Basic Information | |
---|---|
Family ID | F079906 |
Family Type | Metagenome |
Number of Sequences | 115 |
Average Sequence Length | 43 residues |
Representative Sequence | RRHNAHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALAQ |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.74 % |
% of genes near scaffold ends (potentially truncated) | 97.39 % |
% of genes from short scaffolds (< 2000 bps) | 91.30 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.783 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.217 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.696 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.913 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.86% β-sheet: 0.00% Coil/Unstructured: 77.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF00221 | Lyase_aromatic | 18.26 |
PF07704 | PSK_trans_fac | 9.57 |
PF07238 | PilZ | 6.96 |
PF01850 | PIN | 6.09 |
PF00682 | HMGL-like | 4.35 |
PF01557 | FAA_hydrolase | 3.48 |
PF13614 | AAA_31 | 2.61 |
PF07927 | HicA_toxin | 1.74 |
PF12704 | MacB_PCD | 0.87 |
PF00246 | Peptidase_M14 | 0.87 |
PF13738 | Pyr_redox_3 | 0.87 |
PF00132 | Hexapep | 0.87 |
PF04773 | FecR | 0.87 |
PF09346 | SMI1_KNR4 | 0.87 |
PF00497 | SBP_bac_3 | 0.87 |
PF13180 | PDZ_2 | 0.87 |
PF01656 | CbiA | 0.87 |
PF08241 | Methyltransf_11 | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 18.26 |
COG4423 | Uncharacterized conserved protein | Function unknown [S] | 9.57 |
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.78 % |
Unclassified | root | N/A | 25.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101095608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300004082|Ga0062384_101396714 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300004092|Ga0062389_103721457 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300004152|Ga0062386_101306771 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300004479|Ga0062595_100214451 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300005167|Ga0066672_10349366 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300005176|Ga0066679_11016322 | Not Available | 515 | Open in IMG/M |
3300005332|Ga0066388_105919142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300005457|Ga0070662_100980125 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300005526|Ga0073909_10478042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
3300005536|Ga0070697_101270771 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300005555|Ga0066692_10629667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
3300005568|Ga0066703_10680230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300005576|Ga0066708_10737158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300005598|Ga0066706_10709202 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300005610|Ga0070763_10550812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
3300005921|Ga0070766_11059489 | Not Available | 559 | Open in IMG/M |
3300005983|Ga0081540_1121841 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300006755|Ga0079222_12346658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium multihospitium | 533 | Open in IMG/M |
3300006797|Ga0066659_10437179 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300006800|Ga0066660_10486127 | Not Available | 1037 | Open in IMG/M |
