| Basic Information | |
|---|---|
| Family ID | F079780 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 47 residues |
| Representative Sequence | AVQALEKRTAELKQKEAQIAVLESRLEALELRQNQSMQITAAK |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 22.73 % |
| % of genes near scaffold ends (potentially truncated) | 80.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.43 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (29.565 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.739 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 2.61 |
| PF04392 | ABC_sub_bind | 1.74 |
| PF01041 | DegT_DnrJ_EryC1 | 1.74 |
| PF12728 | HTH_17 | 1.74 |
| PF14534 | DUF4440 | 1.74 |
| PF00291 | PALP | 1.74 |
| PF13495 | Phage_int_SAM_4 | 0.87 |
| PF01527 | HTH_Tnp_1 | 0.87 |
| PF01797 | Y1_Tnp | 0.87 |
| PF09865 | DUF2092 | 0.87 |
| PF05876 | GpA_ATPase | 0.87 |
| PF13683 | rve_3 | 0.87 |
| PF12681 | Glyoxalase_2 | 0.87 |
| PF13229 | Beta_helix | 0.87 |
| PF00589 | Phage_integrase | 0.87 |
| PF11154 | DUF2934 | 0.87 |
| PF04972 | BON | 0.87 |
| PF04075 | F420H2_quin_red | 0.87 |
| PF04138 | GtrA | 0.87 |
| PF13489 | Methyltransf_23 | 0.87 |
| PF00072 | Response_reg | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.74 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.74 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.74 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.74 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.74 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.74 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.87 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.00 % |
| All Organisms | root | All Organisms | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02HFM5D | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 513 | Open in IMG/M |
| 3300004480|Ga0062592_100973882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300005093|Ga0062594_102122371 | Not Available | 605 | Open in IMG/M |
| 3300005294|Ga0065705_10130154 | Not Available | 2492 | Open in IMG/M |
| 3300005294|Ga0065705_10672203 | Not Available | 666 | Open in IMG/M |
| 3300005332|Ga0066388_100298293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2256 | Open in IMG/M |
| 3300005332|Ga0066388_102067486 | Not Available | 1023 | Open in IMG/M |
| 3300005332|Ga0066388_104583879 | Not Available | 703 | Open in IMG/M |
| 3300005332|Ga0066388_107045910 | Not Available | 565 | Open in IMG/M |
| 3300005546|Ga0070696_100797322 | Not Available | 777 | Open in IMG/M |
| 3300005713|Ga0066905_100418924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
| 3300005713|Ga0066905_102144359 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005718|Ga0068866_10363877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 923 | Open in IMG/M |
