| Basic Information | |
|---|---|
| Family ID | F079789 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RKTKGRLIYKAWAQDSPKVYEAILKAINATAIQFNKSTEIKKAA |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 96.52 % |
| % of genes from short scaffolds (< 2000 bps) | 88.70 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (86.957 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (33.043 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.174 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.696 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.70 % |
| Unclassified | root | N/A | 11.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002383|B570J29604_1006870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300003393|JGI25909J50240_1002837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4429 | Open in IMG/M |
| 3300003393|JGI25909J50240_1092030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300003404|JGI25920J50251_10073147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
| 3300003499|JGI25930J51415_1031144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
| 3300004124|Ga0066178_10239016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300005582|Ga0049080_10234427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300005582|Ga0049080_10290069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300005805|Ga0079957_1077127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1900 | Open in IMG/M |
| 3300006805|Ga0075464_10161777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
| 3300006920|Ga0070748_1322826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300007363|Ga0075458_10154424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300007559|Ga0102828_1098753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300007559|Ga0102828_1135683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300007974|Ga0105747_1233051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300008114|Ga0114347_1018069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3372 | Open in IMG/M |
| 3300008117|Ga0114351_1222370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300008118|Ga0114352_1136350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300008266|Ga0114363_1142857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300008450|Ga0114880_1276056 | Not Available | 506 | Open in IMG/M |
| 3300008459|Ga0114865_1124466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300009068|Ga0114973_10355498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300009151|Ga0114962_10350044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300009155|Ga0114968_10097820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1798 | Open in IMG/M |
| 3300009184|Ga0114976_10437189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300009184|Ga0114976_10463712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300010885|Ga0133913_10559038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3008 | Open in IMG/M |
| 3300010885|Ga0133913_12918497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
| 3300010885|Ga0133913_13111046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
