| Basic Information | |
|---|---|
| Family ID | F079855 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 50 residues |
| Representative Sequence | VSMEFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.61 % |
| % of genes near scaffold ends (potentially truncated) | 94.78 % |
| % of genes from short scaffolds (< 2000 bps) | 93.04 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.391 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (19.130 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.565 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.087 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.58% β-sheet: 23.38% Coil/Unstructured: 61.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF07364 | DUF1485 | 8.70 |
| PF07690 | MFS_1 | 6.09 |
| PF13450 | NAD_binding_8 | 5.22 |
| PF00892 | EamA | 3.48 |
| PF13193 | AMP-binding_C | 3.48 |
| PF04191 | PEMT | 1.74 |
| PF10576 | EndIII_4Fe-2S | 1.74 |
| PF13411 | MerR_1 | 0.87 |
| PF02653 | BPD_transp_2 | 0.87 |
| PF13231 | PMT_2 | 0.87 |
| PF13374 | TPR_10 | 0.87 |
| PF05544 | Pro_racemase | 0.87 |
| PF01839 | FG-GAP | 0.87 |
| PF12681 | Glyoxalase_2 | 0.87 |
| PF00285 | Citrate_synt | 0.87 |
| PF00515 | TPR_1 | 0.87 |
| PF08486 | SpoIID | 0.87 |
| PF00903 | Glyoxalase | 0.87 |
| PF05977 | MFS_3 | 0.87 |
| PF12680 | SnoaL_2 | 0.87 |
| PF00730 | HhH-GPD | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 8.70 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.87 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.87 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.87 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.87 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.87 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.87 |
| COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.87 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.39 % |
| Unclassified | root | N/A | 2.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000886|AL3A1W_1081924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1548 | Open in IMG/M |
| 3300001536|A1565W1_10664783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 669 | Open in IMG/M |
| 3300004156|Ga0062589_100067430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2107 | Open in IMG/M |
| 3300005172|Ga0066683_10320941 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005177|Ga0066690_10406439 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005177|Ga0066690_10524194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 795 | Open in IMG/M |
| 3300005177|Ga0066690_10688360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 678 | Open in IMG/M |
| 3300005178|Ga0066688_10423058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
| 3300005294|Ga0065705_11090253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 525 | Open in IMG/M |
| 3300005334|Ga0068869_101650099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 571 | Open in IMG/M |
| 3300005343|Ga0070687_101151967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 570 | Open in IMG/M |
| 3300005366|Ga0070659_101346631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 634 | Open in IMG/M |
| 3300005441|Ga0070700_101549025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 565 | Open in IMG/M |
| 3300005447|Ga0066689_10697303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 635 | Open in IMG/M |
| 3300005458|Ga0070681_10188106 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300005468|Ga0070707_100032277 | All Organisms → cellular organisms → Bacteria | 4988 | Open in IMG/M |
| 3300005468|Ga0070707_101641837 | Not Available | 610 | Open in IMG/M |
| 3300005518|Ga0070699_100539186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1062 | Open in IMG/M |