| 3300005764|Ga0066903_102810379 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005764|Ga0066903_108636590 | Not Available | 518 | Open in IMG/M |
| 3300005937|Ga0081455_10187705 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300006806|Ga0079220_10039637 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Amesbacteria → Candidatus Amesbacteria bacterium GW2011_GWB1_48_13 | 2152 | Open in IMG/M |
| 3300006844|Ga0075428_101118516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 832 | Open in IMG/M |
| 3300006844|Ga0075428_101371255 | Not Available | 742 | Open in IMG/M |
| 3300006844|Ga0075428_101411653 | Not Available | 731 | Open in IMG/M |
| 3300006852|Ga0075433_10481139 | Not Available | 1094 | Open in IMG/M |
| 3300006871|Ga0075434_101758140 | Not Available | 627 | Open in IMG/M |
| 3300006881|Ga0068865_102159163 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009100|Ga0075418_13079115 | Not Available | 508 | Open in IMG/M |
| 3300009147|Ga0114129_11948185 | Not Available | 711 | Open in IMG/M |
| 3300009162|Ga0075423_10405897 | Not Available | 1430 | Open in IMG/M |
| 3300009162|Ga0075423_11615859 | Not Available | 697 | Open in IMG/M |
| 3300009553|Ga0105249_12097705 | Not Available | 638 | Open in IMG/M |
| 3300009792|Ga0126374_10918020 | Not Available | 680 | Open in IMG/M |
| 3300010043|Ga0126380_10611718 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300010043|Ga0126380_11020621 | Not Available | 698 | Open in IMG/M |
| 3300010046|Ga0126384_10605313 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300010046|Ga0126384_11306131 | Not Available | 673 | Open in IMG/M |
| 3300010047|Ga0126382_10370929 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira japonica | 1105 | Open in IMG/M |
| 3300010358|Ga0126370_10106416 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300010358|Ga0126370_10196915 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300010358|Ga0126370_10477430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1047 | Open in IMG/M |
| 3300010359|Ga0126376_10193201 | Not Available | 1679 | Open in IMG/M |
| 3300010361|Ga0126378_11359087 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010361|Ga0126378_11534870 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300010362|Ga0126377_11781479 | Not Available | 691 | Open in IMG/M |
| 3300010362|Ga0126377_11960910 | Not Available | 661 | Open in IMG/M |
| 3300010362|Ga0126377_12588060 | Not Available | 583 | Open in IMG/M |
| 3300010362|Ga0126377_13487920 | Not Available | 508 | Open in IMG/M |
| 3300010366|Ga0126379_12700797 | Not Available | 593 | Open in IMG/M |
| 3300010376|Ga0126381_101628057 | Not Available | 933 | Open in IMG/M |
| 3300010376|Ga0126381_103428620 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300010376|Ga0126381_104267178 | Not Available | 554 | Open in IMG/M |
| 3300010376|Ga0126381_104402488 | Not Available | 545 | Open in IMG/M |