| 3300011010|Ga0139557_1082375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300013004|Ga0164293_10546606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10075392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2691 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10114957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2226 | Open in IMG/M |
| 3300013372|Ga0177922_10909313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300014050|Ga0119952_1116593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10658866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300017700|Ga0181339_1018114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300017701|Ga0181364_1033735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300017707|Ga0181363_1018083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
| 3300017716|Ga0181350_1127160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300017716|Ga0181350_1139534 | Not Available | 571 | Open in IMG/M |
| 3300017716|Ga0181350_1139729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300017722|Ga0181347_1132512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300017736|Ga0181365_1156944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300017747|Ga0181352_1147876 | Not Available | 623 | Open in IMG/M |
| 3300017774|Ga0181358_1038954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1832 | Open in IMG/M |
| 3300017774|Ga0181358_1284273 | Not Available | 509 | Open in IMG/M |
| 3300017777|Ga0181357_1285951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300017777|Ga0181357_1311761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300017778|Ga0181349_1029993 | All Organisms → Viruses → Predicted Viral | 2189 | Open in IMG/M |
| 3300017780|Ga0181346_1019072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2889 | Open in IMG/M |
| 3300017784|Ga0181348_1238985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300017785|Ga0181355_1033462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2215 | Open in IMG/M |
| 3300017785|Ga0181355_1049024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1796 | Open in IMG/M |
| 3300017785|Ga0181355_1049856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1780 | Open in IMG/M |
| 3300019784|Ga0181359_1020269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2513 | Open in IMG/M |
| 3300019784|Ga0181359_1115776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300020048|Ga0207193_1622084 | Not Available | 718 | Open in IMG/M |
| 3300020109|Ga0194112_10340299 | Not Available | 1114 | Open in IMG/M |
| 3300020222|Ga0194125_10568846 | Not Available | 681 | Open in IMG/M |
| 3300020551|Ga0208360_1050223 | Not Available | 524 | Open in IMG/M |
| 3300021091|Ga0194133_10304498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300021519|Ga0194048_10106729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300021962|Ga0222713_10560141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300021963|Ga0222712_10068652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2572 | Open in IMG/M |
| 3300022190|Ga0181354_1054908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
| 3300022198|Ga0196905_1014222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2575 | Open in IMG/M |
| 3300022407|Ga0181351_1256521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300023174|Ga0214921_10181720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
