| Basic Information | |
|---|---|
| Family ID | F079744 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRELLRERSGK |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.54 % |
| % of genes near scaffold ends (potentially truncated) | 84.35 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.696 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (13.043 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.130 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.783 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.17% β-sheet: 0.00% Coil/Unstructured: 45.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF04972 | BON | 51.30 |
| PF08085 | Entericidin | 6.09 |
| PF01553 | Acyltransferase | 6.09 |
| PF01435 | Peptidase_M48 | 5.22 |
| PF05494 | MlaC | 3.48 |
| PF02915 | Rubrerythrin | 1.74 |
| PF04366 | Ysc84 | 0.87 |
| PF04191 | PEMT | 0.87 |
| PF01734 | Patatin | 0.87 |
| PF02867 | Ribonuc_red_lgC | 0.87 |
| PF13439 | Glyco_transf_4 | 0.87 |
| PF02922 | CBM_48 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG5510 | Predicted small secreted protein | Function unknown [S] | 6.09 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 3.48 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.87 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.87 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.87 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.87 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.70 % |
| Unclassified | root | N/A | 11.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_29043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1003 | Open in IMG/M |
| 2209111006|2214922443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300000550|F24TB_16424608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 682 | Open in IMG/M |
| 3300003994|Ga0055435_10155226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 640 | Open in IMG/M |
| 3300004009|Ga0055437_10135059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 754 | Open in IMG/M |
| 3300004114|Ga0062593_100518279 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300004156|Ga0062589_101939867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300005289|Ga0065704_10026570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1783 | Open in IMG/M |
| 3300005295|Ga0065707_10679497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300005295|Ga0065707_10773528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 609 | Open in IMG/M |
| 3300005330|Ga0070690_101080501 | Not Available | 635 | Open in IMG/M |
| 3300005335|Ga0070666_10932100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 643 | Open in IMG/M |
| 3300005354|Ga0070675_101309721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 668 | Open in IMG/M |
| 3300005355|Ga0070671_100559420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 987 | Open in IMG/M |
| 3300005364|Ga0070673_100464969 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300005366|Ga0070659_101038729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 720 | Open in IMG/M |
| 3300005406|Ga0070703_10231244 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005507|Ga0074259_10415156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 759 | Open in IMG/M |
| 3300005536|Ga0070697_100445191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
| 3300005546|Ga0070696_100323187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1188 | Open in IMG/M |
| 3300005549|Ga0070704_100968977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300005618|Ga0068864_100824521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 913 | Open in IMG/M |
| 3300005830|Ga0074473_10157246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 567 | Open in IMG/M |
| 3300006845|Ga0075421_101150067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300006847|Ga0075431_101756535 | Not Available | 577 | Open in IMG/M |
| 3300006914|Ga0075436_101305058 | Not Available | 549 | Open in IMG/M |
| 3300007004|Ga0079218_13361203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300009131|Ga0115027_11299298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 587 | Open in IMG/M |