| 3300010398|Ga0126383_12739912 | Not Available | 575 | Open in IMG/M |
| 3300010400|Ga0134122_10982513 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 825 | Open in IMG/M |
| 3300012511|Ga0157332_1055116 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012885|Ga0157287_1114358 | Not Available | 517 | Open in IMG/M |
| 3300012929|Ga0137404_10348333 | Not Available | 1296 | Open in IMG/M |
| 3300012948|Ga0126375_10054532 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
| 3300012948|Ga0126375_10823776 | Not Available | 737 | Open in IMG/M |
| 3300012948|Ga0126375_10856098 | Not Available | 726 | Open in IMG/M |
| 3300012948|Ga0126375_11000845 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012957|Ga0164303_10246200 | Not Available | 1021 | Open in IMG/M |
| 3300012971|Ga0126369_10549535 | Not Available | 1219 | Open in IMG/M |
| 3300012971|Ga0126369_12441704 | Not Available | 608 | Open in IMG/M |
| 3300012984|Ga0164309_11403456 | Not Available | 595 | Open in IMG/M |
| 3300012988|Ga0164306_10630136 | Not Available | 844 | Open in IMG/M |
| 3300012988|Ga0164306_11382868 | Not Available | 598 | Open in IMG/M |
| 3300012989|Ga0164305_11252609 | Not Available | 646 | Open in IMG/M |
| 3300014969|Ga0157376_12263334 | Not Available | 582 | Open in IMG/M |
| 3300015371|Ga0132258_11649742 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300015372|Ga0132256_100962324 | Not Available | 969 | Open in IMG/M |
| 3300015372|Ga0132256_101239317 | Not Available | 859 | Open in IMG/M |
| 3300015372|Ga0132256_102660638 | Not Available | 600 | Open in IMG/M |
| 3300015372|Ga0132256_102896485 | Not Available | 577 | Open in IMG/M |
| 3300015373|Ga0132257_103565804 | Not Available | 566 | Open in IMG/M |
| 3300015374|Ga0132255_102048058 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300015374|Ga0132255_103421011 | Not Available | 676 | Open in IMG/M |
| 3300016270|Ga0182036_10890337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300016341|Ga0182035_10604863 | Not Available | 948 | Open in IMG/M |
| 3300016341|Ga0182035_11421074 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300016357|Ga0182032_11037044 | Not Available | 702 | Open in IMG/M |
| 3300016387|Ga0182040_11166209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300016404|Ga0182037_10916852 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300016404|Ga0182037_11405898 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 617 | Open in IMG/M |
| 3300016422|Ga0182039_10433006 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300016445|Ga0182038_10552205 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300017792|Ga0163161_10303272 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300021344|Ga0193719_10239445 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021560|Ga0126371_10265230 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300021560|Ga0126371_10537380 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300021560|Ga0126371_10859601 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300025923|Ga0207681_10414232 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300025930|Ga0207701_10053793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3694 | Open in IMG/M |
