Basic Information | |
---|---|
Family ID | F079766 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 45 residues |
Representative Sequence | VGHDSVANLRATLRLPSLDAVFASLVAEERVEERTLGLLAAMRA |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.87 % |
% of genes near scaffold ends (potentially truncated) | 98.26 % |
% of genes from short scaffolds (< 2000 bps) | 94.78 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.522 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.913 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.565 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.652 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF12704 | MacB_PCD | 2.61 |
PF07726 | AAA_3 | 0.87 |
PF05239 | PRC | 0.87 |
PF03551 | PadR | 0.87 |
PF13360 | PQQ_2 | 0.87 |
PF05163 | DinB | 0.87 |
PF00005 | ABC_tran | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.87 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.87 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.87 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.52 % |
Unclassified | root | N/A | 3.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002560|JGI25383J37093_10036539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
3300004157|Ga0062590_100108624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1781 | Open in IMG/M |
3300004480|Ga0062592_102291618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300004643|Ga0062591_100252074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
3300005093|Ga0062594_101255180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 739 | Open in IMG/M |
3300005171|Ga0066677_10062511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1893 | Open in IMG/M |
3300005174|Ga0066680_10336870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
3300005179|Ga0066684_10878252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300005289|Ga0065704_10558514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300005294|Ga0065705_10702987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300005294|Ga0065705_10837043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300005337|Ga0070682_101250963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300005343|Ga0070687_100450715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300005353|Ga0070669_101505181 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300005353|Ga0070669_101962257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300005356|Ga0070674_101544444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300005440|Ga0070705_100148028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
3300005440|Ga0070705_100351358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1075 | Open in IMG/M |
3300005466|Ga0070685_11461136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300005552|Ga0066701_10591350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300005561|Ga0066699_10404757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
3300005561|Ga0066699_10761477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 685 | Open in IMG/M |
3300005842|Ga0068858_101978153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300005844|Ga0068862_102362291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300006046|Ga0066652_100815419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