| 3300009147|Ga0114129_11557777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 810 | Open in IMG/M |
| 3300009148|Ga0105243_10891902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 884 | Open in IMG/M |
| 3300009157|Ga0105092_10063810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1989 | Open in IMG/M |
| 3300009168|Ga0105104_10584096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300009551|Ga0105238_12374795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300009610|Ga0105340_1035038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1952 | Open in IMG/M |
| 3300009801|Ga0105056_1000825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2403 | Open in IMG/M |
| 3300009812|Ga0105067_1015079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1024 | Open in IMG/M |
| 3300009821|Ga0105064_1001850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3097 | Open in IMG/M |
| 3300009837|Ga0105058_1036151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1079 | Open in IMG/M |
| 3300010399|Ga0134127_10542166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1182 | Open in IMG/M |
| 3300010399|Ga0134127_10596684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1132 | Open in IMG/M |
| 3300010401|Ga0134121_10536702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1084 | Open in IMG/M |
| 3300011398|Ga0137348_1030254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
| 3300011443|Ga0137457_1344084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 508 | Open in IMG/M |
| 3300012035|Ga0137445_1033483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 976 | Open in IMG/M |
| 3300012203|Ga0137399_11691532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300012225|Ga0137434_1041602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 680 | Open in IMG/M |
| 3300012906|Ga0157295_10048073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1004 | Open in IMG/M |
| 3300012960|Ga0164301_10354883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1009 | Open in IMG/M |
| 3300013307|Ga0157372_10346623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1730 | Open in IMG/M |
| 3300013308|Ga0157375_10888491 | Not Available | 1036 | Open in IMG/M |
| 3300014870|Ga0180080_1018349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300014873|Ga0180066_1012558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1473 | Open in IMG/M |
| 3300014878|Ga0180065_1035690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1043 | Open in IMG/M |
| 3300014880|Ga0180082_1112243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 622 | Open in IMG/M |
| 3300014883|Ga0180086_1153628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 599 | Open in IMG/M |
| 3300014884|Ga0180104_1261813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 514 | Open in IMG/M |
| 3300014885|Ga0180063_1221415 | Not Available | 607 | Open in IMG/M |
| 3300014885|Ga0180063_1304371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 505 | Open in IMG/M |
| 3300015252|Ga0180075_1025527 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300015259|Ga0180085_1240876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 533 | Open in IMG/M |
| 3300017936|Ga0187821_10058508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1388 | Open in IMG/M |
| 3300018031|Ga0184634_10027187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2232 | Open in IMG/M |
| 3300018052|Ga0184638_1315096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 527 | Open in IMG/M |
| 3300018054|Ga0184621_10085765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1100 | Open in IMG/M |
| 3300018056|Ga0184623_10265877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 781 | Open in IMG/M |
| 3300018072|Ga0184635_10059244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1485 | Open in IMG/M |
| 3300018075|Ga0184632_10404270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 573 | Open in IMG/M |
| 3300018079|Ga0184627_10084217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1670 | Open in IMG/M |
| 3300021063|Ga0206227_1053875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 739 | Open in IMG/M |
| 3300021080|Ga0210382_10387440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 618 | Open in IMG/M |