| 3300005518|Ga0070699_102019566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300005536|Ga0070697_101915446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300005537|Ga0070730_10015311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6117 | Open in IMG/M |
| 3300005539|Ga0068853_102221115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300005549|Ga0070704_100728384 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005557|Ga0066704_10983903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
| 3300005559|Ga0066700_10306982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1119 | Open in IMG/M |
| 3300005569|Ga0066705_10631396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 653 | Open in IMG/M |
| 3300005576|Ga0066708_10053375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2270 | Open in IMG/M |
| 3300005586|Ga0066691_10027844 | All Organisms → cellular organisms → Bacteria | 2891 | Open in IMG/M |
| 3300005598|Ga0066706_11315180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 546 | Open in IMG/M |
| 3300005614|Ga0068856_100122597 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
| 3300005718|Ga0068866_10959061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 605 | Open in IMG/M |
| 3300005844|Ga0068862_101748490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 631 | Open in IMG/M |
| 3300006796|Ga0066665_10806841 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300006797|Ga0066659_11119301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 658 | Open in IMG/M |
| 3300006797|Ga0066659_11608582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
| 3300006852|Ga0075433_10282619 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300006918|Ga0079216_11435368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 573 | Open in IMG/M |
| 3300007076|Ga0075435_101574862 | Not Available | 576 | Open in IMG/M |
| 3300009012|Ga0066710_102561883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 735 | Open in IMG/M |
| 3300009088|Ga0099830_10805074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 775 | Open in IMG/M |
| 3300009089|Ga0099828_10497292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1099 | Open in IMG/M |
| 3300009089|Ga0099828_11616411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 570 | Open in IMG/M |
| 3300009090|Ga0099827_10530006 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300009100|Ga0075418_12911322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 522 | Open in IMG/M |
| 3300009137|Ga0066709_103933000 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009148|Ga0105243_12546823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 551 | Open in IMG/M |
| 3300009162|Ga0075423_10153347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2418 | Open in IMG/M |
| 3300010087|Ga0127492_1100212 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010133|Ga0127459_1093260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 534 | Open in IMG/M |
| 3300010303|Ga0134082_10085082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1241 | Open in IMG/M |
| 3300010325|Ga0134064_10091170 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300010362|Ga0126377_12815171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 561 | Open in IMG/M |
| 3300010373|Ga0134128_11764255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 681 | Open in IMG/M |
| 3300010375|Ga0105239_13398407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 518 | Open in IMG/M |
| 3300011270|Ga0137391_10240939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1569 | Open in IMG/M |
| 3300012001|Ga0120167_1116455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 538 | Open in IMG/M |
| 3300012019|Ga0120139_1165855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
| 3300012203|Ga0137399_11656373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 528 | Open in IMG/M |