3300006844|Ga0075428_100148742 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
3300006845|Ga0075421_100432873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
3300006880|Ga0075429_101932551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300006904|Ga0075424_101222060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
3300006904|Ga0075424_102473292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300006914|Ga0075436_100642872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300006914|Ga0075436_101270763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300007004|Ga0079218_12204370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300007076|Ga0075435_100162668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1881 | Open in IMG/M |
3300007076|Ga0075435_101576883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300007255|Ga0099791_10014633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3324 | Open in IMG/M |
3300009012|Ga0066710_104245834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300009038|Ga0099829_11006561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300009090|Ga0099827_11527373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300009098|Ga0105245_13029339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300009100|Ga0075418_10000050 | All Organisms → cellular organisms → Bacteria | 94120 | Open in IMG/M |
3300009101|Ga0105247_11113930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300009137|Ga0066709_100141858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3052 | Open in IMG/M |
3300009147|Ga0114129_10176388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2911 | Open in IMG/M |
3300009148|Ga0105243_12738331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300009162|Ga0075423_10885897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300009162|Ga0075423_11327474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300009162|Ga0075423_11779010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300009177|Ga0105248_12312334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300009545|Ga0105237_11064705 | Not Available | 816 | Open in IMG/M |
3300009814|Ga0105082_1100340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300010304|Ga0134088_10219554 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300010364|Ga0134066_10101063 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300010400|Ga0134122_13142591 | Not Available | 517 | Open in IMG/M |
3300010403|Ga0134123_12603835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300011269|Ga0137392_10372901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
3300011270|Ga0137391_10967764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300011400|Ga0137312_1013584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1067 | Open in IMG/M |
3300011412|Ga0137424_1050143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300011439|Ga0137432_1095826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
3300012022|Ga0120191_10137299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300012206|Ga0137380_11028014 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300012353|Ga0137367_10389446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