3300006893|Ga0073928_10566676 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300007265|Ga0099794_10043463 | Not Available | 2145 | Open in IMG/M |
3300007788|Ga0099795_10458286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300009038|Ga0099829_11300117 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae | 601 | Open in IMG/M |
3300009143|Ga0099792_10933075 | Not Available | 576 | Open in IMG/M |
3300010326|Ga0134065_10384129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
3300010329|Ga0134111_10327837 | Not Available | 643 | Open in IMG/M |
3300010337|Ga0134062_10324033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
3300010358|Ga0126370_10458666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1065 | Open in IMG/M |
3300010358|Ga0126370_11619073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300010361|Ga0126378_10536751 | Not Available | 1285 | Open in IMG/M |
3300010362|Ga0126377_13506231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300010376|Ga0126381_101152038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
3300010398|Ga0126383_10335986 | Not Available | 1525 | Open in IMG/M |
3300011120|Ga0150983_14202553 | Not Available | 895 | Open in IMG/M |
3300011269|Ga0137392_10375595 | Not Available | 1179 | Open in IMG/M |
3300011269|Ga0137392_11586964 | Not Available | 513 | Open in IMG/M |
3300011270|Ga0137391_10150052 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
3300012096|Ga0137389_11355694 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300012096|Ga0137389_11574407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300012189|Ga0137388_10692990 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300012189|Ga0137388_10728632 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300012189|Ga0137388_11123355 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300012202|Ga0137363_10758475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
3300012203|Ga0137399_11426121 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300012205|Ga0137362_10499061 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300012205|Ga0137362_10573563 | Not Available | 974 | Open in IMG/M |
3300012205|Ga0137362_10976949 | Not Available | 722 | Open in IMG/M |
3300012361|Ga0137360_10845548 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300012362|Ga0137361_11439455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300012363|Ga0137390_10446650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1269 | Open in IMG/M |
3300012685|Ga0137397_10410852 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300012923|Ga0137359_10696534 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300012924|Ga0137413_11583746 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300012924|Ga0137413_11813605 | Not Available | 504 | Open in IMG/M |
3300012927|Ga0137416_12017062 | Not Available | 529 | Open in IMG/M |
3300012975|Ga0134110_10424631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300015052|Ga0137411_1197907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
3300015242|Ga0137412_10034028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4162 | Open in IMG/M |