| 3300012206|Ga0137380_10766596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 834 | Open in IMG/M |
| 3300012285|Ga0137370_10551786 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012360|Ga0137375_11336246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 538 | Open in IMG/M |
| 3300012362|Ga0137361_10037044 | All Organisms → cellular organisms → Bacteria | 3927 | Open in IMG/M |
| 3300012400|Ga0134048_1184887 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300012402|Ga0134059_1303170 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300012681|Ga0136613_10803587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 501 | Open in IMG/M |
| 3300012923|Ga0137359_10600729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 965 | Open in IMG/M |
| 3300012977|Ga0134087_10509221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 607 | Open in IMG/M |
| 3300013831|Ga0120126_1040587 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300015190|Ga0167651_1096697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 558 | Open in IMG/M |
| 3300015372|Ga0132256_103203491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300017997|Ga0184610_1246762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 594 | Open in IMG/M |
| 3300018000|Ga0184604_10011474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1889 | Open in IMG/M |
| 3300018027|Ga0184605_10257675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 792 | Open in IMG/M |
| 3300018052|Ga0184638_1158475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 814 | Open in IMG/M |
| 3300018071|Ga0184618_10487012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 517 | Open in IMG/M |
| 3300018074|Ga0184640_10471038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 556 | Open in IMG/M |
| 3300018431|Ga0066655_10530557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 784 | Open in IMG/M |
| 3300019259|Ga0184646_1046080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300020202|Ga0196964_10700269 | Not Available | 502 | Open in IMG/M |
| 3300025910|Ga0207684_10602100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 939 | Open in IMG/M |
| 3300025912|Ga0207707_10842581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 761 | Open in IMG/M |
| 3300025918|Ga0207662_10547476 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300025921|Ga0207652_11675397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 540 | Open in IMG/M |
| 3300025922|Ga0207646_10215904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1732 | Open in IMG/M |
| 3300025922|Ga0207646_10658036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 938 | Open in IMG/M |
| 3300025922|Ga0207646_11372707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300025922|Ga0207646_11689183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
| 3300025934|Ga0207686_10290786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1210 | Open in IMG/M |
| 3300025942|Ga0207689_10750100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 824 | Open in IMG/M |
| 3300025949|Ga0207667_11940594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300026041|Ga0207639_11546947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300026298|Ga0209236_1057432 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300026300|Ga0209027_1231105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
| 3300026309|Ga0209055_1156586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300026317|Ga0209154_1290207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300026318|Ga0209471_1245178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300026523|Ga0209808_1185418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 726 | Open in IMG/M |