| 3300023184|Ga0214919_10600203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300025451|Ga0208426_1017888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
| 3300025635|Ga0208147_1098491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300027581|Ga0209651_1045049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
| 3300027608|Ga0208974_1173200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300027644|Ga0209356_1100097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300027644|Ga0209356_1170209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300027659|Ga0208975_1057745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
| 3300027707|Ga0209443_1251480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300027732|Ga0209442_1084019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1308 | Open in IMG/M |
| 3300027732|Ga0209442_1261002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300027741|Ga0209085_1354859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300027756|Ga0209444_10248775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300027759|Ga0209296_1289373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300027759|Ga0209296_1319053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300027760|Ga0209598_10336657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300027760|Ga0209598_10357065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300027764|Ga0209134_10256305 | Not Available | 599 | Open in IMG/M |
| 3300027804|Ga0209358_10187208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300027808|Ga0209354_10081293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1318 | Open in IMG/M |
| 3300027900|Ga0209253_10805625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300027900|Ga0209253_11085712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300027963|Ga0209400_1298251 | Not Available | 618 | Open in IMG/M |
| 3300028027|Ga0247722_10263737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10156163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1750 | Open in IMG/M |
| 3300031758|Ga0315907_10221385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1579 | Open in IMG/M |
| 3300031857|Ga0315909_10170816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1761 | Open in IMG/M |
| 3300031857|Ga0315909_10223836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1468 | Open in IMG/M |
| 3300031951|Ga0315904_10244919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1721 | Open in IMG/M |
| 3300031951|Ga0315904_10595204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300031963|Ga0315901_10470641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300032018|Ga0315272_10355074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300032116|Ga0315903_10219142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1673 | Open in IMG/M |
| 3300033233|Ga0334722_10887975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300033992|Ga0334992_0411065 | Not Available | 605 | Open in IMG/M |
| 3300034062|Ga0334995_0402520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300034062|Ga0334995_0454477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300034062|Ga0334995_0461366 | Not Available | 776 | Open in IMG/M |
| 3300034104|Ga0335031_0252012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1170 | Open in IMG/M |