| 3300025930|Ga0207701_10480500 | Not Available | 1065 | Open in IMG/M |
| 3300025938|Ga0207704_11815739 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300025940|Ga0207691_11402051 | Not Available | 574 | Open in IMG/M |
| 3300025972|Ga0207668_11630698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae | 582 | Open in IMG/M |
| 3300027787|Ga0209074_10056776 | Not Available | 1215 | Open in IMG/M |
| 3300027876|Ga0209974_10118627 | Not Available | 936 | Open in IMG/M |
| 3300027907|Ga0207428_10688387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300031547|Ga0310887_10279817 | Not Available | 943 | Open in IMG/M |
| 3300031573|Ga0310915_10500852 | Not Available | 863 | Open in IMG/M |
| 3300031720|Ga0307469_10312487 | Not Available | 1300 | Open in IMG/M |
| 3300031740|Ga0307468_100154365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1480 | Open in IMG/M |
| 3300031740|Ga0307468_101780783 | Not Available | 582 | Open in IMG/M |
| 3300031890|Ga0306925_11445828 | Not Available | 676 | Open in IMG/M |
| 3300031910|Ga0306923_10688726 | Not Available | 1139 | Open in IMG/M |
| 3300032035|Ga0310911_10798054 | Not Available | 546 | Open in IMG/M |
| 3300032076|Ga0306924_10221192 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300032180|Ga0307471_100583450 | Not Available | 1275 | Open in IMG/M |
| 3300032211|Ga0310896_10820762 | Not Available | 534 | Open in IMG/M |
| 3300032261|Ga0306920_103278387 | Not Available | 604 | Open in IMG/M |
| 3300033289|Ga0310914_11174159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 29.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_07405550 | 2170459010 | Grass Soil | EKRTAELKQKEAQIAELAARLEALELQKNSSIQITAEKTVSVQ |
| Ga0062592_1009738822 | 3300004480 | Soil | GDIAGILMIAVQALEKRTAELKQTKEQLAELAARLEALELRQKQPVQTAEQRAY* |
| Ga0062594_1021223711 | 3300005093 | Soil | GILMIAVQALEKRTAELKQKEAKIAVLESRLEALELRQNQSMQITAAK* |
| Ga0065705_101301541 | 3300005294 | Switchgrass Rhizosphere | VQALEKRTAELRQKEAQIAALAARLEALELRQNQSIQTTATKY* |
| Ga0065705_106722032 | 3300005294 | Switchgrass Rhizosphere | ALEKRTAELKEKEAQIAELAARLEALEQYQSIEIAAKQR* |
| Ga0066388_1002982931 | 3300005332 | Tropical Forest Soil | MIAVRALEKRTVELKHKEAQIADLVARLEALESQQNQSTQITAAK* |
| Ga0066388_1020674863 | 3300005332 | Tropical Forest Soil | VQALEKRTAELKQKEAQIAVLESRLEALELRANQSIQITAKEPLVF |
| Ga0066388_1045838791 | 3300005332 | Tropical Forest Soil | MIAVQALEKRTADLKQKDAQIAVLAARLEALELRQNQSIQITAKEPSVFVAR* |