| 3300026536|Ga0209058_1153043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1078 | Open in IMG/M |
| 3300026537|Ga0209157_1277862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 627 | Open in IMG/M |
| 3300026552|Ga0209577_10388642 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300027637|Ga0209818_1223993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 558 | Open in IMG/M |
| 3300027873|Ga0209814_10432370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 580 | Open in IMG/M |
| 3300027882|Ga0209590_10810713 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300028006|Ga0247717_1016115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1181 | Open in IMG/M |
| 3300028711|Ga0307293_10047482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1330 | Open in IMG/M |
| 3300028771|Ga0307320_10225542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 736 | Open in IMG/M |
| 3300028792|Ga0307504_10390277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
| 3300028828|Ga0307312_10790995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 628 | Open in IMG/M |
| 3300028885|Ga0307304_10045204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1611 | Open in IMG/M |
| 3300030905|Ga0308200_1146952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
| 3300031093|Ga0308197_10426761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
| 3300031720|Ga0307469_11112541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 743 | Open in IMG/M |
| 3300031965|Ga0326597_11093788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 796 | Open in IMG/M |
| 3300031965|Ga0326597_11196131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 751 | Open in IMG/M |
| 3300034164|Ga0364940_0144112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 685 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.22% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.48% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.87% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013831 | Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M | Environmental | Open in IMG/M |
| 3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028006 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-4-E_N | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL3A1W_10819242 | 3300000886 | Permafrost | TDIGSFVSMEFNMSPGGRPISVRVRGTGAWVDLKGDRFLRTTLGLKSTLVRTILF* |
| A1565W1_106647831 | 3300001536 | Permafrost | TDIGSFVSMEFNMSPGGRPISVRVRGTGASVDLKGDRFLRTTLGLRSTLVRTIPF* |
| Ga0062589_1000674301 | 3300004156 | Soil | GIDIGRFVSMAFNESPGGRPISVIVRGSIRSIDLHGERFLRATLGLPSTLVRTTPF* |
| Ga0066683_103209411 | 3300005172 | Soil | GDFVSMEFKVSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF* |
| Ga0066690_104064392 | 3300005177 | Soil | GRPISVRVRGSADWVDLKGDRFLRTTLGLKSTLVKVIPF* |
| Ga0066690_105241941 | 3300005177 | Soil | SLGFNLSPGGRPISVRVQGTLDTVDLKGDRFLRSTLGLPSTLIRTTPF* |
| Ga0066690_106883602 | 3300005177 | Soil | FKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF* |
| Ga0066688_104230583 | 3300005178 | Soil | EDYGIDIGDFVSLELNMSPGGRPVSVLVRGTHDWVDLKGDRFLRTTLGLKSTLVRMIPF* |
| Ga0065705_110902532 | 3300005294 | Switchgrass Rhizosphere | PGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF* |
| Ga0068869_1016500991 | 3300005334 | Miscanthus Rhizosphere | IGHLVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF* |
| Ga0070687_1011519671 | 3300005343 | Switchgrass Rhizosphere | VDIGHLVSIRFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF* |
| Ga0070659_1013466311 | 3300005366 | Corn Rhizosphere | NESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF* |
| Ga0070700_1015490251 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VSMEFNESPGGRPISVRVRGTGASVDLKGDRFLRTVLGLRSTLVRTRPF* |
| Ga0066689_106973032 | 3300005447 | Soil | MQFNESPGGRPISVRVYGTDASIDLKGDRVLRTTLGLKSTLVRTVPF* |