| 3300021081|Ga0210379_10424237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 588 | Open in IMG/M |
| 3300025289|Ga0209002_10297286 | Not Available | 952 | Open in IMG/M |
| 3300025319|Ga0209520_10834747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 503 | Open in IMG/M |
| 3300025537|Ga0210061_1092392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300025551|Ga0210131_1071876 | Not Available | 583 | Open in IMG/M |
| 3300025899|Ga0207642_10184120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1140 | Open in IMG/M |
| 3300025903|Ga0207680_10550557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 824 | Open in IMG/M |
| 3300025914|Ga0207671_10148971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1807 | Open in IMG/M |
| 3300025918|Ga0207662_10070495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2114 | Open in IMG/M |
| 3300025921|Ga0207652_11620354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300025925|Ga0207650_10568313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 952 | Open in IMG/M |
| 3300025942|Ga0207689_10056769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3222 | Open in IMG/M |
| 3300025953|Ga0210068_1026620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 849 | Open in IMG/M |
| 3300025961|Ga0207712_11019099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300025972|Ga0207668_10222111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300026023|Ga0207677_10434958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300026088|Ga0207641_10859013 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300026089|Ga0207648_10256838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1559 | Open in IMG/M |
| 3300027006|Ga0209896_1010123 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300027056|Ga0209879_1029079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300027815|Ga0209726_10016801 | All Organisms → cellular organisms → Bacteria | 6550 | Open in IMG/M |
| 3300027821|Ga0209811_10014525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2539 | Open in IMG/M |
| 3300027840|Ga0209683_10229510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300027907|Ga0207428_10980230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 595 | Open in IMG/M |
| 3300027907|Ga0207428_11308016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 502 | Open in IMG/M |
| 3300027909|Ga0209382_11395967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300028884|Ga0307308_10208635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 936 | Open in IMG/M |
| 3300030006|Ga0299907_10366257 | Not Available | 1164 | Open in IMG/M |
| 3300030540|Ga0247649_1020232 | Not Available | 701 | Open in IMG/M |
| 3300030551|Ga0247638_1015655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
| 3300030634|Ga0247636_10256990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 578 | Open in IMG/M |
| 3300031229|Ga0299913_10932589 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031538|Ga0310888_10840038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300031944|Ga0310884_10840495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 563 | Open in IMG/M |
| 3300032180|Ga0307471_103708237 | Not Available | 540 | Open in IMG/M |
| 3300032211|Ga0310896_10712342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 569 | Open in IMG/M |
| 3300032770|Ga0335085_11796617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 628 | Open in IMG/M |
| 3300033412|Ga0310810_11367173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 547 | Open in IMG/M |
| 3300033486|Ga0316624_11852773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 558 | Open in IMG/M |
| 3300033513|Ga0316628_104086984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 520 | Open in IMG/M |
| 3300034147|Ga0364925_0426945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 504 | Open in IMG/M |