3300012359|Ga0137385_11124675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300012922|Ga0137394_10342729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
3300012922|Ga0137394_11497167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300012930|Ga0137407_11792330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300012944|Ga0137410_10212043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
3300013306|Ga0163162_11553083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300013308|Ga0157375_11127633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
3300014166|Ga0134079_10212049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300014325|Ga0163163_13212867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300015373|Ga0132257_100643625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
3300015373|Ga0132257_100923920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
3300015373|Ga0132257_102626379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300015373|Ga0132257_102703852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300018053|Ga0184626_10246812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
3300018056|Ga0184623_10487478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300018078|Ga0184612_10604262 | Not Available | 519 | Open in IMG/M |
3300018083|Ga0184628_10391892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300018429|Ga0190272_10938536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300018429|Ga0190272_11688502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
3300018431|Ga0066655_10541478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300018469|Ga0190270_10455531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1204 | Open in IMG/M |
3300018920|Ga0190273_11172693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300019377|Ga0190264_10725362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300022694|Ga0222623_10347436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300025914|Ga0207671_10949314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300025923|Ga0207681_11785714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300025960|Ga0207651_10470530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
3300026035|Ga0207703_12119122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300026118|Ga0207675_101180314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
3300026310|Ga0209239_1082219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1390 | Open in IMG/M |
3300026315|Ga0209686_1109279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
3300026328|Ga0209802_1280478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300026335|Ga0209804_1251189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300027655|Ga0209388_1123657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300027907|Ga0207428_10000039 | All Organisms → cellular organisms → Bacteria | 213218 | Open in IMG/M |
3300027907|Ga0207428_10709408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300028799|Ga0307284_10203826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
3300028803|Ga0307281_10253605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300031114|Ga0308187_10447786 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031198|Ga0307500_10293855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300031538|Ga0310888_10065642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1749 | Open in IMG/M |
