Basic Information | |
---|---|
Family ID | F079460 |
Family Type | Metagenome |
Number of Sequences | 115 |
Average Sequence Length | 39 residues |
Representative Sequence | MSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Number of Associated Samples | 60 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 11.30 % |
% of genes near scaffold ends (potentially truncated) | 48.70 % |
% of genes from short scaffolds (< 2000 bps) | 84.35 % |
Associated GOLD sequencing projects | 53 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (52.174 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (28.696 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.565 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (73.913 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 83.78% β-sheet: 0.00% Coil/Unstructured: 16.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF00816 | Histone_HNS | 6.09 |
PF00589 | Phage_integrase | 2.61 |
PF13676 | TIR_2 | 2.61 |
PF04392 | ABC_sub_bind | 1.74 |
PF07883 | Cupin_2 | 1.74 |
PF00565 | SNase | 1.74 |
PF07885 | Ion_trans_2 | 0.87 |
PF01068 | DNA_ligase_A_M | 0.87 |
PF04014 | MazE_antitoxin | 0.87 |
PF07508 | Recombinase | 0.87 |
PF13936 | HTH_38 | 0.87 |
PF13560 | HTH_31 | 0.87 |
PF14347 | DUF4399 | 0.87 |
PF00486 | Trans_reg_C | 0.87 |
PF07681 | DoxX | 0.87 |
PF01569 | PAP2 | 0.87 |
PF06841 | Phage_T4_gp19 | 0.87 |
PF07452 | CHRD | 0.87 |
PF03401 | TctC | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG2916 | DNA-binding protein H-NS | Transcription [K] | 6.09 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.74 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.87 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.87 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.87 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.87 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.87 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.17 % |
Unclassified | root | N/A | 47.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000580|AF_2010_repII_A01DRAFT_1019832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1069 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10013866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2214 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10132975 | Not Available | 604 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1018843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 1307 | Open in IMG/M |
3300005332|Ga0066388_102884956 | Not Available | 878 | Open in IMG/M |
3300005764|Ga0066903_100291061 | Not Available | 2572 | Open in IMG/M |
3300005764|Ga0066903_100300584 | All Organisms → cellular organisms → Bacteria | 2539 | Open in IMG/M |
3300005764|Ga0066903_101478419 | Not Available | 1281 | Open in IMG/M |
3300005764|Ga0066903_101878693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1146 | Open in IMG/M |
3300005764|Ga0066903_102687260 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300005764|Ga0066903_102733066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 957 | Open in IMG/M |
3300005764|Ga0066903_103607110 | Not Available | 833 | Open in IMG/M |
3300005764|Ga0066903_104009003 | Not Available | 789 | Open in IMG/M |
3300005764|Ga0066903_105552222 | Not Available | 664 | Open in IMG/M |
3300005764|Ga0066903_105950234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
3300005764|Ga0066903_106395082 | Not Available | 614 | Open in IMG/M |
3300005764|Ga0066903_108803276 | Not Available | 512 | Open in IMG/M |
3300006028|Ga0070717_10225402 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
3300009792|Ga0126374_10650252 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300009792|Ga0126374_11151627 | Not Available | 618 | Open in IMG/M |
3300010043|Ga0126380_11393568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300010046|Ga0126384_10569027 | Not Available | 987 | Open in IMG/M |
3300010046|Ga0126384_11608627 | Not Available | 612 | Open in IMG/M |
3300010047|Ga0126382_11922366 | Not Available | 560 | Open in IMG/M |
3300010048|Ga0126373_11014155 | Not Available | 895 | Open in IMG/M |
3300010048|Ga0126373_12082038 | Not Available | 629 | Open in IMG/M |
3300010048|Ga0126373_12303743 | Not Available | 599 | Open in IMG/M |
3300010358|Ga0126370_10124675 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300010358|Ga0126370_12510908 | Not Available | 514 | Open in IMG/M |
3300010359|Ga0126376_10126527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2004 | Open in IMG/M |
3300010361|Ga0126378_10307256 | Not Available | 1690 | Open in IMG/M |
3300010361|Ga0126378_10738254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1095 | Open in IMG/M |
3300010361|Ga0126378_13054373 | Not Available | 533 | Open in IMG/M |
3300010366|Ga0126379_11091628 | Not Available | 904 | Open in IMG/M |
3300010366|Ga0126379_11942482 | Not Available | 691 | Open in IMG/M |
3300010366|Ga0126379_12114305 | Not Available | 665 | Open in IMG/M |
3300010376|Ga0126381_100252725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2389 | Open in IMG/M |
3300010376|Ga0126381_100354278 | Not Available | 2030 | Open in IMG/M |
3300010376|Ga0126381_100513478 | Not Available | 1692 | Open in IMG/M |
3300010376|Ga0126381_101286416 | Not Available | 1057 | Open in IMG/M |
3300010376|Ga0126381_103951533 | Not Available | 577 | Open in IMG/M |
3300010398|Ga0126383_10358353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1482 | Open in IMG/M |
3300010398|Ga0126383_10504787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1268 | Open in IMG/M |
3300010863|Ga0124850_1036918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1557 | Open in IMG/M |
3300010863|Ga0124850_1109290 | Not Available | 750 | Open in IMG/M |
3300010868|Ga0124844_1244338 | Not Available | 634 | Open in IMG/M |