3300017930|Ga0187825_10126065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
3300017936|Ga0187821_10507620 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300019999|Ga0193718_1091790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300020579|Ga0210407_10306937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1239 | Open in IMG/M |
3300020581|Ga0210399_11083804 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300020583|Ga0210401_11119418 | Not Available | 646 | Open in IMG/M |
3300021046|Ga0215015_10671548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300021088|Ga0210404_10465614 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300021088|Ga0210404_10687071 | Not Available | 583 | Open in IMG/M |
3300021168|Ga0210406_11004303 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300021170|Ga0210400_10093672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2372 | Open in IMG/M |
3300021170|Ga0210400_11074648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
3300021171|Ga0210405_11378703 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300021401|Ga0210393_10623817 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300021404|Ga0210389_10046750 | All Organisms → cellular organisms → Bacteria | 3321 | Open in IMG/M |
3300021404|Ga0210389_11406727 | Not Available | 532 | Open in IMG/M |
3300021405|Ga0210387_10177679 | Not Available | 1837 | Open in IMG/M |
3300021406|Ga0210386_10747077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium | 842 | Open in IMG/M |
3300021432|Ga0210384_10228122 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
3300021432|Ga0210384_11666086 | Not Available | 543 | Open in IMG/M |
3300021474|Ga0210390_11285738 | Not Available | 587 | Open in IMG/M |
3300021560|Ga0126371_13909361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300024232|Ga0247664_1051050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300025929|Ga0207664_11665365 | Not Available | 560 | Open in IMG/M |
3300026281|Ga0209863_10152978 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300026557|Ga0179587_10265826 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300027660|Ga0209736_1068325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
3300027692|Ga0209530_1034325 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300027706|Ga0209581_1126478 | Not Available | 850 | Open in IMG/M |
3300027725|Ga0209178_1002512 | All Organisms → cellular organisms → Bacteria | 5756 | Open in IMG/M |
3300027725|Ga0209178_1034406 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300027727|Ga0209328_10191454 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300027737|Ga0209038_10182995 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300027867|Ga0209167_10757642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NBRC 110028 | 529 | Open in IMG/M |
3300027875|Ga0209283_10334571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
3300028906|Ga0308309_11426714 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300030737|Ga0302310_10185944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1223 | Open in IMG/M |
3300031668|Ga0318542_10011518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3372 | Open in IMG/M |
3300031715|Ga0307476_11189543 | Not Available | 558 | Open in IMG/M |