| Ga0070681_101881062 | 3300005458 | Corn Rhizosphere | VDIGHLVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGMKSTLVHTTPF* |
| Ga0070707_1000322776 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IIEDYGVDIGSFVAMEFNMSPGGRPVSVQVRGTDRWVDLKGDRFLRNTLGLKSTLVKTVRF* |
| Ga0070707_1016418372 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IIEDYGVDIGNFVSLEFNQSPGGRPISVQVRGTDRWVDLKGDRFLRTTLGLKSTLVKTVRF* |
| Ga0070699_1005391864 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DIGQFVSLAFNESPGGRPISVIVRGSRRSVDLNGDQFLRNTLGLPSTLVKTTPF* |
| Ga0070699_1020195662 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPSGRPISVRVQGTRTTVDLKGDKFLRETLGLPANLVRTSPF* |
| Ga0070697_1019154461 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | YGLDIGTFVSMEFNMSPGGRPISVLVRGTHDWVDLKGDRFLRTTLGLKSTLVRMIPF* |
| Ga0070730_100153111 | 3300005537 | Surface Soil | DYGVDIGDYVWMQFNESPGGRPISVRVYGTDASVDLKGDRFLRTTLGLRSTLVRTIPF* |
| Ga0068853_1022211151 | 3300005539 | Corn Rhizosphere | FNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF* |
| Ga0070704_1007283843 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | NMSPGQRPISVRVRGTAGAVDLKGDRFLRTTLGLKSTLVRTTPF* |
| Ga0066704_109839032 | 3300005557 | Soil | GGRPISVLVRGAHDWVDLKGDRFLRTTLGLKSTLVRMIPF* |
| Ga0066700_103069822 | 3300005559 | Soil | SVRVRGTNAAADLKGDRFLRTTLGLKSTLVSTTPF* |
| Ga0066705_106313961 | 3300005569 | Soil | MSPGGRPISVRVQGTLDTVDLKGDRFLRSTLGLPSTLVRTTGF* |
| Ga0066708_100533753 | 3300005576 | Soil | QIIEDYGIDIGTFVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF* |
| Ga0066691_100278443 | 3300005586 | Soil | FVSMEFNLSPGGRPISVLVRGTGDWVDLKGDRFLRTTLGLRSTLVRMIPF* |
| Ga0066706_113151801 | 3300005598 | Soil | PGGRPISVRVQGTSAAVDLKGDRFLRTTLGLKSTLVSTMPF* |
| Ga0068856_1001225971 | 3300005614 | Corn Rhizosphere | MSRGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF* |
| Ga0068866_109590612 | 3300005718 | Miscanthus Rhizosphere | PISVLVRGTSSDIDLKGDRFLRTTLGLKSTLVHTTPF* |
| Ga0068862_1017484902 | 3300005844 | Switchgrass Rhizosphere | IQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF* |
| Ga0066665_108068411 | 3300006796 | Soil | GRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF* |
| Ga0066659_111193012 | 3300006797 | Soil | GIDIGTFVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF* |
| Ga0066659_116085822 | 3300006797 | Soil | GVDIGPFVSIAFNESPGGRPISVMIRGSCRSVDLNGDQFLRATLGLPSTLVQTTPF* |
| Ga0075433_102826191 | 3300006852 | Populus Rhizosphere | WDEYGVDIGGFVSLAFNESPAGRPISVRVRGTLAAVDLRGDRFLRTVLGLKSTLVSTRPF |
| Ga0079216_114353681 | 3300006918 | Agricultural Soil | DIGRFVSMDFNMSPGERPISVRVRGTDAALDLKGDRFLRTTLGLKSTLVRTTPF* |
| Ga0075435_1015748622 | 3300007076 | Populus Rhizosphere | GNFVAMAFNTSPGGRPVSVQVRGTDRWVDLKGDRFLRSTLGLKSTLVKTVRF* |
| Ga0066710_1025618831 | 3300009012 | Grasslands Soil | YGVDVGQFVSLAFNESPGGRPISVIVRGSRRSIDLNGDQFLRRTLGLASTMVRTTPF |
| Ga0099830_108050741 | 3300009088 | Vadose Zone Soil | DIGSFISIEFNESPGGRPISVRVRGTSAAVDLKADRFLRTTLGLKSTLVHTTPF* |
| Ga0099828_104972923 | 3300009089 | Vadose Zone Soil | VSLAFNDSPAGRPISVVVRGSNQSVDLNGEQFLRATLGLRSTLVETTPF* |
| Ga0099828_116164111 | 3300009089 | Vadose Zone Soil | GSFISIEFNESPGGRPISVRVRGTSAVVDLKGDRFLRTTLGLKSTLVHTTPF* |
| Ga0099827_105300063 | 3300009090 | Vadose Zone Soil | SVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF* |
| Ga0075418_129113222 | 3300009100 | Populus Rhizosphere | MDFNMSPGERPISVRVRGTEASLDLKGDRFLRTTLGLKSTLVRTTPF* |
| Ga0066709_1039330002 | 3300009137 | Grasslands Soil | GGRPISVRVRGSADWVDLKGDRFLRTTLGLKSTLVKVIPF* |
| Ga0105243_125468231 | 3300009148 | Miscanthus Rhizosphere | LVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGMKSTLVHTTPF* |
| Ga0075423_101533474 | 3300009162 | Populus Rhizosphere | RREIWNDYGYDIGGFVAMRFNESPGGRPISVQIDGTRMTVDLKGDRFLRTTLGLRSTLVRTTPF* |