| Ga0066388_1070459101 | 3300005332 | Tropical Forest Soil | IAVQALEKRTAELKQKEAQIAVLESRLEALELRNSRSFQITAEEPWVFTVK* |
| Ga0070696_1007973223 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAVQALEKRTRELKRKEARIAVLESRLEALELRNKQRIK* |
| Ga0066905_1004189241 | 3300005713 | Tropical Forest Soil | MIAVQALEKRTAELKQKEAQLAVLESRLAALELRTNRSIQITAEEPRGCLR* |
| Ga0066905_1005292073 | 3300005713 | Tropical Forest Soil | VQALEKRTAELKHTKAQLAAMAERLEALELRNSRSIQITAEKSVSKQ* |
| Ga0066905_1021443592 | 3300005713 | Tropical Forest Soil | MIAVQALEKRTAELKQKEARIAVLESRLEALEVLQKKHPIQITTGKSLSDR* |
| Ga0068866_103638771 | 3300005718 | Miscanthus Rhizosphere | MIAVQALEKRTAELKQKEAKIAVLESRLEALELRQNQSMQITAAK* |
| Ga0066903_1028103794 | 3300005764 | Tropical Forest Soil | LKQKEAQIAALESRLEMLELRQRRSIQNAAEKSFSDK* |
| Ga0066903_1028776281 | 3300005764 | Tropical Forest Soil | VQISVLESELKRKDTQIAALVARLDALELRQNQSVQIAAEK* |
| Ga0066903_1086365902 | 3300005764 | Tropical Forest Soil | QALEKRTVELKQKEAQIADLVARLEALESQQNQSTQITAAK* |
| Ga0081455_101877051 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIAVQALEKRTAELKQKEAQIAVLESRLEALELRQNPSVQVKADDPWMFMAR* |
| Ga0079220_100396372 | 3300006806 | Agricultural Soil | SGDIAGILMIAVQALENRTEELKQRKEELAELATRLEALELRQQRPVQLTAEQRAY* |
| Ga0075428_1011185163 | 3300006844 | Populus Rhizosphere | LKQKQAQIAVLESRLEALELRQNHSIQITAEDPWVFVAR* |
| Ga0075428_1013712552 | 3300006844 | Populus Rhizosphere | GILMIAVQALEKRTAELKQKEAKIAVLESRLEALELRQNQSIQITAAK* |
| Ga0075428_1014116532 | 3300006844 | Populus Rhizosphere | LEKRTAELKQKEAKIAVLESRLEALELRQNQSMQITAAK* |
| Ga0075433_104811393 | 3300006852 | Populus Rhizosphere | AVQALEKRTAELRQKEAQIAALAARLEALELRQNQSIQTTATKY* |
| Ga0075434_1017581402 | 3300006871 | Populus Rhizosphere | AGILIIAVQALEKRTAELKQKEAQIAELAARLEALESQQKQAIQITADQRAY* |
| Ga0068865_1021591631 | 3300006881 | Miscanthus Rhizosphere | AVQALEKRTAELKQKEARIAVLESRLEALELRQNQSMQITAAK* |
| Ga0075418_130791151 | 3300009100 | Populus Rhizosphere | GILMIAVQALEKRTAELKRKEARIAVLESRLEALELRNKQRIR* |
| Ga0114129_119481852 | 3300009147 | Populus Rhizosphere | MIAAQALEKRTAELKRTKAQLAAMAERLEALELRQNPSIQIAAEKSVSMQ* |
| Ga0075423_104058973 | 3300009162 | Populus Rhizosphere | VQALEKRTAELKQKEAKIAVLESRLEALELRQNQSMQITAAK* |
| Ga0075423_116158592 | 3300009162 | Populus Rhizosphere | LEKRTAELKQKEAQIAELAARLEALESQQKQAIQITADQRAY* |
| Ga0105249_120977051 | 3300009553 | Switchgrass Rhizosphere | RTAELKQKEARIAVLESRLEALELRQNQSMQITAAK* |
| Ga0126374_109180202 | 3300009792 | Tropical Forest Soil | EKRTAELKQKDAQIAALAARLEAVELRQNQSIVLTAEQR* |
| Ga0126380_106117181 | 3300010043 | Tropical Forest Soil | VQALEKRTAELKQKEARIAVLESRLEALELRRNPSSQITAEKRFGDK* |
| Ga0126380_110206211 | 3300010043 | Tropical Forest Soil | MAGILMIAVRALEKRTVELKHKEAQIADLVARLEALESQQNQSTQITAAK* |
| Ga0126384_100144205 | 3300010046 | Tropical Forest Soil | MIAVQALEKRTAELKHTKAQLAAMAARLEALELRTNRSIQIAAEEPWVFAVK* |