3300031718|Ga0307474_10303292 | Not Available | 1231 | Open in IMG/M |
3300031754|Ga0307475_10716354 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300031754|Ga0307475_10828875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
3300031768|Ga0318509_10467570 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300031820|Ga0307473_10847232 | Not Available | 656 | Open in IMG/M |
3300031823|Ga0307478_10016087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5214 | Open in IMG/M |
3300031831|Ga0318564_10193418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
3300031946|Ga0310910_10024425 | All Organisms → cellular organisms → Bacteria | 4029 | Open in IMG/M |
3300031962|Ga0307479_10757431 | Not Available | 948 | Open in IMG/M |
3300032060|Ga0318505_10071087 | Not Available | 1534 | Open in IMG/M |
3300032076|Ga0306924_12106100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300032180|Ga0307471_103055107 | Not Available | 593 | Open in IMG/M |
3300032261|Ga0306920_101425689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
3300032261|Ga0306920_101507282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
3300032783|Ga0335079_10037041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5602 | Open in IMG/M |
3300032898|Ga0335072_10573500 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.09% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.48% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.48% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.61% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.87% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.87% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1010956082 | 3300000364 | Soil | ETLELACGHYSLELAPFSXIAGYRMLTYLRSALA* |
Ga0062384_1013967141 | 3300004082 | Bog Forest Soil | RHGANPRTLELPCGHYSLELPVFSYLAGYRMLSFFRTTLA* |
Ga0062389_1037214571 | 3300004092 | Bog Forest Soil | RNGAAPKTVELHCGHYSLELAPFSYIAGYRMLTFLRSSLV* |
Ga0062386_1013067713 | 3300004152 | Bog Forest Soil | LEALRRHGAPPKTVELHCGHYSLELAPFSYVAGYRMLTFLRSSLV* |
Ga0062595_1002144512 | 3300004479 | Soil | SRQMLDALRRHGAHPRSLQLHCGHYSLELAPFSYIAGYRVLAFLRAALGH* |
Ga0066672_103493662 | 3300005167 | Soil | DSLRRNGASPHTLGLHCGHYSLELAPFSYIAGYRMLAFLRGALSAR* |
Ga0066679_110163222 | 3300005176 | Soil | EQMLEALRRHTPHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0066388_1059191421 | 3300005332 | Tropical Forest Soil | ENGASPKTLELACGHYSLELAPFSYIAGYRMLTYLRSALA* |
Ga0070662_1009801251 | 3300005457 | Corn Rhizosphere | RRHGAHPRTLELHCGHYSLELPPFSHIAGYRMLTFLRSALAKG* |
Ga0073909_104780421 | 3300005526 | Surface Soil | HQPHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0070697_1012707712 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RHGAHPRTLELHCGHYSLELPPFSHIAGYRMLTFLRSALAKG* |
Ga0066692_106296671 | 3300005555 | Soil | HGANPKTLELSCGHYSLELAPFSYIAGIRMLRFLKGALA* |
Ga0066703_106802301 | 3300005568 | Soil | LTEQMLEALRRHTPHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0066708_107371581 | 3300005576 | Soil | GANPRTLELPCGHYSLELRPFSYIAGYRMLTYLKSALV* |
Ga0066706_107092021 | 3300005598 | Soil | RQMLDSLRRHGAAPRTLGLHCGHYSLELFPFSYIAGYRMLTFLRGALSS* |