| Ga0127492_11002122 | 3300010087 | Grasslands Soil | FNVSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF* |
| Ga0127459_10932602 | 3300010133 | Grasslands Soil | DYGVDIGRFVSIAFNESPGGRPISVVIRGSSRSVDLNGDQFLRATLGLRSTLVRTTPF* |
| Ga0134082_100850822 | 3300010303 | Grasslands Soil | VSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF* |
| Ga0134064_100911702 | 3300010325 | Grasslands Soil | PISVRVRGSADWVDLKGDRFLRTTLGLKSTLVKVIPF* |
| Ga0126377_128151712 | 3300010362 | Tropical Forest Soil | SVGFNESPGGRPISVRVQGTLDTVDLKGDRFLRSTLGLPATLVRTSPF* |
| Ga0134128_117642552 | 3300010373 | Terrestrial Soil | SMEFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF* |
| Ga0105239_133984072 | 3300010375 | Corn Rhizosphere | FNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF* |
| Ga0137391_102409391 | 3300011270 | Vadose Zone Soil | IGQFVSMAFNESAGGRPISVIVRGSRRSVDLNGDQFLRRTLGLASTMVRTAPF* |
| Ga0120167_11164552 | 3300012001 | Permafrost | DHGLRGDIGFFVSMGFNESPGGRPISVVIRGSTRSVDLNGEQFLRNTLGLRSTLVQTTPF |
| Ga0120139_11658551 | 3300012019 | Permafrost | ISVRVRGTGAWVDLKGDRFLRTTLGLKSTLVRTILF* |
| Ga0137399_116563731 | 3300012203 | Vadose Zone Soil | GSFISLEFNESPGGRPISVRVQGTSAAVNLKGDRFLRTTLGLKSTLVNTTPF* |
| Ga0137380_107665962 | 3300012206 | Vadose Zone Soil | DIGRFVSMAFNESPGGRPISVVIRGSSRSVDLNGDQFLRATLGLRSTLVRTTPF* |
| Ga0137370_105517861 | 3300012285 | Vadose Zone Soil | LEFNESPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF* |
| Ga0137375_113362461 | 3300012360 | Vadose Zone Soil | ISMEFNMSPGGRPISVRVRGTDGWVDLKGDRFLRTTLGLKSTLVRTTPF* |
| Ga0137361_100370441 | 3300012362 | Vadose Zone Soil | SPGGRPISVRVQGTSAAVDLKGDRFLRTTLGLKSTLVSTTPF* |
| Ga0134048_11848872 | 3300012400 | Grasslands Soil | VSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF* |
| Ga0134059_13031702 | 3300012402 | Grasslands Soil | DFVSMEFNMSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF* |
| Ga0136613_108035871 | 3300012681 | Polar Desert Sand | EIITDYGIDIGQFIAMKFAYSPGGRPLSVKVVGSLGVADLAGDRFLRTTLGMKSSLVRTTPF* |
| Ga0137359_106007292 | 3300012923 | Vadose Zone Soil | VSMEFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF* |
| Ga0134087_105092212 | 3300012977 | Grasslands Soil | DYGVDIGQFLSIAFNESAGGRPISVIVRGNRRSVDLHGDQFLRRTLGLASTMVRTAPF* |
| Ga0120126_10405872 | 3300013831 | Permafrost | MAFNENPGGRPISVVVRGSARSIDLNGEQFLRGTLGLRSTLVRTTPF* |
| Ga0167651_10966971 | 3300015190 | Glacier Forefield Soil | FNESPGGRPISVRVRGTAASVDVKGDRFLRTVLGLRSTLVRTRPF* |
| Ga0132256_1032034911 | 3300015372 | Arabidopsis Rhizosphere | GIDIGAYVAMQFNMSPGGRPISVRIRGSYATVDLKGDRFLRTTLGLKSTLVRAIPF* |
| Ga0184610_12467622 | 3300017997 | Groundwater Sediment | FVSMGFNESPGGRPISVVVRGSNRSVDLPGSQFLRDTLGLRSTLVSTTPF |
| Ga0184604_100114743 | 3300018000 | Groundwater Sediment | DIGHLVSLQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF |
| Ga0184605_102576751 | 3300018027 | Groundwater Sediment | MEFNESPGGRPISVRVRGTGAAVDLKGDRFLRTTLGMKSTLVSTTPF |
| Ga0184638_11584752 | 3300018052 | Groundwater Sediment | EDYGVDIGRFVSIQFNESPGGRPISVLVRGTAADVDLKGDRFLRTTLGLKSTLVHTTPF |
| Ga0184618_104870122 | 3300018071 | Groundwater Sediment | IEDYGVDIGRFVSIQFHESPGGRPVSVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF |
| Ga0184640_104710381 | 3300018074 | Groundwater Sediment | EIIVDYGVDIGHFVSMDFNMSPGERPISVRVRGTDAALDLKGDRFLRTTLGLKSTLVRTIPF |
| Ga0066655_105305572 | 3300018431 | Grasslands Soil | MQFNLSPGGRPVSVVVRGTADAVDLKGDRFLRTTLGLKSTLVRAIPF |
| Ga0184646_10460801 | 3300019259 | Groundwater Sediment | GIDIGQFVSMGFNESPGGRPISVVVRGSNRSVDLHGEQFLRATLGLRSTLVSTTPF |
| Ga0196964_107002692 | 3300020202 | Soil | GRPVSVRIRASRAAADLPGDRFLRTTLGMRSTLVRTEPF |
| Ga0207684_106021002 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SMEFKMSPGGRPLSVVVRGTYDAVDLKGDRFLRTTFGLKSSLVRMIPF |