| Ga0126384_106053133 | 3300010046 | Tropical Forest Soil | LMIAVQALEKRTAELKQKEAQIAALESRLEMLELRQRRSIQNAAEKSFSDK* |
| Ga0126384_113061312 | 3300010046 | Tropical Forest Soil | MAGILMIAVQALEKRTAELNQKEARIAVLESRLEALELRNNPFYPTNSG* |
| Ga0126382_103709291 | 3300010047 | Tropical Forest Soil | MAGILMIAVQALEKRTVELKQKEAQIADLVARLEALESQQNQSTQITAAK* |
| Ga0126382_114248323 | 3300010047 | Tropical Forest Soil | EKRTVQISVLESELKQKEAQIAALAARLEALELRTNPPIQVAAEKSVSMR* |
| Ga0126373_114011361 | 3300010048 | Tropical Forest Soil | KRTVQISALESELKQKDAQIAALAARLEALELRQNQSVQITAK* |
| Ga0126370_101064163 | 3300010358 | Tropical Forest Soil | MIAVQALEKRTAELKHAKAQLAAMVERLEALELRNNHSIQIAADVIP* |
| Ga0126370_101969151 | 3300010358 | Tropical Forest Soil | MIAVQVLEKRTAELKHTKAQLAAMAERPQALELRNYHSVQI |
| Ga0126370_104774302 | 3300010358 | Tropical Forest Soil | DIAGILMIAVQALEKRTAELKQTKAQLAELAARLESLELRQNQPIQITAEQRGY* |
| Ga0126376_101932011 | 3300010359 | Tropical Forest Soil | MIAVQALEKRTAELKHTKAQIAVLESRLEALELRTNRSIQIAAEEP |
| Ga0126378_113590873 | 3300010361 | Tropical Forest Soil | MAGILMVAVQALEKRTVQISAQQLELKQRDAQLAALAARLEAVELRQKQPIQITAKQGGY |
| Ga0126378_115348701 | 3300010361 | Tropical Forest Soil | MIAVQALEKRTAELRQKEARIAVLESRLEALELQKNRPIQITADRNVGDR* |
| Ga0126377_117814791 | 3300010362 | Tropical Forest Soil | LMIAVQALEKRTAELKQKEAQIAALATRLKALELRQNLAIQIAAEKSVSMQ* |
| Ga0126377_119609101 | 3300010362 | Tropical Forest Soil | MAGILMIAVQALEKRTVELKQKEAQIADLVARLEASESQQNQ |
| Ga0126377_125880602 | 3300010362 | Tropical Forest Soil | SGDMSGILMIAVQALEKRTAELKEKDAQIATLAARLEALELRQDHAILLTAEKSLIP* |
| Ga0126377_134879202 | 3300010362 | Tropical Forest Soil | VQALENRTAELKQTKAQLAGLAARLEALELRQNHSIQIAVEKGPEFLVQ* |
| Ga0126379_127007971 | 3300010366 | Tropical Forest Soil | RSALKPRLTPGDIAGILMIAVQALEKRTAELQQTKAQLTALESQVEELKVRRSQPIQITAEQRGY* |
| Ga0126381_1016280571 | 3300010376 | Tropical Forest Soil | RTAELKEKEAQLAALAARLEALELRQNQSTQIAAEK* |
| Ga0126381_1034286202 | 3300010376 | Tropical Forest Soil | MIAVQALEKRTRELTQKDAQIAQLAARLEALELRQNQYIQP |
| Ga0126381_1042671781 | 3300010376 | Tropical Forest Soil | DIAGILMIAVQALEKRTAELKEKEAQLAALAARLEALELRQNQPIQITAEQRGY* |
| Ga0126381_1044024882 | 3300010376 | Tropical Forest Soil | DMAGILMIAVQALEKRTAELKEKEARIAALAARLEALESRQNQSIQLTAEQQGY* |
| Ga0126383_127399121 | 3300010398 | Tropical Forest Soil | MAGLLIIAVQALEKRTAELKQKEAQLAALAARLRQNQSIQTTATKY* |
| Ga0134122_109825132 | 3300010400 | Terrestrial Soil | MIAVQALEKRTAEIKQKEAQIAVLESRLEALELRQNQPIQMTAEQRGY* |
| Ga0157332_10551161 | 3300012511 | Soil | VQALEKRTAELKQKEAQIAVLESRLEALELRQHQSMQITGAK* |
| Ga0157287_11143581 | 3300012885 | Soil | GILMIAVQALEKRTVELKQKEAQIAVLASRLEALELRQNQSMQITAVK* |
| Ga0137404_103483333 | 3300012929 | Vadose Zone Soil | QALEKRTAELKQKEARIAVLESRLEALELRNNHSFQIAAEKNNSFVTSGE* |
| Ga0126375_100545325 | 3300012948 | Tropical Forest Soil | MIAVQALEKRTAELKHTMAQLAAMAERLQALELQNNHSIQLTAAE |