| 3300034354|Ga0364943_0026308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1830 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 13.04% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.09% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.22% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.35% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.74% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.74% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.87% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.87% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.87% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030540 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030551 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00094950 | 2199352025 | Soil | MTTNGESKFSYLLVGLGLGAIGGLMAAILGRKETREVLRERGGKSLDY |
| 2213982951 | 2209111006 | Arabidopsis Rhizosphere | MTTNSESKVSYLLIGLGLGAVGGLMAALLVRKETREAI |
| F24TB_164246081 | 3300000550 | Soil | MTTNGESKFSYLLVGLGLGAIGGFMAAILGRRETREVLRERGGKGLDYLN |
| Ga0055435_101552261 | 3300003994 | Natural And Restored Wetlands | KFSYLLIGLGLGAIGALMFALVARKETRELPRERSKTLD* |
| Ga0055437_101350593 | 3300004009 | Natural And Restored Wetlands | METNGESKFSYLLIGLGLGAIGGLMAALLARKETRELLRERSTETLD |
| Ga0062593_1005182791 | 3300004114 | Soil | MRTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREIIRDSSRKSLDYLNQQ |
| Ga0062589_1019398672 | 3300004156 | Soil | MRTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREIIRDSSRK |
| Ga0065704_100265702 | 3300005289 | Switchgrass Rhizosphere | MKNNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERTSKTLD* |
| Ga0065707_106794971 | 3300005295 | Switchgrass Rhizosphere | MTTNGESKFSHLLIGLGLGAIGGLVAAILANKESRDLLRERSGKS |
| Ga0065707_107735281 | 3300005295 | Switchgrass Rhizosphere | MKTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSKSLD* |
| Ga0070690_1010805011 | 3300005330 | Switchgrass Rhizosphere | MTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRDR |
| Ga0070666_109321001 | 3300005335 | Switchgrass Rhizosphere | MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETREVLRERSGKS |
| Ga0070675_1013097211 | 3300005354 | Miscanthus Rhizosphere | MTTNGESKFSYLLIGLGAVGGLMAAILARKETRELLRERSGKSLDYLNQQA |
| Ga0070671_1005594201 | 3300005355 | Switchgrass Rhizosphere | MAANGESKFSYLFIALGLGAVGGLMAAIIARKETREVLRERSGKSLDYLNQQ |
| Ga0070673_1004649691 | 3300005364 | Switchgrass Rhizosphere | MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRETLRERSGKSLDYLNQQ |
| Ga0070659_1010387291 | 3300005366 | Corn Rhizosphere | MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRELLRERSGK |
| Ga0070703_102312441 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRD |
| Ga0074259_104151562 | 3300005507 | Arabidopsis Rhizosphere | MRTNDESKFSFLLIGLGLGVIGGMMAVLLARKETRESLNERSRKT |
| Ga0070697_1004451913 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTNDESKFSYLLVGLGLGAIGGLMAALLARKETRELLRER |
| Ga0070696_1003231871 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRELLRERSGKS |
| Ga0070704_1009689771 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREIIRERSP* |
| Ga0068864_1008245212 | 3300005618 | Switchgrass Rhizosphere | MTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREI |
| Ga0074473_101572461 | 3300005830 | Sediment (Intertidal) | MTTNGESKFSYLLIGLGLGAIGGLMSALLARKETREL |
| Ga0075421_1011500672 | 3300006845 | Populus Rhizosphere | MTTNSESKVSYLLIGLGLGAVGGLMAALLVRKETREAIRERSRKSLDY |
| Ga0075431_1017565353 | 3300006847 | Populus Rhizosphere | MKTNDESKFSFLLIGLGLGVIGGMMAVLLARKETRESLSER |
| Ga0075436_1013050583 | 3300006914 | Populus Rhizosphere | MTTNDESKFSYLLVGLGLGVIGGVMATLLARKETRELLRER |
| Ga0079218_133612031 | 3300007004 | Agricultural Soil | MTNNDESKFSYLLIGLGLGAVGGLMAAMLAHKETRE |
| Ga0115027_112992981 | 3300009131 | Wetland | MRTNDDGKLFFLLIGLGLGAIGGLIAALLAREENREALREGGAKSLEYLNE |
| Ga0114129_115577773 | 3300009147 | Populus Rhizosphere | MTTNGESKFSYLLIGLGLGAIGGLMSALLARKETRELLRERSGKSLDYLNQ |
| Ga0105243_108919022 | 3300009148 | Miscanthus Rhizosphere | MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRETLRERSGKSLDYL |
| Ga0105092_100638102 | 3300009157 | Freshwater Sediment | MTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERS* |
| Ga0105104_105840961 | 3300009168 | Freshwater Sediment | MKTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSETLD* |
| Ga0105238_123747951 | 3300009551 | Corn Rhizosphere | MAANGESKFSYLFIALGLGAVGGLMAAIIARKETREVLR |
| Ga0105340_10350381 | 3300009610 | Soil | MTTRGGSRFSYLLTGLGLGAIGGILAAILARKETREAFRERRA |