Ga0070763_105508123 | 3300005610 | Soil | TAQMLAALRQHHANLRTLELHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0070766_110594891 | 3300005921 | Soil | PRSLELHCGHYSLELAPFSYIAGYRMLSFLRSALA* |
Ga0081540_11218411 | 3300005983 | Tabebuia Heterophylla Rhizosphere | DALHAHGANPRTLELPCGHYSLELKPFSYVAGYRMLTYLRSALA* |
Ga0079222_123466581 | 3300006755 | Agricultural Soil | HNANPRTLALHCGHYSLELPPFSHIAGYRMLTFLRQALA* |
Ga0066659_104371792 | 3300006797 | Soil | SLRRHGAAPRTLGLHCGHYSLELFPFSYIAGYRMLTFLRGALSS* |
Ga0066660_104861271 | 3300006800 | Soil | QMLDSLRRHGARPRTLALRCGHYSLELFPFSYVAGYRMLAFLRGALSSSG* |
Ga0073928_105666762 | 3300006893 | Iron-Sulfur Acid Spring | RRHGSNPRVLELACGHYSLELRPFSYIAGYRMLSFFRRALS* |
Ga0099794_100434633 | 3300007265 | Vadose Zone Soil | AALRRHNANPRTLALHCGHYSLELPPFSHIAGYRMLTFLRQALA* |
Ga0099795_104582862 | 3300007788 | Vadose Zone Soil | ALHEHGASPRTLELPCGHYSLELRPFSYIAGYRMLTYLKSALA* |
Ga0099829_113001173 | 3300009038 | Vadose Zone Soil | AAPRTLQFHCGHYSLELFPFSYVAGYLMLSFFRSALG* |
Ga0099792_109330751 | 3300009143 | Vadose Zone Soil | LTEQMLAALRRYHPHPRTLALHCGHYSLELPPFSHIAGYRMLAFLRQALA* |
Ga0134065_103841291 | 3300010326 | Grasslands Soil | SPHTLGLHCGHYSLELAPFSYIAGYRMLAFLRGALSAR* |
Ga0134111_103278373 | 3300010329 | Grasslands Soil | APRTLALHCGHYSLELAPFSYIAGYRMLSFFRSALT* |
Ga0134062_103240331 | 3300010337 | Grasslands Soil | NGASPHTLGLHCGHYSLELAPFSYIAGYRMLAFLRGALSAR* |
Ga0126370_104586661 | 3300010358 | Tropical Forest Soil | APRTLALHCGHYSLELPLFSHIAGYRMLTFLRDALA* |
Ga0126370_116190731 | 3300010358 | Tropical Forest Soil | GASPRTLELPCGHYSLELAPFSYIAGYRMLTFLRSALA* |
Ga0126378_105367511 | 3300010361 | Tropical Forest Soil | RQMLDSLRRHGATPRTLALHCGHYSLELFPFSYVAGYRMLSFLRYALSA* |
Ga0126377_135062312 | 3300010362 | Tropical Forest Soil | DALNEHGANPRTLQLPCGHYSLELAPFSYIAGYRMLTFLRSALA* |
Ga0126381_1011520381 | 3300010376 | Tropical Forest Soil | NGAKPRTLELHCGHYSLELAPFSYVAGYRMLRFLKSALA* |
Ga0126383_103359861 | 3300010398 | Tropical Forest Soil | QMLDSLCRHGARPRTLALHCGHYSLELFPFSYLAGYRMLAFLRGALSRPV* |
Ga0150983_142025531 | 3300011120 | Forest Soil | EQMLTALRRYTPHPRTLALHCGHYSLELPPFSHIAGYRMLAFLRQALAQVQLALSN* |
Ga0137392_103755951 | 3300011269 | Vadose Zone Soil | PRTLALHCGHYSLELAPFSYIAGYRMLSFFRSALA* |
Ga0137392_115869641 | 3300011269 | Vadose Zone Soil | PHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0137391_101500521 | 3300011270 | Vadose Zone Soil | LRRHNANPRTLALHCGHYSLELPPFSHIAGYRMLAFLRQALA* |
Ga0137389_113556942 | 3300012096 | Vadose Zone Soil | MLAALRRHNAHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0137389_115744072 | 3300012096 | Vadose Zone Soil | AHPRTLRLPCGHYSLELAPFSYLAGYNMLSFFRSALAS* |
Ga0137388_106929901 | 3300012189 | Vadose Zone Soil | RTLALHCGHYSLELPPFSHIAGYRMLAFLRQALA* |
Ga0137388_107286322 | 3300012189 | Vadose Zone Soil | RRHNAHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0137388_111233552 | 3300012189 | Vadose Zone Soil | AALRRHNAHPRTLALHCGHYSLELPPFSHIAGFRMLTFLRQALA* |
Ga0137363_107584751 | 3300012202 | Vadose Zone Soil | NMVEALHEHGANPRTLELPCGHYSLELMPFSYIAGYRMLTYLRSALR* |
Ga0137399_114261213 | 3300012203 | Vadose Zone Soil | MLAALRRHNAHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALA* |
Ga0137362_104990613 | 3300012205 | Vadose Zone Soil | RHKPHPRTLALHCGHYSLELPPFSHIAGYRMLTFLREALAQ* |