3300031538|Ga0310888_11028995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300031547|Ga0310887_10710215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300031548|Ga0307408_100170344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1738 | Open in IMG/M |
3300031720|Ga0307469_12301165 | Not Available | 525 | Open in IMG/M |
3300031740|Ga0307468_100519467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
3300031847|Ga0310907_10855074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300031858|Ga0310892_11150877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300032075|Ga0310890_10623306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
3300032160|Ga0311301_11763978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300032179|Ga0310889_10630570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300032261|Ga0306920_101656796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.91% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.09% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.35% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.48% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.48% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.61% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.87% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.87% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.87% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.87% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25383J37093_100365391 | 3300002560 | Grasslands Soil | SVANLRATLQLPSLDAVFAALVVEENVDERSQGLVAAMKS* |
Ga0062590_1001086242 | 3300004157 | Soil | DGDVVGHDSVDNLRDTLRLPSLDAVFAALVSEECVDEKTGGLVAAMNG* |
Ga0062592_1022916181 | 3300004480 | Soil | VEHLRATLQLPSLDAVFALLVAEENVEERTRGLVAAMKQ* |
Ga0062591_1002520741 | 3300004643 | Soil | GHDSVEHLRSTLQLPSLDAVFAALVAEENVEEQTRDMISTMKA* |
Ga0062594_1012551802 | 3300005093 | Soil | ILKDGHIVGHDSVENLRATLQLPSLDAVFAALVMEESVEERTRDMIATMKLGARSSKLHA |
Ga0066677_100625111 | 3300005171 | Soil | KDGRIVGHDSVANLRATLRLPSLDAVFASLVAEERVEERTLGLLAAMRA* |
Ga0066680_103368701 | 3300005174 | Soil | RIVGHDSVARLRATLQLPTLDAVFASLVKEDDVDSRSRRLIEAMRA* |
Ga0066684_108782522 | 3300005179 | Soil | KDGRIVGHDSVANLRATLQLPSLDAVFASLVAEERVEERTLGLLAAMRA* |
Ga0065704_105585142 | 3300005289 | Switchgrass Rhizosphere | RVVILKDGHVVGHDSVERLRAMLQLPSLDAVFASLVQEDDSEARCRSMIAAMNA* |
Ga0065705_107029872 | 3300005294 | Switchgrass Rhizosphere | DSVENLRSTLKLPSLDAVFAALVTEDDVASRTRALVAAMKAS* |
Ga0065705_108370431 | 3300005294 | Switchgrass Rhizosphere | DSVASLRSTLQLPSLDAVFAALVAEENVEERTQGLVAAMKT* |
Ga0070682_1012509631 | 3300005337 | Corn Rhizosphere | GYDSVANLRDTLQLASLDAVFAALTAEEDVDDRRSGLIRAMKASGV* |
Ga0070687_1004507151 | 3300005343 | Switchgrass Rhizosphere | VILKDGRVVGHDSVERLRAMLQLPSLDAVFASLVQEDDSEARCRSMIAAMNA* |
Ga0070669_1015051812 | 3300005353 | Switchgrass Rhizosphere | GHDSVENLRSTLKLPSLDAVFAALVTEDDVVSRTRALIAAMKAS* |
Ga0070669_1019622571 | 3300005353 | Switchgrass Rhizosphere | SVAQLRSTLRLPSLDAVFAALVAEERVEERTGDMVNLMKSHG* |
Ga0070674_1015444441 | 3300005356 | Miscanthus Rhizosphere | ILKDGHIVGHDSVAHLRSTLQLPSLDAVFASLVSEENVEERSRGLIAAMKA* |
Ga0070705_1001480282 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | KDGRIVGHDSVANLRATLRLPSLDAVFASIVAEEHVEERTSGLVAAMKA* |