| Ga0207707_108425812 | 3300025912 | Corn Rhizosphere | VDIGHLVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGMKSTLVHTTPF |
| Ga0207662_105474762 | 3300025918 | Switchgrass Rhizosphere | MSPGGRPISVRVRGTDASVDLKGDRFLRTTLGLKSTLVRTIPF |
| Ga0207652_116753971 | 3300025921 | Corn Rhizosphere | QIIEDYGVDIGHLVSIQFNESPGGRPISVLVRGTYADVDLKGDRFLRTTLGMKSTLVHTTPF |
| Ga0207646_102159042 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IGRFVSMGFNESPGGRPISVVVRGSDRSVDLHGGQFLRATLGLRSTLVSTTPF |
| Ga0207646_106580363 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EDYGVDIGTFVSMEFKLSPGGRPVSVLIRGTYNFVDLKGDRFLRTTLGLKSTLVRMSPF |
| Ga0207646_113727072 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PISVRVRGTDAVVDLKGDRFLRTTLGLKSTLVSTTPF |
| Ga0207646_116891832 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RMSPGGRPLSVVVRGTYDAVDLKGDRFLRTTFGLKSSLVRMIPF |
| Ga0207686_102907862 | 3300025934 | Miscanthus Rhizosphere | PGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF |
| Ga0207689_107501001 | 3300025942 | Miscanthus Rhizosphere | VSMAFNESPGGRPISVIVRGSIRSIDLHGERFLRATLGLPSTLVRTTPF |
| Ga0207667_119405942 | 3300025949 | Corn Rhizosphere | EFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF |
| Ga0207639_115469471 | 3300026041 | Corn Rhizosphere | FNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF |
| Ga0209236_10574321 | 3300026298 | Grasslands Soil | MEFNVSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIAF |
| Ga0209027_12311052 | 3300026300 | Grasslands Soil | YDIGNYVSMEFNMSPGGRPISVRVRGTDGWVDLKGDRFLRTTLGLKSTLVRTIPF |
| Ga0209055_11565863 | 3300026309 | Soil | IGDFVSLELNMSPGGRPVSVLVRGTHDWVDLKGDRFLRTTLGLKSTLVRMIPF |
| Ga0209154_12902072 | 3300026317 | Soil | ELNMSPGGRPVSVLVRGTHDWVDLKGDRFLRTTLGLKSTLVRMIPF |
| Ga0209471_12451781 | 3300026318 | Soil | IIEDYGIDIGTFVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIP |
| Ga0209808_11854181 | 3300026523 | Soil | DIGTFVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF |
| Ga0209058_11530431 | 3300026536 | Soil | VAMQFNLSPGGRPVSVVVRGTADAVDLKGDRFLRTTLGLKSTLVRAIPF |
| Ga0209157_12778621 | 3300026537 | Soil | FVAMQFNLSPGGRPVSVVVRGTADAVDLKGDRFLRTTLGLKSTLVRAIPF |
| Ga0209577_103886421 | 3300026552 | Soil | YGVDIGRFVSMEFNMSPGGRPISVRVRGSADWVDLKGDRFLRTTLGLKSTLVKVIPF |
| Ga0209818_12239932 | 3300027637 | Agricultural Soil | IDFNMSPGERPISVRVRGTDASLDLKGDRFLRTTLGLKSTLVRTTPF |
| Ga0209814_104323702 | 3300027873 | Populus Rhizosphere | DIGRFVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF |
| Ga0209590_108107131 | 3300027882 | Vadose Zone Soil | GGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF |
| Ga0247717_10161152 | 3300028006 | Soil | ISVRVRGTDGWVDLKGDRFLRTTLGLKSTLVRTNPF |
| Ga0307293_100474821 | 3300028711 | Soil | MGFNESPGGRPISVVVRGSDRSVDLPGSQFLRDTLGLRSTLVSTTPF |
| Ga0307320_102255422 | 3300028771 | Soil | LVSLQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF |
| Ga0307504_103902772 | 3300028792 | Soil | MQFNESPGGRPISVRVYGSLGSVDLKGDRFLRITLGLKSTLVRTLPF |
| Ga0307312_107909952 | 3300028828 | Soil | EDYGIDIGQFVSMGFNESPGGRPISVVVRGSDRSVDLHGDQFLRATLGLRSTLVSTTPF |
| Ga0307304_100452041 | 3300028885 | Soil | VDIGRFVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF |
| Ga0308200_11469522 | 3300030905 | Soil | QFVSMGFNESPGGRPISVVVRGSNRSVDLPGSQFLRDTLGLRSTLVSTTPF |
| Ga0308197_104267611 | 3300031093 | Soil | GQFVSMGFNESPGGRPISVVVRGSNRSVDLPGSQFLRDTLGLRSTLVSTTPF |
| Ga0307469_111125412 | 3300031720 | Hardwood Forest Soil | YGMDIGGFVAMQFNESPGGRPISVRVRGTLATVDLKGDRFLRTTLGLRSTLVRTWPF |
| Ga0326597_110937881 | 3300031965 | Soil | DIGRFVSMAFNKSPGGRPISVVVRGSSRSVDLNGDQFLRFTLGLPSTLVRTTPFSRV |
| Ga0326597_111961312 | 3300031965 | Soil | YGVDIGPFVSMEFSLSPGGRPVSVRVRGSDAAVDLKGDRFLRTTLGLKSTLVRTTPF |
| Ga0364940_0144112_1_123 | 3300034164 | Sediment | GERPISVRIRGTDAALDLKGDRFLRTTLGLKSTLVRTTPF |
| ⦗Top⦘ |