| Ga0105056_10008254 | 3300009801 | Groundwater Sand | MKTNGESKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKTLD* |
| Ga0105067_10150793 | 3300009812 | Groundwater Sand | SKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKTLD* |
| Ga0105064_10018505 | 3300009821 | Groundwater Sand | MKTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSKTLD* |
| Ga0105058_10361513 | 3300009837 | Groundwater Sand | MKTNGESKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKPLD* |
| Ga0134127_105421661 | 3300010399 | Terrestrial Soil | MRTNDESKLSFLLIGLGLGVIGGMMAVLLPRKETRESLSERS |
| Ga0134127_105966843 | 3300010399 | Terrestrial Soil | MTTNGEAKISYLVIGLGLGAIGGLMAAVFASKETRQLLRERSGKSL |
| Ga0134122_119623292 | 3300010400 | Terrestrial Soil | MRERNERGDKRMETNDESKFSYLLIGLGLAAIGGLMAGLLARREIRELLRERSG |
| Ga0134121_105367021 | 3300010401 | Terrestrial Soil | MRTNDESKFSFLLIGLGLGVIGGMMAVLLARKETRES |
| Ga0137348_10302543 | 3300011398 | Soil | MTTRGESRFSYLLTGLGLGAIGGILAAILARKETREAF |
| Ga0137457_13440842 | 3300011443 | Soil | MKPNGESKNSFLLIGLGLAAIGALMAALLARKETRES |
| Ga0137445_10334833 | 3300012035 | Soil | MRTNGESKNSVLLIGLGLAAIGALMAALLARKETRESL |
| Ga0137399_116915321 | 3300012203 | Vadose Zone Soil | MTTNGESKFSYLLVGLGLGAIGGLMAAILGRKETREVLRERGGK |
| Ga0137434_10416023 | 3300012225 | Soil | MRTKGESRFALLLIGLGLGAMGALVAGLLARKETRELLRERSTEALDYL |
| Ga0157295_100480733 | 3300012906 | Soil | MTTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREIIRERS |
| Ga0164301_103548832 | 3300012960 | Soil | MTTNGESKFSYLLVGLGLGAIGGFMAAILGRKETR* |
| Ga0157372_103466231 | 3300013307 | Corn Rhizosphere | MTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETRE |
| Ga0157375_108884911 | 3300013308 | Miscanthus Rhizosphere | MRTNDESKLSFLLIGLGLGVIGGMMAVLLARKETRESLSERSRKTID |
| Ga0180080_10183491 | 3300014870 | Soil | MRTNGESKFSFLLIGLGLGAIGGLMFALLARKETRKYLREQSDKGLDILN |
| Ga0180066_10125584 | 3300014873 | Soil | MTTNGESKFSYLLIGLGLGAIGGLMSALLGRKETR |
| Ga0180065_10356902 | 3300014878 | Soil | MRTNGESKFSFLLIGLGLGAIGGLMAALLARKETRELLRQRGGKTVDY |
| Ga0180082_11122431 | 3300014880 | Soil | MTTNGESKFSYLFIGLGLGLGAIGGLMFALLARKETRELLRERSSKTLDYLNQH |
| Ga0180086_11536282 | 3300014883 | Soil | MTTNDESKFSYLLVGLGLGAVGGLMAAILARKETRDV |
| Ga0180104_12618132 | 3300014884 | Soil | MRTNGEAKFSVLLIGLSLGAIGALMGALLARKETRESLR |
| Ga0180063_12214151 | 3300014885 | Soil | MQKEEKLMSTNGESKFSYLLIGLGLGAIGGLLSALLGRKETRELL |
| Ga0180063_13043712 | 3300014885 | Soil | MRTNGEAKFSFLLIGLGLGAIGALMAALLARKETRE |
| Ga0180075_10255271 | 3300015252 | Soil | MQKEEKLMTTNGESKFSYLLIGLGLGAIGGLMAALLARNET |
| Ga0180085_12408762 | 3300015259 | Soil | MEKEEKLMTTNGESKFSYLLIGLGLGAIGGLMSALLGRKDTRELLRERSNKCLDY |
| Ga0187821_100585084 | 3300017936 | Freshwater Sediment | MTTNGESKFSYLLIGLGMGAIGGLMAAILAHKETR |
| Ga0184634_100271875 | 3300018031 | Groundwater Sediment | MRTKGEAKFFFLLIGLGLGAIGALMAALLARKETRE |
| Ga0184638_13150962 | 3300018052 | Groundwater Sediment | MTTNGESKFSYLLIGLALGAIGGLMSALLARKETRDVLRERSGKSLDYL |
| Ga0184621_100857651 | 3300018054 | Groundwater Sediment | MTTNGESKFSDLLIGLGLGAIGGLMSALLARKETRE |
| Ga0184623_102658773 | 3300018056 | Groundwater Sediment | MTTNGESKFSYLLIGLGLGAIGGLMAAILARKETREALRERGGKSLDYLNQ |
| Ga0184637_102898163 | 3300018063 | Groundwater Sediment | MTTNGESKFSYLLIGLGLGAIGGLISAALARKETRELL |
| Ga0184635_100592443 | 3300018072 | Groundwater Sediment | MSTNGESKFSYLFIGLGLGLGAIGGLMFALLARKETRELLRERSSKT |
| Ga0184632_104042701 | 3300018075 | Groundwater Sediment | MTTNGESKFSFLLISLGLGAIGGLMFALLARKETRDLLRERSRKTL |
| Ga0184627_100842174 | 3300018079 | Groundwater Sediment | MTTNGESKFSYLLIGLGLGAIGGLISAALARKETRELIRERGRSSLDYLN |
| Ga0206227_10538751 | 3300021063 | Deep Subsurface Sediment | MRMESATMRSNGEFRFPYFLVGLGRGAIGGPMSALLGRKETREFLRERS |
| Ga0210382_103874403 | 3300021080 | Groundwater Sediment | MTTNGESKFSYLLIGLALGAIGGLMSALLARKETRDVLR |
| Ga0210379_104242372 | 3300021081 | Groundwater Sediment | MRTNGESKFSFLLIGLGLGAIGGLMAALLARKETRELLRQRGGKT |
| Ga0209002_102972862 | 3300025289 | Soil | MKTNVETKFSYFLVGLGLGAIGGLMAALLARQEGRELL |
| Ga0209520_108347472 | 3300025319 | Soil | MTTNGESKFSHLLIGLGLGAVGGLIAAILARKETREELRERS |