| Ga0126375_108237762 | 3300012948 | Tropical Forest Soil | MTIAGQVLEKRTAELKHTKAQLAAMAERLQALELRNNHCGQIA |
| Ga0126375_108560983 | 3300012948 | Tropical Forest Soil | QALEKRTAELKEKEARIAVLESRLEALELRTNPPIQVAAENPWMSVAR* |
| Ga0126375_110008451 | 3300012948 | Tropical Forest Soil | VQVLEKRTAELKHTKAQLAAMAERLQALELRNNHCGQIA |
| Ga0164303_102462001 | 3300012957 | Soil | MAGILMIAVQALEKRTAELKQKEAQIAELAARLEALESQQKQAIQITADQRAY* |
| Ga0126369_105495354 | 3300012971 | Tropical Forest Soil | DIAGILMIAVQALEQRTAELKQKDEQIAALAARLEALESRQNQPIQLTAEQRGY* |
| Ga0126369_124417041 | 3300012971 | Tropical Forest Soil | EKRTAELKGTKAELAVLAARLEALELRQNQPIQLTAEQRGY* |
| Ga0164309_114034561 | 3300012984 | Soil | VQALEKRTAELKQKEARIAVLESRLEALELRQNQSMQITAAK* |
| Ga0164306_106301361 | 3300012988 | Soil | EKRTAELKEKEAQIAELAARLEALEQYQSIEIAAKQC* |
| Ga0164306_113828681 | 3300012988 | Soil | SGDLAGILMVAVQALEKRTAELRQKEAQIAALAARLEALELRQNQSIQTTATKY* |
| Ga0164305_112526092 | 3300012989 | Soil | GILMIAVQALEKRTGQIYSLQSELKQKEAQIAELAAHLEVLEARQNQPIQITAEQRVY* |
| Ga0157376_122633342 | 3300014969 | Miscanthus Rhizosphere | ALEKRTAELKQKEARIAVLESRLEALELRQNQSVQITAAK* |
| Ga0132258_116497422 | 3300015371 | Arabidopsis Rhizosphere | GILMIAVQALEKRTAELKQKEAKIAVLESRLEALELRQNQSMQITAAKYWR* |
| Ga0132256_1009623241 | 3300015372 | Arabidopsis Rhizosphere | IAVQALEKRTAELKQKEAKIAVLESRLEALELRQNQSMQITAAK* |
| Ga0132256_1012393171 | 3300015372 | Arabidopsis Rhizosphere | QALEKRTAELKQKEAKIAVLESRLEALEVRQNQSMQITAAK* |
| Ga0132256_1026606381 | 3300015372 | Arabidopsis Rhizosphere | IAGVLMVAVQALEKRTVELKQTKAELAALAARLEALELRQKPIQLTADQRAD* |
| Ga0132256_1028964851 | 3300015372 | Arabidopsis Rhizosphere | EKRTAELKQKEAKIAVLESRLEALELRQNQSMQITAAK* |
| Ga0132257_1035658041 | 3300015373 | Arabidopsis Rhizosphere | EKRTAELKQKEAQIAELAARLEALESQQKQAIQITADQRAY* |
| Ga0132255_1020480583 | 3300015374 | Arabidopsis Rhizosphere | MVAVQALEKRTAELKQKEARIAVLESRLEALELRQNQSMQITAAK* |
| Ga0132255_1034210111 | 3300015374 | Arabidopsis Rhizosphere | LEKRTAELKQTKAELAALAARLEALELRQNQSMQITAAR* |
| Ga0182036_108903371 | 3300016270 | Soil | MIAVQALEKRTAELKETKAQIAELAARLEKLESRQKQSIQITAEQRG |
| Ga0182035_106048632 | 3300016341 | Soil | LEKRTAELKQKESQVAELAARLEALESRQKQSIQITAEQRSY |
| Ga0182035_114210741 | 3300016341 | Soil | EKRTTELKQKEARIAVLESRLEALELQKNRSVQITAENK |
| Ga0182032_110370441 | 3300016357 | Soil | AVQALEKRTAELKQKKAQIAAMAVQLEALELRITPIQITAGKTLSFVATGE |
| Ga0182040_111662092 | 3300016387 | Soil | MIAVQALEKQNREKDAQIAALAARLEALELRQNQPMQITAEQRGY |
| Ga0182037_109168521 | 3300016404 | Soil | KRTAELKQTKAQLAELAARLETLELRQKQSMQITAEQRGY |
| Ga0182037_114058981 | 3300016404 | Soil | MIAVQALEKRTAELKQTKAQLAELAARLEALELRQNQPMQITAEQRGY |
| Ga0182039_104330061 | 3300016422 | Soil | MIAVQALGKRTAELKQTKAELAALAARLEALELRQNQPMQITAEQRGY |
| Ga0182038_105522051 | 3300016445 | Soil | NSGDIAGILMIAVQALGKRTAELKQTKAELAALAARLEALELRQNQPMQITAEQRGY |