Ga0070705_1003513582 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VGHDSVENLRQTLKLPTLDAVFATLVEETNVEGRSRALVEAMHLQ* |
Ga0070685_114611362 | 3300005466 | Switchgrass Rhizosphere | DGAVVGHDSVGSLRETLRLPSLDAVFAALVSEERVDEKTGGLVAAMNV* |
Ga0066701_105913502 | 3300005552 | Soil | QLRSTLQLPSLDAVFASLVREENVTGRVRGLVEVMRS* |
Ga0066699_104047572 | 3300005561 | Soil | QLRSTLQLPSLDAVFASLVREENVTGCARGLVEVMGS* |
Ga0066699_107614771 | 3300005561 | Soil | KDGRIVGHDSVARLRATLQLPTLDAVFASLVKEDDVDSRSRRLIEAMRA* |
Ga0068858_1019781531 | 3300005842 | Switchgrass Rhizosphere | SVERLRAMLHLPSLDAVFASLVQEDDSEARCRSMIAAMNA* |
Ga0068862_1023622911 | 3300005844 | Switchgrass Rhizosphere | VILKDGHIVGLDSVEHLRATLQLPSLDAVFALLVAEENVEERTRGLVAAMKQ* |
Ga0066652_1008154192 | 3300006046 | Soil | DSVVNLRSTLQLPSLDAVFATLTAEEDVAERTREMVAAMKV* |
Ga0075428_1001487424 | 3300006844 | Populus Rhizosphere | CSRVVILKDGDVVGHDSVGNLRETLRLPSLDAVFAALVSEERVDEKTGGLVAAMNV* |
Ga0075421_1004328732 | 3300006845 | Populus Rhizosphere | NTLRLPSLDAVFAALTAEENVEDRRLELIRAMKA* |
Ga0075429_1019325511 | 3300006880 | Populus Rhizosphere | GHDYVERLRAMLQLPSLDAVFASLVEEDDSEARCRSMIAAMNA* |
Ga0075424_1012220601 | 3300006904 | Populus Rhizosphere | SVGNLRETLRLPSLDAVFAALVSEERVDEKTGGLVAAMHV* |
Ga0075424_1024732921 | 3300006904 | Populus Rhizosphere | RQVGHDSVANLRETLRLPSLDAVFAALVSEENVDARTNGLLEAMRA* |
Ga0075436_1006428722 | 3300006914 | Populus Rhizosphere | VCSKVIIVKDSRMVGGGSVARLRETLHLPSLDAVFAALVSESDVAERTRDLVTAMKA* |
Ga0075436_1012707632 | 3300006914 | Populus Rhizosphere | KDGVVVGHDSVSQLRSMLQLPSLDAVFASLVREENVTGRARGLVEAMQS* |
Ga0079218_122043701 | 3300007004 | Agricultural Soil | SVGHDSVDNLRNTLKLPSLDAVFATLVAEENVERRTTGLISAMHLQ* |
Ga0075435_1001626682 | 3300007076 | Populus Rhizosphere | NLRETLRLPSLDAVFAALVSEENVDARTNGLLEAMRA* |
Ga0075435_1015768832 | 3300007076 | Populus Rhizosphere | LKEGRVAGHDSVVNLRATLQLPSLDAVFAALTAEEDVDERSRAMVAAMKA* |
Ga0099791_100146331 | 3300007255 | Vadose Zone Soil | LKDGRIVGHDSVANLRATLQLPSLDAVFAALVVEENVDERSQGLVAAMKS* |
Ga0066710_1042458341 | 3300009012 | Grasslands Soil | KEGHVVGHDSVDQLRATLQLPSLDAVFAALVAEENVEERCRGLLAAMKA |
Ga0099829_110065612 | 3300009038 | Vadose Zone Soil | MWSFFEDGRIVGHDSIANRRSTFTLPSLDAVFLALASEENVDQQSRGLVAAMKT* |
Ga0099827_115273732 | 3300009090 | Vadose Zone Soil | SVAHLRSTLELPSLDAVFAALVVEDDVATYSQGLIAAMKA* |
Ga0105245_130293391 | 3300009098 | Miscanthus Rhizosphere | ILKDGRIVGHDSVANLRATLRLPSLDAVFASLVAEDHVEERTQGLLAAMRA* |
Ga0075418_100000501 | 3300009100 | Populus Rhizosphere | NLRNTLKLPSLDAVFATLVEEDNVEKRTSALLAAMHLQ* |
Ga0105247_111139301 | 3300009101 | Switchgrass Rhizosphere | SVANLRATLQLSSLDAVFAALVNEEDVQERSRGLVAAMRA* |
Ga0066709_1001418582 | 3300009137 | Grasslands Soil | VVILKDGVVVGHDSVSQLRSTLQLPSLDAVFASLVREENVTGRVRGLVEVMRS* |
Ga0114129_101763881 | 3300009147 | Populus Rhizosphere | KDGRIVGHDSVANLRATLQLPSLDAVFAALVVEEDVEERSRGLVAAMQS* |
Ga0105243_127383312 | 3300009148 | Miscanthus Rhizosphere | QTLKLPTLDAVFATLVEETNVEGRTRALVEAMHLQ* |
Ga0075423_108858972 | 3300009162 | Populus Rhizosphere | DVVGHDSVGNLRETLRLPSLDAVFAALVSEERVDEKTGGLVAAMNV* |
Ga0075423_113274742 | 3300009162 | Populus Rhizosphere | GHDSVANLRATLQLPSLDAVFAALVVEENIDERSRGLVAAMQS* |
Ga0075423_117790102 | 3300009162 | Populus Rhizosphere | HDSVERLRAMMHLPSLDAVFASLVEEDDSEARCQSMIAAMNT* |