| Ga0210061_10923921 | 3300025537 | Natural And Restored Wetlands | MTTNGESKVSYLLIGLGLGAVGGLLAALLVRKETREIIRERSRESLDYLNQK |
| Ga0210131_10718763 | 3300025551 | Natural And Restored Wetlands | KFSYLLIGLGLGAIGALMFALVARKETRELPRERSKTLD |
| Ga0207642_101841202 | 3300025899 | Miscanthus Rhizosphere | MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRETLRE |
| Ga0207680_105505572 | 3300025903 | Switchgrass Rhizosphere | MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETREVLRERSGKSLDY |
| Ga0207671_101489713 | 3300025914 | Corn Rhizosphere | MTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRDRSRKSLD |
| Ga0207662_100704952 | 3300025918 | Switchgrass Rhizosphere | MTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRERSP |
| Ga0207652_116203541 | 3300025921 | Corn Rhizosphere | MRTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREII |
| Ga0207650_105683133 | 3300025925 | Switchgrass Rhizosphere | MRTNDESKFSFLLIGLGLGVIGGMMAVLLARKETRESLSERSRKT |
| Ga0207689_100567692 | 3300025942 | Miscanthus Rhizosphere | MTTNSESKVSYLLIGLGLGAVGGLMAALLVRKETREIIRERSP |
| Ga0210068_10266203 | 3300025953 | Natural And Restored Wetlands | MTTNGESKFSYLFIGLCLGLGAIGGLVFALLARKE |
| Ga0207712_110190991 | 3300025961 | Switchgrass Rhizosphere | MTTNGESKLSYLLIGLGLGAVGGLMAAILARKETRELL |
| Ga0207668_102221111 | 3300025972 | Switchgrass Rhizosphere | MTTNGESKFSYLLVGLGLGAIGGFMAAIPGRRETR |
| Ga0208284_10198761 | 3300026003 | Rice Paddy Soil | MKTNGETKFFYFLGGLGLGAIGGLISGLLARKDTRD |
| Ga0207677_104349581 | 3300026023 | Miscanthus Rhizosphere | MTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREII |
| Ga0207641_108590132 | 3300026088 | Switchgrass Rhizosphere | SGSKVSYLLIGLGLGAVGGLMAALLVRKETREIIRERSP |
| Ga0207648_102568381 | 3300026089 | Miscanthus Rhizosphere | MTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRDRS |
| Ga0209896_10101233 | 3300027006 | Groundwater Sand | MKTNGESKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKTLD |
| Ga0209879_10290791 | 3300027056 | Groundwater Sand | MKTNGESKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKPLD |
| Ga0209726_1001680113 | 3300027815 | Groundwater | MRTDSEFKFSILLIGLGLGAIGGLMAVLLARKETRASLRESSGKTLDY |
| Ga0209811_100145251 | 3300027821 | Surface Soil | MTTNGESKFSYLLVGLGLRAIGGLMAAILGRKETREVL |
| Ga0209683_102295101 | 3300027840 | Wetland Sediment | MTTNGESKFSYLLIGLGLGAIGGLMSALLGRKDTRELLRERS |
| Ga0207428_109802301 | 3300027907 | Populus Rhizosphere | MTTNGESKFSYLLVGLGLGAIGGFMAAILGRRETREVLRERGGKG |
| Ga0207428_113080162 | 3300027907 | Populus Rhizosphere | MSTNGESKFSYLFIGLGLGAIGGLMFALLARKETRELLRERSN |
| Ga0209382_113959671 | 3300027909 | Populus Rhizosphere | MTTNSESKVSYLLIGLGLGAVGGLMAALLVRKETREAIRERS |
| Ga0307308_102086353 | 3300028884 | Soil | MTSDGESKFSYLLIGLGLGAVGGLMAAILARKETRELIR |
| Ga0299907_103662572 | 3300030006 | Soil | MKTNVETKFSYFLVGLGLGAIGGLMAALLARQETRELLRERSAKSLKYLN |
| Ga0247649_10202322 | 3300030540 | Soil | GESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSKTLD |
| Ga0247638_10156551 | 3300030551 | Soil | MKTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSKTLD |
| Ga0247636_102569901 | 3300030634 | Soil | VTTNGESKFSYLLIGLALGAIGGLISAVLARKETRELLRERGRNSLDYLN |
| Ga0299913_109325891 | 3300031229 | Soil | MTTNGAAKFAYLFIGLALGAVGGLIAAILARKETREVLRERSGRSLDYLNQ |
| Ga0310888_108400381 | 3300031538 | Soil | MTTNGESKFSYLLVGLGLGAIGGFMAAILGRRETRELLRERGGKSLDYLTGG |
| Ga0310884_108404951 | 3300031944 | Soil | MTTNGESKFSYLLVGLGLGAIGGFMAAILGRRETREVLRERGGKSLDYLNQ |
| Ga0307471_1037082373 | 3300032180 | Hardwood Forest Soil | MTTNDESKFSYLLVGLGLGAIGGLMAALLARKETR |
| Ga0310896_107123421 | 3300032211 | Soil | MPTNGESKFSYLLVGLGLGAIGGFMAAILGRRETREVLRERGG |
| Ga0335085_117966171 | 3300032770 | Soil | MTTNGKSTFSYLLIGLGLGAIGGLMSALLARKETRELLRERGRNSLDYLNQ |
| Ga0310810_113671732 | 3300033412 | Soil | MATNGTSKFSILLIGLGLGAIGGLMATVLGRKETREVLRESGGK |
| Ga0316624_118527731 | 3300033486 | Soil | MRTNGESKFSDLLIGLGLGAIGGLMIALLARKETRDSLRE |
| Ga0316628_1040869842 | 3300033513 | Soil | MRTNGEAKFSLLLIGLGLGAIGGLMIALLARKETRDSLRESST |
| Ga0364925_0426945_3_110 | 3300034147 | Sediment | MRTNDESRFSLLLIGLGLGAIAALVAALLARKKTRE |
| Ga0364943_0026308_1_153 | 3300034354 | Sediment | MTTNSESKFSYLFIGLGLGLGAIGGLMFALLARKETRELLRERSSKTLDYL |
| ⦗Top⦘ |