| Ga0163161_103032722 | 3300017792 | Switchgrass Rhizosphere | MIAVQALEKRTAELKQKEARIAVLESRLEALELRQNQSMQITAAK |
| Ga0193719_102394451 | 3300021344 | Soil | AVQALEKRTAELKQKEAQIAVLESRLEALELRQNQSMQITAAK |
| Ga0126371_102652303 | 3300021560 | Tropical Forest Soil | MAGILMIAVQALEKRTAELEQTKAELAALAARLDALESQQKRSIQITAEQRTY |
| Ga0126371_105373803 | 3300021560 | Tropical Forest Soil | VQALEKRTAELKEKEAQIAALAARLEALELRQNQPMQLTAEQRGY |
| Ga0126371_108596012 | 3300021560 | Tropical Forest Soil | AGILMIAVQALEKRTAELKQKEERIAVLESRLEALELRNNHSIQLTAAESLWQK |
| Ga0207681_104142322 | 3300025923 | Switchgrass Rhizosphere | KRTAELKQKEARIAVLESRLEALELRQNQSMQITAAK |
| Ga0207701_100537931 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AGILMVAVQALEKRTAELRQKEAQIAALAARLEALELRQNQSIQTTATKY |
| Ga0207701_104805001 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RTAELKQREARIAVLESRLEALELRQNQSMQITAAK |
| Ga0207704_118157391 | 3300025938 | Miscanthus Rhizosphere | RTAELKQKEARIAVLESRLEALELRQNQSMQITAAK |
| Ga0207691_114020512 | 3300025940 | Miscanthus Rhizosphere | TVELKQKEAQIAVLASRLEALELRQNQSMQITAAK |
| Ga0207668_116306981 | 3300025972 | Switchgrass Rhizosphere | TINSADLAGIIMVAVQALEKRTAELRQREARIAILESRLEALELRQNQSMQITAAK |
| Ga0209074_100567762 | 3300027787 | Agricultural Soil | INSGDIAGILMIAVQALEKRTAELKQTKEELAELATRLEALELRQKQAVQTAEQGAY |
| Ga0209974_101186271 | 3300027876 | Arabidopsis Thaliana Rhizosphere | GILMTAVQALEKRTEELKETKAELAALTARLEALELRQKPIQLTADPRAD |
| Ga0207428_106883871 | 3300027907 | Populus Rhizosphere | GDIAGILMIAVQALEKRTAELKQKEAQIAELAAQLEVLELRHNQNIQLTAE |
| Ga0310887_102798172 | 3300031547 | Soil | AVQALEKRTAELKQKEAKIAVLESRLEALELRQNQSMQITAAK |
| Ga0310915_105008521 | 3300031573 | Soil | AGILMIAVQALEKRTAELKQKESQVAELAARLEALESRQKQSIQITAEQRSY |
| Ga0307469_103124872 | 3300031720 | Hardwood Forest Soil | MRGPDKTQALEKRTAELKQKEARIADLESRLDALELRNNHSFQITAEKSVSMQ |
| Ga0307468_1001543651 | 3300031740 | Hardwood Forest Soil | GILMIAVQALEKRTAELKQKEAQMAALESRLEALELRQNHPMQITAGKNLSSVTTGE |
| Ga0307468_1017807832 | 3300031740 | Hardwood Forest Soil | AGILMIAVQALEKRTAELKHKEAQIAALAARLEALELRQNQSIQIAAEDPWVFVAR |
| Ga0306925_114458282 | 3300031890 | Soil | ALQLELKQKDAQLAALAARLEALELHQNQPIQMTAEQRGY |
| Ga0306923_106887261 | 3300031910 | Soil | QALEKRTVQISALQLELKQKDAQLAALAARLEALELHQNQPIQMTAEQRGY |
| Ga0310911_107980541 | 3300032035 | Soil | VQALEKRTVQISALQLELKQKDAQLAALAARLEALELHQNQPIQMTAEQRGY |
| Ga0306924_102211921 | 3300032076 | Soil | AVQALEKRTAQVSVLESELKQKEAQIAMLAARLDALELRQNQSIQVTAEQRAY |
| Ga0307471_1005834504 | 3300032180 | Hardwood Forest Soil | RRTAELKQKEARIADLESRLDALELRNNHSFQITAEKSVSMQ |
| Ga0310896_108207621 | 3300032211 | Soil | RTAELKQKEAQIAVLASRLEALELRQNQSMQITAAK |
| Ga0306920_1032783872 | 3300032261 | Soil | ELKQKDAQLAALAARLEALELRQNQPIQITAEQRGY |
| Ga0310914_111741591 | 3300033289 | Soil | IAVQALEQRTAELKQKDAQIAALAARLEALELPQNQVVQITAENK |
| ⦗Top⦘ |