Ga0105248_123123341 | 3300009177 | Switchgrass Rhizosphere | LRDTLQLASLDAVFAALTAEEDVDDRRSGLIRAMKASGV* |
Ga0105237_110647051 | 3300009545 | Corn Rhizosphere | LKEGHVVGHDSVANLRATLHLSSLDAVFAALVNEDDVLERSRGLVAAMKA* |
Ga0105082_11003401 | 3300009814 | Groundwater Sand | RIVGHDSVANLRTTLQLPSLDAVFAALVAEENIDDRTRGLVEAMKA* |
Ga0134088_102195542 | 3300010304 | Grasslands Soil | VARLRATLQLPTLDAVFASLVKEDDVDSRSRRLIEAMRA* |
Ga0134066_101010632 | 3300010364 | Grasslands Soil | DRVDRLRSTLQLPSLDAVFASLVAEENVEDRCRGLVAAMKG* |
Ga0134122_131425912 | 3300010400 | Terrestrial Soil | GHDSVGNLRETLRLPSLDAVFAALVAEERVAERTDGLVAAMNG* |
Ga0134123_126038352 | 3300010403 | Terrestrial Soil | CTTLRLPSLDAVFASIVAEEHVEERTSGLVAAMKA* |
Ga0137392_103729012 | 3300011269 | Vadose Zone Soil | VGHDSVDHLRATLELPSLDAVFAALVAEDNVDDRSRKLLAAMKA* |
Ga0137391_109677642 | 3300011270 | Vadose Zone Soil | RRSTFTLPSLDAVFLALASEENVDQQSRGLVAAMKT* |
Ga0137312_10135841 | 3300011400 | Soil | HDSVANLRNTLKLPSLDAVFATLVEEDDVDKRSAALLEAMHLQ* |
Ga0137424_10501431 | 3300011412 | Soil | RVVILKDGRIVGHDSVANLRNTLKLPSLDAVFATLVEEDNVEGRTSALLAAMHLQ* |
Ga0137432_10958261 | 3300011439 | Soil | NTLKLPSLDAVFATLVAEENVERRTTGLISAMHLQ* |
Ga0120191_101372992 | 3300012022 | Terrestrial | ILKDGHIVGHDSVDNLRNTLKLPSLDAVFAALVEEENVDKRASALIAAMHLQ* |
Ga0137380_110280142 | 3300012206 | Vadose Zone Soil | VGHDSVEQLRSTLQLPSLDAVFASLVAEEHVDDRCRGLVAAMKA* |
Ga0137367_103894462 | 3300012353 | Vadose Zone Soil | VERLRATLQLPSLDAVFASLVEEDDSDARCHAMIAAMNS* |
Ga0137385_111246752 | 3300012359 | Vadose Zone Soil | GHDSVDRLRTTLQLPSLDAVFASIVAEENVDDRCHGLVAAMKA* |
Ga0137394_103427291 | 3300012922 | Vadose Zone Soil | DGRIVGHDSVANLRATLQLPSLDAVFAAIIAEENVDERSQGLVAAMKS* |
Ga0137394_114971672 | 3300012922 | Vadose Zone Soil | ILKDGRIVGHDSVANLRATLQLPSLDAVFAALVVEENVDARSQGLVAAMKS* |
Ga0137407_117923301 | 3300012930 | Vadose Zone Soil | VVGHDSVDQLRATLQLPSLDAVFAALVAEENVEERCRGLLAAMKA* |
Ga0137410_102120432 | 3300012944 | Vadose Zone Soil | KDGRIVGHDSVANLRETLRLTSLDAVFASLVAEEKIEERTSGLVAAMKA* |
Ga0163162_115530831 | 3300013306 | Switchgrass Rhizosphere | ANLRDTLQLASLDAVFAALTAEEDVDDRRSGLIRAMKASGV* |
Ga0157375_111276331 | 3300013308 | Miscanthus Rhizosphere | VVGHDYVERLRAMLQLPSLDAVFASLVEEDDSEARCRSMIAAMNA* |
Ga0134079_102120492 | 3300014166 | Grasslands Soil | GHDSVERLRAMLQLPSLDAVFASLVQEDDSEARCRSMIAAMNA* |
Ga0163163_132128672 | 3300014325 | Switchgrass Rhizosphere | GRVVGHDSVAQLRSTLRLPSLDAVFAALVAEERVEERTGDMVNLMKSHG* |
Ga0132257_1006436252 | 3300015373 | Arabidopsis Rhizosphere | VILKDGHVVGHDSVERLRAMLQLPSLDAVFASLVQEDDSEARCRSMIAAMNA* |
Ga0132257_1009239201 | 3300015373 | Arabidopsis Rhizosphere | VCSRVVTLKDGRVVGHDSVAHLRETLRLPSLDAVFASIVAEENLEERTNGLVAAMKA* |
Ga0132257_1026263791 | 3300015373 | Arabidopsis Rhizosphere | SVERLRAILQLPSLDAVFASLVQEDDSEARCRLMIAAMNA* |
Ga0132257_1027038521 | 3300015373 | Arabidopsis Rhizosphere | RVVILKDGKVVGHDSVERLRAMLHLPSLDAVFASLVQEDDSEARCRSMIAAMNA* |
Ga0184626_102468122 | 3300018053 | Groundwater Sediment | VGHDSVVNLRATLKLPSLDAVFAALVAEEDADEQSSGLVAAMKA |
Ga0184623_104874782 | 3300018056 | Groundwater Sediment | ATLQLPSLDAVFAAFIADDNIEDRTHGLVAAMKAGA |
Ga0184612_106042621 | 3300018078 | Groundwater Sediment | GRMFGHASVANLRDTLQRPSLDAVFAALTAEGNVEDRRRELIRAMKA |
Ga0184628_103918921 | 3300018083 | Groundwater Sediment | LKDGRIVGHDSVANLRNTLKLPSLDAVFATLVEEDNVEGRTSALLAAMHLQ |