| 3300034104|Ga0335031_0303846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300034106|Ga0335036_0101439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2112 | Open in IMG/M |
| 3300034109|Ga0335051_0563403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300034118|Ga0335053_0300285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
| 3300034200|Ga0335065_0604350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300034280|Ga0334997_0350927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 33.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.96% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.22% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.35% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.48% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.48% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.74% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.74% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.87% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.87% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.87% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.87% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.87% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002383 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008118 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29604_10068701 | 3300002383 | Freshwater | GGRKTKGRLIYKAWSQDSLKVYEAILKAIDQSAVQFNKKTEIKSKKAA* |
| JGI25909J50240_10028376 | 3300003393 | Freshwater Lake | KGVRGGTGKKTKGRLIFKAWSQDSSKVYDAIVEAINXTAIQFNKSTEIKKAA* |
| JGI25909J50240_10920302 | 3300003393 | Freshwater Lake | KGRLIFKAWSQDSSKVYDAILQAINSTAIQFNKSTEIKKAA* |
| JGI25920J50251_100731472 | 3300003404 | Freshwater Lake | SRKTKGRLIYKAWSQDSVKVYTAIVDAINSTATKFNKSTQVKKKVA* |
| JGI25930J51415_10311442 | 3300003499 | Freshwater Lake | TGRKMQGRLIYKAWAQDSIKVYEAILKAIDGSATEFTRKTQIKKAA* |
| Ga0066178_102390162 | 3300004124 | Freshwater Lake | GIRGGGKKTKGRLIFKAWAQDSPKVYDAILQAINDTAIQFNKSTEIKKAA* |
| Ga0049080_102344271 | 3300005582 | Freshwater Lentic | AWAQDSPKVYDAILQAINATAIQFNKSTEIKKAA* |
| Ga0049080_102900691 | 3300005582 | Freshwater Lentic | RIKGVRGGYGKKTKGRLIFKAWSTDSIKVYEAIVQAINASAITFNKATEVKKAA* |
| Ga0079957_10771271 | 3300005805 | Lake | RKTTGRLIYKAWAQDSPKVYDKILEAINSTAIRFNKATEVKKAS* |
| Ga0075464_101617771 | 3300006805 | Aqueous | KGRLIYKAWAQDSGKVYNAILKAIDNTATDFTKMTYIKKKKAA* |
| Ga0070748_13228261 | 3300006920 | Aqueous | GGASRKTKGRLIYKAWSQDSVKVYTAIVDAINSTATKFNKSTQVKKKVA* |
| Ga0075458_101544241 | 3300007363 | Aqueous | RLIYKAWAQDSGKIYQSILGAINATAIKFNKSTDIKKAA* |
| Ga0102828_10987531 | 3300007559 | Estuarine | KAWAQDNVKVYTAMIDAINATAIKFNKSTEIKKKVA* |
| Ga0102828_11356831 | 3300007559 | Estuarine | AWAQDSTKVYDAILKAINATAIQFNKATEIKKAA* |
| Ga0105747_12330512 | 3300007974 | Estuary Water | GRLIYKAWSQDSVKVYTAIVDAINSTATKFNKSTQVKKKVA* |
| Ga0114347_10180694 | 3300008114 | Freshwater, Plankton | AWAQDSGKVYQAVLGAINSTAIKFNKSTEIKKAA* |
| Ga0114351_12223702 | 3300008117 | Freshwater, Plankton | TKGRLIYKAWAQDSGKVYQAVLGAINSTAIKFNKSTEIKKAA* |
| Ga0114352_11363502 | 3300008118 | Freshwater, Plankton | LIYKAWAQDKIKVYDAILKAIDKTAVEFTRKTEIKKVA* |
| Ga0114363_11428571 | 3300008266 | Freshwater, Plankton | VRSGGRKTKGRLIYKAWAQDSGKVYDAILGAINATAVKFNKSTEIKKAA* |