Ga0137362_105735634 | 3300012205 | Vadose Zone Soil | AALRKHHANLRTLELHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0137362_109769491 | 3300012205 | Vadose Zone Soil | HGGHPRTLALHCGHYSLELFPFSYIAGYCMLSFLRSALAQ* |
Ga0137360_108455481 | 3300012361 | Vadose Zone Soil | PRTLALHCGHYSLELPPFSHIAGYRMLAFLRQALA* |
Ga0137361_114394552 | 3300012362 | Vadose Zone Soil | ALHEHGANPRTLELPCDRDSLELGAFSYIAGYRMLTYLRSVLA* |
Ga0137390_104466501 | 3300012363 | Vadose Zone Soil | TALRRHNPHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRQALA* |
Ga0137397_104108523 | 3300012685 | Vadose Zone Soil | LTALTEQMLAALRRHKPHPRTLALHCGHYSLELPPFSHIAGYRMLTFLREALAQ* |
Ga0137359_106965343 | 3300012923 | Vadose Zone Soil | LRRHNAHPRTLALHCGHYSLELPPFSHIAGFRMLTFLRSALA* |
Ga0137413_115837463 | 3300012924 | Vadose Zone Soil | TAQMVAALRKHHANLRTLELHCGHYSLELPPFSHIAGYRMLTFLRSALAQ* |
Ga0137413_118136052 | 3300012924 | Vadose Zone Soil | KPYPRTLALHCGHYSLELPPFSHIAGYRMLSFLRQALA* |
Ga0137416_120170622 | 3300012927 | Vadose Zone Soil | VFRKYDFTFVPALSEQTLTALPRHKPPPSTLTVHCGHYSLKLPPFSHISCYRMLPFFRQALA* |
Ga0134110_104246312 | 3300012975 | Grasslands Soil | PHTLGLHCGHYSLELAPFSYIAGYRMLAFLRGALS* |
Ga0137411_11979071 | 3300015052 | Vadose Zone Soil | ELTLEMVDALREHGANPRTLELPCGHYSLELGPFSYIAGYRMLTYLRSVLA* |
Ga0137412_100340287 | 3300015242 | Vadose Zone Soil | KPYPRTLALHCGHYSLELPPFSHIAGYRMLTFLREALAQ* |
Ga0187825_101260651 | 3300017930 | Freshwater Sediment | GAHPRTLRLPCGHYSLELAPFSYLAGYNMLSFFRSALA |
Ga0187821_105076201 | 3300017936 | Freshwater Sediment | MLDSLRRHGAHPRSLQLHCGHYSLELPPFRYIAGYRVLSFLRSALA |
Ga0193718_10917902 | 3300019999 | Soil | HGANPRTLELPCGHYSLELVPFSYIAGYRMLRYLRSALR |
Ga0210407_103069373 | 3300020579 | Soil | RRHGAKPRSMELHCGHYSLELAPFSYIAGYRMLTFLRSALAQ |
Ga0210399_110838042 | 3300020581 | Soil | ALRRHGAHPRSLELSCGHYSLELPPFSYIAGYSVLSFLRSALA |
Ga0210401_111194182 | 3300020583 | Soil | DSLRRHGAHPRVLELACGHYSLELPFFSYIAGYRMLSYLRSALA |
Ga0215015_106715481 | 3300021046 | Soil | MVEALHEHGANPRTLELPCGHYSLELMPFSYIAGYRMLTYLRSALR |
Ga0210404_104656141 | 3300021088 | Soil | EQMLAALRLHNAHPRTLALHCGHYSLELPPFSHIAGYRMLTFFRQALAQ |
Ga0210404_106870713 | 3300021088 | Soil | TEQMLTALRRYTPHPRTLALHCGHYSLELPPFSHIAGYRMLAFLRQALA |
Ga0210406_110043031 | 3300021168 | Soil | LPELTAQMLAALRQHHANLRTLELHCGHYSLELPGFSHIAGYRMLTFLRSALAQ |
Ga0210400_100936723 | 3300021170 | Soil | EQMLAALRRHNAHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRQALAQ |
Ga0210400_110746483 | 3300021170 | Soil | TALRRYTPHPRTLALHCGHYSLELPPFSHIAGYRMLAFLRQALA |
Ga0210405_113787032 | 3300021171 | Soil | LRRHGAHPRTLRLPCGHYSLELAPFSYLAGYNMLSFFRSALA |
Ga0210393_106238171 | 3300021401 | Soil | MLAALRRHGASPRSLELYCGHYSLELAPFSYIAGYRMLSFLRSALA |
Ga0210389_100467505 | 3300021404 | Soil | SHGAHPRSLELHCGHYSLELAPFSYIAGYRVLAFLRSALG |
Ga0210389_114067271 | 3300021404 | Soil | LTAQMLAALHQHHANLRTLELHCGHYSLELPPFSHIAGYRMLTFLRSALA |
Ga0210387_101776791 | 3300021405 | Soil | RSMQLHCGHYSLELPPFSYVAGYRVLSFLRSALAH |
Ga0210386_107470773 | 3300021406 | Soil | HGARPRSLELHCGHYSLELAPFSYIAGYRVLAFLRSALG |
Ga0210384_102281221 | 3300021432 | Soil | ANLRTLELHCGHYSLELPPFSHIAGYRMLTFLRGALAQ |
Ga0210384_116660861 | 3300021432 | Soil | AHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRQALAQ |
Ga0210390_112857381 | 3300021474 | Soil | NEAAPRTLELHCGHYSLELAPFSYVAGYRMLTYLRSTLLAR |