Ga0190272_109385361 | 3300018429 | Soil | HDSVDNLRNTLQLPSLDAVFATLVEEDNVENRTSALIAAMHLQ |
Ga0190272_116885022 | 3300018429 | Soil | CTRVVILKDGHIVGHDSVANLRNTLKLPSLDAVFATLVEEDDVDKRSAALVAAMHLQ |
Ga0066655_105414782 | 3300018431 | Grasslands Soil | RTDRRIVGLDSVGRLRASLELPTLDAVFASLVKEDDVDSRSRRLIEAMRA |
Ga0190270_104555312 | 3300018469 | Soil | IVGHDSVENLRNTLKLPSLDAVFATLTEEENVEKRTNALIAAMHMQ |
Ga0190273_111726931 | 3300018920 | Soil | DSVANLRANLQLPSLDAVFAALTAEENVEDRRRELVRAMKA |
Ga0190264_107253621 | 3300019377 | Soil | VENLRNTLKLPSLDAVFATLTDEENVEKRTNALIAAMHMQ |
Ga0222623_103474361 | 3300022694 | Groundwater Sediment | LKDGQIVGHDSVANLRDMLRLPSLDAVFAALTAEENVEERSRGLVAAMKA |
Ga0207671_109493141 | 3300025914 | Corn Rhizosphere | LKEGHVVGHDSVANLRATLHLSSLDAVFAALVNEDDVLERSRGLVAAMKA |
Ga0207681_117857141 | 3300025923 | Switchgrass Rhizosphere | DSVAQLRSTLRLPSLDAVFAALVAEERVEERTGDMVNLMKSHG |
Ga0207651_104705301 | 3300025960 | Switchgrass Rhizosphere | ILKDGHVVGHDYVERLRAMLQLPSLDAVFASLVEEDDSEARCRSMIAAMNA |
Ga0207703_121191221 | 3300026035 | Switchgrass Rhizosphere | RSTLQLPSLDAVFAALVAEENVEEQTRDMISTMKA |
Ga0207675_1011803142 | 3300026118 | Switchgrass Rhizosphere | LRSTLKLPSLDAVFAALVTEDDVTSRTRALIAAMKAS |
Ga0209239_10822192 | 3300026310 | Grasslands Soil | HDSVANLRATLRLPSLDAVFASLVAEERVEERTLGLLAAMRA |
Ga0209686_11092791 | 3300026315 | Soil | VGHDSVANLRATLRLPSLDAVFASLVAEERVEERTLGLLAAMRA |
Ga0209802_12804781 | 3300026328 | Soil | RIVGHDSVARLRATLQLPTLDAVFASLVKEDDVDSRSRRLIEAMRA |
Ga0209804_12511892 | 3300026335 | Soil | RLRATLQLPTLDAVFASLVKEDDVDSRSRRLIEAMRA |
Ga0209388_11236572 | 3300027655 | Vadose Zone Soil | LKDGRIVGHDSVANLRATLRLPSLDAVFASLVEEDHVEERTQGLLAAMRA |
Ga0207428_10000039186 | 3300027907 | Populus Rhizosphere | VTNLRNTLRLPSLDAVFAALTAEENVEDRRLELIRAMKA |
Ga0207428_107094081 | 3300027907 | Populus Rhizosphere | ANLRATLQLPSLDAVFATLIVEEHIDERSQGLVAAMKS |
Ga0307284_102038261 | 3300028799 | Soil | ANLRATLKLPSLDAVFASLVAEDDHEARSRGLVAAMKA |
Ga0307281_102536051 | 3300028803 | Soil | DVVGHDSVGNLRETLRLPSLDAVFAALVSEERVDEKTGGLVAAMNR |
Ga0308187_104477861 | 3300031114 | Soil | KDGRIVGHDSVANLRATLKLPSLDAVFASLVAEDDHEARSRGLVAAMKA |
Ga0307500_102938551 | 3300031198 | Soil | DGGIVGHDSVANLRDTLRLPSLDAVFASLVAEENVEERTNGLVAAMKA |
Ga0310888_100656422 | 3300031538 | Soil | VENLRQTLKLPTLDAVFATLVEETNVEGRTRALVEAMHLQ |
Ga0310888_110289952 | 3300031538 | Soil | SLRNTLKLPSLDAVFAMLVHEDNVEARTNALIAAMHLQ |
Ga0310887_107102151 | 3300031547 | Soil | GHDSVASLRNTLKLPSLDAVFAMLVHEDNVEARTNALIAAMHLQ |
Ga0307408_1001703442 | 3300031548 | Rhizosphere | SRVVILKDGHIVGHDSVANLRNTLKLPSLDAVFATLVEEDSVEARTTALLAAMHLQ |
Ga0307469_123011652 | 3300031720 | Hardwood Forest Soil | HDSVVNLRATLQLPSLDAVFGALSAEEDVDERSRAMVAAMKA |
Ga0307468_1005194671 | 3300031740 | Hardwood Forest Soil | RVVGHDSVERLRAILQLPSLDAVFASLVQEDDSEARCRSMIAAMNA |
Ga0310907_108550741 | 3300031847 | Soil | LKDGSIVGHDSVANLRATLQLPSLDAVFAALVAEEDLGERTRGLVAAMTGAL |
Ga0310892_111508772 | 3300031858 | Soil | NTLKLPSLDAVFATLVEEDNVEKRTGALLAAMHLQ |
Ga0310890_106233061 | 3300032075 | Soil | SVASLRNTLKLPSLDAVFAMLVHEDNVEARTNALIAAMHLQ |
Ga0311301_117639781 | 3300032160 | Peatlands Soil | AKLRSTLQLPSLDAVFAALTVEDNIEERSREMVAAMKA |
Ga0310889_106305701 | 3300032179 | Soil | GSLRETLRLPSLDAVFAALVSEERVDEKTGGLVAAMNR |
Ga0306920_1016567961 | 3300032261 | Soil | NLRTTLRLPSLDAVFAALTAEENVDERSRAMVAAMKA |
⦗Top⦘ |