| Ga0114880_12760562 | 3300008450 | Freshwater Lake | VKTKGRLIYKAFANQSPQIYQAILNAINATAVDFNKSYDKKAA* |
| Ga0114865_11244662 | 3300008459 | Freshwater Lake | AWSQDSLKVYEAILKAIDQSAVQFNKKTEIKSKKAA* |
| Ga0114973_103554981 | 3300009068 | Freshwater Lake | MQGRLVYKAWAEDSIKVYEAILKAIDNTAVEFTRKTAIKKAA* |
| Ga0114962_103500442 | 3300009151 | Freshwater Lake | RSGGRKTKGRLIFKAWAQDSPKVYESILKAINDTTVDFTKMTYIKKKKAA* |
| Ga0114968_100978201 | 3300009155 | Freshwater Lake | RFKGQVGGASRKTKGRLIFKAWAQDNVKVYTAMIDAINATAIKFNKSTEIKKKVA* |
| Ga0114976_104371891 | 3300009184 | Freshwater Lake | AWSQDSSKVYDAILQAINSTAIQFNKSTEIKKAA* |
| Ga0114976_104637121 | 3300009184 | Freshwater Lake | GGTGKKTKGRLIFKAWSQDSSKVYDAILQAINSTAIQFNKSTEIKKAA* |
| Ga0133913_105590381 | 3300010885 | Freshwater Lake | TKGRLIFKAWAQDSQEVYDAILKAINSTAIQFNKATEIKKAA* |
| Ga0133913_129184971 | 3300010885 | Freshwater Lake | RSGGVKTKGRLIYKAFANQSPRIYQAILDAINDTAVDFNKSYDKKAA* |
| Ga0133913_131110461 | 3300010885 | Freshwater Lake | RLIFKAWAQDSQEVYDAILKAINSTAIQFNKSTEIKKAA* |
| Ga0139557_10823751 | 3300011010 | Freshwater | IYKAWSQDSVKVYTAIVDAINSTATKFNKSTQVKKKVA* |
| Ga0164293_105466061 | 3300013004 | Freshwater | RSGGRKTKGRLIYKAWAQDSGKVYDAILGAINSTAIKFNKSTEIKKAA* |
| (restricted) Ga0172373_100753921 | 3300013131 | Freshwater | PKIPGARSGGRKTKGRLIYKAWSQDSLKVYEAILKAIDNTAVQFNKKTEIKGKRAA* |
| (restricted) Ga0172372_101149571 | 3300013132 | Freshwater | KTKGRLIYKAWSQDSLKVYEAILKAIDNTDVQFNKKTEIKGKRAA* |
| Ga0177922_109093131 | 3300013372 | Freshwater | RKTKGRLIYKAWAEDSPKVYDAILKAINATAVDFNKKTEIKKAA* |
| Ga0119952_11165932 | 3300014050 | Freshwater | GRKTKGRLIYKAWAQDSPKVYDAIIKAINATAVHFNKATEIKKAA* |
| (restricted) Ga0172376_106588662 | 3300014720 | Freshwater | SGGRKTKGRLIYKAWSQDSLKVYQAILKAIDNSVVQFNKKTQIKGKRAA* |
| Ga0181339_10181141 | 3300017700 | Freshwater Lake | GRLIYKAWAQESPTVYYVIVKAINSTAINFNKSTEIKKAA |
| Ga0181364_10337352 | 3300017701 | Freshwater Lake | GIRAGGKKTKGRLIFKAWAQDSPKVYDAILQAINATAIQFNKSTEIKKAA |
| Ga0181363_10180832 | 3300017707 | Freshwater Lake | YKAWAQDSPKVYDAIIKAINATAIHFNKATEIKKAA |
| Ga0181350_11271602 | 3300017716 | Freshwater Lake | GGKKTKGRLIFKAWAQDSPKVYDAILQAINDTAIQFNKSTEIKKAA |
| Ga0181350_11395342 | 3300017716 | Freshwater Lake | KKTKGRLIFKAWSQDSSKVYDAIVEAINSTAIQFNKSTEIKKAA |
| Ga0181350_11397292 | 3300017716 | Freshwater Lake | LIYRAWAEDSPDIYRAVIRAVNVTAELFNKKTEIKKAA |
| Ga0181347_11325122 | 3300017722 | Freshwater Lake | GGRKTQGRLIYRAWAEDSPEIYRAVIRAVNVTAELFNKKTEIKKAA |
| Ga0181365_11569441 | 3300017736 | Freshwater Lake | KTKGRLIFKAWAQDSPKVYDAILQAINATAIQFNKSTEIKKAA |
| Ga0181352_11478762 | 3300017747 | Freshwater Lake | GTGKKTKGRLIFKAWSQDSSKVYDAIVEAINATAIQFNKSTEIKKAA |
| Ga0181358_10389542 | 3300017774 | Freshwater Lake | KKTKGRLIFKAWSQDSSKVYDAILQAINSTAIQFNKSTEIKKAA |
| Ga0181358_12842732 | 3300017774 | Freshwater Lake | RSPGRKGQGRLIYKAWAQESPRVYYVIVKAINSTAISFNKSTEIKKAE |
| Ga0181357_12859511 | 3300017777 | Freshwater Lake | KGVRGGTGKKTKGRLIFKARSQYSSKVNDAILQEINSTDMQFNKSKENKNAAKWPM |
| Ga0181357_13117611 | 3300017777 | Freshwater Lake | KGRLIFKAWAQDSPKVYDAILQAINATAIQFNKSTEIKKAA |
| Ga0181349_10299931 | 3300017778 | Freshwater Lake | RGGTGKKTKGRLIFKAWSQDSSKVYDAIVEAINSTAIHFNKSTEIKKAA |
