEYTEGYRTGYEYAQRMGAKDNE
Ga0181407_102364763300017753SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNE
Ga0181409_122654333300017758SeawaterMSKDYREQSQLEDEADEKYLTMYRYYKELTDYERGEYDALHSYPFDELEEANKEYTEGYRTGYEYAQRMGANDK
Ga0181408_100609083300017760SeawaterMSKDYREQAQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNE
Ga0187217_108726543300017770SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGADDNE
Ga0181430_115958233300017772SeawaterKTMSKDYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNG
Ga0181386_101131543300017773SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDLERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNG
Ga0181386_103105923300017773SeawaterMSKDYREQAQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGANGK
Ga0181386_114123433300017773SeawaterMSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPEYLSGYGDAYAYLQTLSGDII
Ga0181386_118612723300017773SeawaterMSKDYQEQSQLEDEADEKYLTMYQYYKQLTNYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGAK
Ga0181380_101419483300017782SeawaterMSKDYREQAQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGA
Ga0181380_101428253300017782SeawaterMSKDYREQAQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEDANKEYTEGYRTGYEYVQRMGANDNE
Ga0181379_122929913300017783SeawaterMSKDYREQAQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYR
Ga0181553_1047644233300018416Salt MarshMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYAFDESEEANKEYTEGYRTGYAYAQQMGANDNG
Ga0206127_113319223300020169SeawaterMSKDAREQAQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDAEESPDYYSGYGDAYAYLQVKGADK
Ga0181556_110471133300020176Salt MarshMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEESNKEYTEGYRTGYAYAQQMGANDNG
Ga0213867_108998113300021335SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYAYAQQMGANDNG
Ga0213858_1000221163300021356SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGANSNE
Ga0213858_10016560103300021356SeawaterMSKDYREQAQLEDIADTTYNMYQYFKELTDYERGEYDALHGYPVSDAEESPDYLSGYGDAYAYLQTLSGDIINE
Ga0213858_1021849953300021356SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGANSNE
Ga0213865_1006242293300021373SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE
Ga0213865_1009422843300021373SeawaterMSKDYREQGQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYAYAQQMGANDNG
Ga0213865_1022018823300021373SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYAYAQQMGANSNE
Ga0213869_1033857223300021375SeawaterVMRQVAEHGKQREVKKMSKDYQEQAQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPDYLSGYGDAYAYLQTLSGDIINE
Ga0222717_1004067323300021957Estuarine WaterMSKDYREQSQLEDEAEEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGAK
Ga0196899_101124843300022187AqueousMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGYRTGYEYAQQMGANNNE
Ga0196899_112753013300022187AqueousMSKDAREQAQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDAEESPDYYSGYGDAYEYLQVMGADK
Ga0224504_1014048033300022308SedimentMSKDYREQAQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEETNKEYTEGYRTGYEYTQRMGADDNE
(restricted) Ga0255040_1017459923300024059SeawaterMSKDYQEQAHLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQKMGANSNE
(restricted) Ga0255040_1017623043300024059SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNE
(restricted) Ga0255039_1028412823300024062SeawaterMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNNDYTEGFRQGYEYAQKMGANSNE
Ga0244775_1003282263300024346EstuarineMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE
Ga0244775_1134802623300024346EstuarineMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEERNKDYTEGFRQGYEYAQKMGANSNE
Ga0208667_104114223300025070MarineMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYVQRMGANDNE
Ga0208434_103783963300025098MarineMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTG
Ga0208793_115805023300025108MarineMSKDYQEQAHLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMG
Ga0208767_102544733300025769AqueousMSKDYREQSQLEDIADTTYNMYQYFKELTDYERGEYDALHGYPVADDESPDYLSGYGDAYAYLQTLSGDIINE
Ga0208545_112425413300025806AqueousQVLYIIGKEVKTMSKDYREQSQLEDEADEKYLTMYQYYKQLTDFERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSNE
Ga0209603_103117163300025849Pelagic MarineMSKDYQEQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPEYLSGYGDAYAYLQTLSGDIINE
Ga0208645_104276723300025853AqueousVSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPDYLSGYGDAYAYLQTLSGDIINE
Ga0208645_105235173300025853AqueousMSKDYREQSQLEDDADEKYLTMYQYYKELTDYERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGANDNG
Ga0208645_114635243300025853AqueousMSKDAREQAQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYLVSDAEESPDYYSGYGDAYEYLQVMGADK
Ga0208897_102763613300027571EstuarineMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQQMGANSN
Ga0316208_104013753300032254Microbial MatMSKDYREQSQLEDEADEKYLTMYQYYKQLTDYERGEYDALHSYPFDESEENNKDYTEGFRQGYEYAQQMGANNNE
Ga0316208_109079013300032254Microbial MatMSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPEYLSGYGDAYAYLQTLSGDIINE
Ga0316203_104663333300032274Microbial MatMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQQMGANDNE
Ga0316202_1001642293300032277Microbial MatMSRDYQEQAHLEDEADENYLTMYQYYKQLTDYERGEYDALHSYPFDESEESNKDYTEGFRQGYEYAQKMGANQDG
Ga0316202_1006997263300032277Microbial MatMSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPDYLSGYGDAYAYLQTLSGDIIK
Ga0316202_1011667213300032277Microbial MatMSKDYREQSQLEDDADEKYLTMYQYYKELTDFERGEYDSLHSYPFDESEEANKEYTEGYRTGYE
Ga0316202_1039508023300032277Microbial MatMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGANDNE
Ga0316204_1046656213300032373Microbial MatLNRGAKLMSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPEYLSGYGDAYAYLQTLSGDIINE
Ga0348336_048013_377_6043300034375AqueousMSKDYREQSQLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDAEESPDYYSGYGDAYAYLQTLSGDIINE
Ga0348336_079157_999_11963300034375AqueousLEDEADEKYLTMYQYFKELTDYERGEYDALHGYPVSDADESPDYLSGYGDAYAYLQTLSGDIINE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.