Ga0126371_139093611 | 3300021560 | Tropical Forest Soil | REHGAAPKTLQLACGHYSLELAPFSYIAGYRMLTYLRSALA |
Ga0247664_10510503 | 3300024232 | Soil | PKTLELACGHYSLELAPFSYIAGYRMLSYLRSALA |
Ga0207664_116653652 | 3300025929 | Agricultural Soil | GANPRTLELPCGHYSLELVPFNYIAGYRMLTYLRSALR |
Ga0209863_101529782 | 3300026281 | Prmafrost Soil | RTGAPPRTLELHCGHYSLELSPFSYIAGYQMLTFLRNSLTNGAIRP |
Ga0179587_102658261 | 3300026557 | Vadose Zone Soil | TALRRHTPHPRTLALHCGHYSLELPPFSHIAGYRMLSFLRQALA |
Ga0209736_10683252 | 3300027660 | Forest Soil | PRVLELACGHYSLELRPFSYIAGYQMLSFFRRALGNSR |
Ga0209530_10343253 | 3300027692 | Forest Soil | TPRTLELHCGHYSLELAPFSHVAGYRMLTYLRSTLLAR |
Ga0209581_11264781 | 3300027706 | Surface Soil | LPCGHYSLELAPFSYIAGYRMLSFFRSALIPKSQLA |
Ga0209178_10025127 | 3300027725 | Agricultural Soil | HGATPRTLGLHCGHYSLELAPFSYIAGYRMLAFLRSALSQ |
Ga0209178_10344061 | 3300027725 | Agricultural Soil | HGAHPRTLELPCGHYSLELAPFSYIAGYRMLSFLRSTLSRDSTS |
Ga0209328_101914541 | 3300027727 | Forest Soil | RRHDANLRTLELACGHYSLELPPFSHIAGYRMLTFLHSALAQ |
Ga0209038_101829953 | 3300027737 | Bog Forest Soil | QHHANLRTLELHCGHYSLELPPFSHIAGYRMLTFLRSALAQ |
Ga0209167_107576421 | 3300027867 | Surface Soil | PELTAQMLAALRQHHANLRTLELHCGHYSLELPPFSHIAGYRMLTFLRSALAQ |
Ga0209283_103345711 | 3300027875 | Vadose Zone Soil | MLAALRRYTPHPRTLALHCGHYSLELPPFSHIAGYRMLSFLRSVLAQ |
Ga0308309_114267143 | 3300028906 | Soil | TVELHCGHYSLELAPFSHIAGYKMLTYLRSTLLAG |
Ga0302310_101859441 | 3300030737 | Palsa | LRRTGASPRTLELHCGHYSLELSPFSYIAGYRMLTFLRSSLMSSAAHS |
Ga0318542_100115181 | 3300031668 | Soil | PKTLELACGHYSLELAPFSYIAGYRMLTYLRSALA |
Ga0307476_111895431 | 3300031715 | Hardwood Forest Soil | THPRSLQLHCGHYSLELPPFSYIAGYRVLSFLRSALAA |
Ga0307474_103032921 | 3300031718 | Hardwood Forest Soil | DSLRRHGAHPRSLQLHCGHYSLELPPFSYIAGYRVLSFLRSALAA |
Ga0307475_107163542 | 3300031754 | Hardwood Forest Soil | ALRRYKPHPRTLALHCGHYSLELPPFSHIAGYRMLSFLRQALT |
Ga0307475_108288751 | 3300031754 | Hardwood Forest Soil | YKPHPRTLALHCGHYSLELPPFSHIAGYRMLSFLRQALA |
Ga0318509_104675701 | 3300031768 | Soil | ADPQTLELACGHYSLELAPFSYIAGIKMLGFLRSALS |
Ga0307473_108472321 | 3300031820 | Hardwood Forest Soil | AFTEQMLAALRRHNANPRTLALHCGHYSLELPPFSHIAGYRMLTFLRSALAQ |
Ga0307478_100160877 | 3300031823 | Hardwood Forest Soil | VEALHEHGANPRTLELPCGHYSLELMPFSYIAGYRMLTYLRSALR |
Ga0318564_101934183 | 3300031831 | Soil | REHGAAPKTLELACGHYSLELAPFSYIAGYRMLTYLRSALA |
Ga0310910_100244251 | 3300031946 | Soil | RPRTLALRCGHYSLELFPFSYVAGYRMLAFLRGALSGSG |
Ga0307479_107574312 | 3300031962 | Hardwood Forest Soil | RHGANPRTLALHCGHYSLELAPFSYIAGYRMLSFFRSALA |
Ga0318505_100710871 | 3300032060 | Soil | PRTLALRCGHYSLELFPFSYVAGYRMLAFLRGALSGSG |
Ga0306924_121061001 | 3300032076 | Soil | GANPKTLELPCGHYSLELAPFSYVAGYRMLSYLRSALA |
Ga0307471_1030551071 | 3300032180 | Hardwood Forest Soil | MLAALRRHNAHPRTLALHCGHYSLELPPFSHIAGYRMLTFLRQALAQ |
Ga0306920_1014256892 | 3300032261 | Soil | RPRTLSLHCGHYSLELPFFSHIAGYRMITFLRDALA |
Ga0306920_1015072821 | 3300032261 | Soil | QHGAAPKTLELACGHYSLELAPFSYIAGYRMLNYFRAELA |
Ga0335079_100370413 | 3300032783 | Soil | MPKIRGADPRTLELPCGHYSLELAPFSYIAGYRMLSFFRSSLAQ |
Ga0335072_105735001 | 3300032898 | Soil | LRRHGAKPRSLELHCGHYSLELAPFSYIAGYRVLAFLRSALA |
⦗Top⦘ |