| Ga0181346_10190723 | 3300017780 | Freshwater Lake | KAWSQDSSKVYDAILQAINSTAIQFNKSTEIKKAA |
| Ga0181348_12389852 | 3300017784 | Freshwater Lake | FKAWSQDSSKVYDAILQAINSTAIQFNKSTEIKKVA |
| Ga0181355_10334623 | 3300017785 | Freshwater Lake | VRGGTGKKTKGRLIFKAWSQDSSKVYDAIVEAINSTAIHFNKSTEIKKAA |
| Ga0181355_10490241 | 3300017785 | Freshwater Lake | KGIRAGGKKTKGRLIFKAWAQDSPKVYDAILQAINATAIQFNKSTEIKKAA |
| Ga0181355_10498561 | 3300017785 | Freshwater Lake | IFKAWAQDSQGVYDAILKAINSTAIQFNKSTEIKKAA |
| Ga0181359_10202691 | 3300019784 | Freshwater Lake | ERRGGTGKKTKGRLIFKAWSQDSSKVYDAIVEAINATAIQFNKSTEIKKAA |
| Ga0181359_11157761 | 3300019784 | Freshwater Lake | KTKGRLIFKAWAQDSPKVYDAILQAINATAIQFNKSTEIKKVA |
| Ga0207193_16220843 | 3300020048 | Freshwater Lake Sediment | KTKGRLIYKAFAKNSTDIYGAILKAIDATAVDFNKSYDKKAA |
| Ga0194112_103402991 | 3300020109 | Freshwater Lake | GGRKTKGRIIYKAWAEKSPAVYDAILKAITSTANYFNDSTELKKVA |
| Ga0194125_105688461 | 3300020222 | Freshwater Lake | SGGRKTKGRIIYKAWAEKSPAVYDAILKAITSTANYFNDSTELKKVA |
| Ga0208360_10502231 | 3300020551 | Freshwater | KGRLIYKAWSQDSLKVYEAILKAIDQSAVQFNKKTEIKSKKAA |
| Ga0194133_103044981 | 3300021091 | Freshwater Lake | GRKTKGRLIYKAWSQDSLQVYKAILKAIDNTAVQFNKNTKIKGKRAA |
| Ga0194048_101067292 | 3300021519 | Anoxic Zone Freshwater | LIYKAWAQDSDKVYKVILDAINATATKFNKSTQIKKAA |
| Ga0222713_105601412 | 3300021962 | Estuarine Water | PKIKDIRGGGRKTKGRLIYRAWAEDSPEIYKAVIRAVNVTAELFNKKTEIKKAA |
| Ga0222712_100686523 | 3300021963 | Estuarine Water | GRLIFKAWSQDSSKVYDAILQAINSTAIQFNKSTEIKKAA |
| Ga0181354_10549081 | 3300022190 | Freshwater Lake | KTKGRLIYKAWAQDSPKVYDAIIKAINATAIHFNKATEIKKAA |
| Ga0196905_10142223 | 3300022198 | Aqueous | YKAWAQDNIKVYDAILKAIDKTAVEFTRKTQIKKVA |
| Ga0181351_12565211 | 3300022407 | Freshwater Lake | KKTKGGLIFKAWSQDSSKVYDAILQAINSTAIQFNKSTEIKKAA |
| Ga0214921_101817201 | 3300023174 | Freshwater | KGRLIYKAWAEDSTKVYDAILKAINLTAIDFNKKTEIKKAA |
| Ga0214919_106002031 | 3300023184 | Freshwater | RSGGRKTKGRLIFKAWAQDSPKVYEAILKAIDDTTVDFTKMTYITKKKAA |
| Ga0208426_10178881 | 3300025451 | Aqueous | GGRKMQGRLIYKAWAQDSIKVYEAILKAIDGSTVEFKRRTTIKKAA |
| Ga0208147_10984911 | 3300025635 | Aqueous | RLIYKAWAQDSGKIYQSILGAINATAIKFNKSTDIKKAA |
| Ga0209651_10450491 | 3300027581 | Freshwater Lake | GVRSPGRKGKGRLIYKAWAQESPRVYYVIVKAINSTAINFNKSTEIKKAA |
| Ga0208974_11732002 | 3300027608 | Freshwater Lentic | RIKGVRGGYGKKTKGRLIFKAWSTDSIKVYEAIVQAINASAITFNKATEVKKAA |
| Ga0209356_11000972 | 3300027644 | Freshwater Lake | TKIKGVRGGTGKKTKGRLIFKAWSQDSSKIYDAILQAINSTAIQFNKSTEIKKAA |
| Ga0209356_11702092 | 3300027644 | Freshwater Lake | GGTGKKTKGRLIFKAWSQDSSKVYDAILQAINSTAIQFNKSTEIKKAA |
| Ga0208975_10577451 | 3300027659 | Freshwater Lentic | VRGGGRKTKGRLIYKAWAQDSGKVYEAMLGAINSTAIKFNKSTEIKKAA |
| Ga0209443_12514802 | 3300027707 | Freshwater Lake | GGASRKTKGRLIYKAWSQDSVKVYTAIVDAINSTATKFNKSTQVKKKVA |
| Ga0209442_10840191 | 3300027732 | Freshwater Lake | GGKKTKGRLIFKAWAQDSPKVYDAILQAINATAIQFNKSTEIKKAA |
| Ga0209442_12610021 | 3300027732 | Freshwater Lake | TKGRLIFKAWSQDSAKVYDAILQAINSTAIQFNKSTEIKKAA |
| Ga0209085_13548592 | 3300027741 | Freshwater Lake | YRAWAEDNGRIVPAVLKAINYTAIKFNKETEIKKAA |
| Ga0209444_102487752 | 3300027756 | Freshwater Lake | DMRGGGRKTKGRLIYRAWAEDSPEIYRAVIRAVNVTAELFNKKTEIKKAA |
| Ga0209296_12893731 | 3300027759 | Freshwater Lake | KGRLIYKAWAEDSTKVYDAILKAINATAIDFNKKTEIKKAA |
| Ga0209296_13190532 | 3300027759 | Freshwater Lake | IYRAWAEDSPKVYKAILDAVNATTDNFNNSTEIRGAA |
| Ga0209598_103366572 | 3300027760 | Freshwater Lake | KTKGRLIYKAWATDSPRVYDAILKAINATAIDFNKKTEIKKAA |
| Ga0209598_103570652 | 3300027760 | Freshwater Lake | GGRKTKGRLIYKAWAQDSGKVFQAIVDSVNASATDFNRMTEIKVKKVA |
| Ga0209134_102563052 | 3300027764 | Freshwater Lake | GVRGGTGKKTKGRLIFKAWSQDSSKVYDAIVEAINSTAIQFNKSTEIKKAA |
| Ga0209358_101872081 | 3300027804 | Freshwater Lake | IYKAFAQKSPSIYAAILQAIDATAVDFNKSYDKKAA |
| Ga0209354_100812931 | 3300027808 | Freshwater Lake | FKAWAQDSPKVYDAILQAINATAIQFNKSTEIKKAA |
| Ga0209253_108056251 | 3300027900 | Freshwater Lake Sediment | IRGGNRKTKGRLIYKAWAQDSLKIYEAILKAIDNSAVEFNRKTEIRSKKAA |
| Ga0209253_110857122 | 3300027900 | Freshwater Lake Sediment | LIYKAWAQDSIKVYEAILKAIDGSTVEFKRRTTLKKAA |
| Ga0209400_12982511 | 3300027963 | Freshwater Lake | SQPKTKGVRSGGVKTKGRLIYKAFSNQSPRIYQAILDAINDTAVDFNKSYDKKAA |
| Ga0247722_102637371 | 3300028027 | Deep Subsurface Sediment | YKAWAQDSMKVYEAIVKAINGTADNFNKTTQIKKAA |
| (restricted) Ga0247841_101561633 | 3300029286 | Freshwater | RKTKGRLIYKAWAQDSPKVYEAILKAINATAIQFNKSTEIKKAA |
| Ga0315907_102213851 | 3300031758 | Freshwater | KGRLIYKAWAQDSGKIYQSILGAINATAIKFNKSTDIKKAA |
| Ga0315909_101708163 | 3300031857 | Freshwater | GGGRKTKGRLIYKAWAQDSGDIYGVIVKAINATATHFNKTTDKKVA |
| Ga0315909_102238362 | 3300031857 | Freshwater | GRLIYKAWAQDSGKVYQAVLGAINSTAIKFNKSTEIKKAA |
| Ga0315904_102449191 | 3300031951 | Freshwater | IYKAWAQDSIKVYEAILKAIDGSTVEFKRRTTIKKAA |
| Ga0315904_105042131 | 3300031951 | Freshwater | SQPKFEGVRAGNRKTKGRLVYKAWAEDSPRIYQAIKDAINATATHFNKTTQQRVA |
| Ga0315904_105952042 | 3300031951 | Freshwater | GGRKTKGRLIYKAWAQDSGKVYDAILGAINATAVHFNKSTQVKRAA |
| Ga0315901_104706411 | 3300031963 | Freshwater | VRGGGRKSKGRLIYKAWAQDSGKIYQSILGAINATAIKFNKSTDIKKAA |
| Ga0315272_103550741 | 3300032018 | Sediment | GQVGGSSRKTKGRLIYKAWAQDNVKVYTAMIDAINATAIKFNKSTEIKKKVA |
| Ga0315903_102191421 | 3300032116 | Freshwater | KGRLIYKAWAQDSGKVYQAVLGAINSTAIKFNKSTEIKKAA |
| Ga0334722_108879751 | 3300033233 | Sediment | KGQVGGASRKTKGRLIYKAWAQDNVKVYTAMIDAINATAIKFNKSTEIKKKVA |
| Ga0334992_0411065_442_603 | 3300033992 | Freshwater | KIKGVRSGGTKTKGRLIYKAFANRSPKIYQAILNAINATTVDFNKATEIKKAA |
| Ga0334995_0402520_746_856 | 3300034062 | Freshwater | FKAWAQDSQEVYDAILKAINSTAIQFNKATEIKKAA |
| Ga0334995_0454477_27_155 | 3300034062 | Freshwater | MQGRLIYKAWAQDNTKVYEAILKAIDKTAVEFTRKTEIKKVA |
| Ga0334995_0461366_2_118 | 3300034062 | Freshwater | LIFKAWAQDSPKVYDAILQAINATAIQFNKSTEIKKAA |
| Ga0335031_0252012_1027_1170 | 3300034104 | Freshwater | GRKTKGRLIYKAWSQDSLKVYEAILKAIDNSAVEFNKKTEIKSKKAA |
| Ga0335031_0303846_897_1037 | 3300034104 | Freshwater | GGRKTKGRLIYRAWAEDSPEIYKAVIRAVNVTAELFNKKTEIKKAA |
| Ga0335036_0101439_1_135 | 3300034106 | Freshwater | GVKTKGRLIYKAFANQSPQIYQAILNAINATAVDFNKSYDKKAA |
| Ga0335051_0563403_413_523 | 3300034109 | Freshwater | YKAWAQDSGKVYQAVLGAINSTAIKFNKSTEIKKAA |
| Ga0335053_0300285_396_545 | 3300034118 | Freshwater | VRGGGRKTKGRLIYKAWAQDSGKVYQAVLGAINSTAIKFNKSTEIKKAA |
| Ga0335065_0604350_495_638 | 3300034200 | Freshwater | GGGRKTKGRLIYKAWAQDSGKVYQAVLGAINSTAIKFNKSTEIKKAA |
| Ga0334997_0350927_3_110 | 3300034280 | Freshwater | KAWAQDSGKVYQAVLGAINSTAIKFNKSTEIKKAA |
| ⦗Top⦘ |