3300011120|Ga0150983_15045230 | Not Available | 969 | Open in IMG/M |
3300012211|Ga0137377_11082868 | Not Available | 732 | Open in IMG/M |
3300012957|Ga0164303_10407960 | Not Available | 841 | Open in IMG/M |
3300012971|Ga0126369_10416766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aurantimonas → unclassified Aurantimonas → Aurantimonas sp. 22II-16-19i | 1385 | Open in IMG/M |
3300012971|Ga0126369_11165016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium → unclassified Rhodomicrobium → Rhodomicrobium sp. Az07 | 860 | Open in IMG/M |
3300012971|Ga0126369_11193556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 851 | Open in IMG/M |
3300012971|Ga0126369_13413507 | Not Available | 520 | Open in IMG/M |
3300016294|Ga0182041_10052511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2768 | Open in IMG/M |
3300016294|Ga0182041_10151974 | Not Available | 1788 | Open in IMG/M |
3300016319|Ga0182033_10091076 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
3300016357|Ga0182032_10813889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
3300016357|Ga0182032_10994606 | Not Available | 716 | Open in IMG/M |
3300016371|Ga0182034_10088089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2185 | Open in IMG/M |
3300016371|Ga0182034_10216752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1490 | Open in IMG/M |
3300016371|Ga0182034_10290355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1307 | Open in IMG/M |
3300016371|Ga0182034_11373815 | Not Available | 617 | Open in IMG/M |
3300016371|Ga0182034_11674929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300016404|Ga0182037_10159812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1708 | Open in IMG/M |
3300016404|Ga0182037_10223514 | Not Available | 1475 | Open in IMG/M |
3300016404|Ga0182037_11517586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
3300016445|Ga0182038_10176235 | Not Available | 1660 | Open in IMG/M |
3300021560|Ga0126371_10175393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2223 | Open in IMG/M |
3300021560|Ga0126371_10295032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1747 | Open in IMG/M |
3300021560|Ga0126371_11533496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
3300021560|Ga0126371_13641011 | Not Available | 520 | Open in IMG/M |
3300025928|Ga0207700_11477259 | Not Available | 603 | Open in IMG/M |
3300031543|Ga0318516_10225992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1082 | Open in IMG/M |
3300031545|Ga0318541_10297381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 899 | Open in IMG/M |
3300031564|Ga0318573_10259614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 927 | Open in IMG/M |
3300031572|Ga0318515_10206698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1053 | Open in IMG/M |
3300031573|Ga0310915_10031533 | All Organisms → cellular organisms → Bacteria | 3316 | Open in IMG/M |
3300031573|Ga0310915_10054280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 2597 | Open in IMG/M |
3300031573|Ga0310915_10136739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1686 | Open in IMG/M |
3300031573|Ga0310915_10186107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 1448 | Open in IMG/M |
3300031573|Ga0310915_11076993 | Not Available | 559 | Open in IMG/M |
3300031719|Ga0306917_10308079 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300031719|Ga0306917_10391898 | Not Available | 1083 | Open in IMG/M |
3300031724|Ga0318500_10530619 | Not Available | 593 | Open in IMG/M |
3300031736|Ga0318501_10838006 | Not Available | 510 | Open in IMG/M |
3300031744|Ga0306918_10401095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1068 | Open in IMG/M |
3300031744|Ga0306918_10587326 | Not Available | 873 | Open in IMG/M |
3300031744|Ga0306918_11403205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 535 | Open in IMG/M |
3300031765|Ga0318554_10571257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 638 | Open in IMG/M |
3300031771|Ga0318546_10049379 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300031781|Ga0318547_10655063 | Not Available | 652 | Open in IMG/M |
3300031796|Ga0318576_10086502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1415 | Open in IMG/M |
3300031846|Ga0318512_10517740 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300031879|Ga0306919_10043260 | Not Available | 2933 | Open in IMG/M |
3300031879|Ga0306919_10418142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1029 | Open in IMG/M |
3300031890|Ga0306925_10027545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5753 | Open in IMG/M |
3300031890|Ga0306925_12020195 | Not Available | 543 | Open in IMG/M |
3300031910|Ga0306923_11597448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300031912|Ga0306921_10769854 | Not Available | 1101 | Open in IMG/M |
3300031942|Ga0310916_10466976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1075 | Open in IMG/M |
3300031945|Ga0310913_10354501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1038 | Open in IMG/M |
3300031945|Ga0310913_11292824 | Not Available | 506 | Open in IMG/M |
3300031946|Ga0310910_10910737 | Not Available | 689 | Open in IMG/M |
3300032001|Ga0306922_10385198 | Not Available | 1502 | Open in IMG/M |
3300032025|Ga0318507_10079559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1342 | Open in IMG/M |
3300032039|Ga0318559_10302950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 742 | Open in IMG/M |
3300032051|Ga0318532_10047460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1469 | Open in IMG/M |
3300032052|Ga0318506_10491721 | Not Available | 544 | Open in IMG/M |
3300032094|Ga0318540_10558132 | Not Available | 552 | Open in IMG/M |
3300032261|Ga0306920_100014448 | All Organisms → cellular organisms → Bacteria | 10780 | Open in IMG/M |
3300032261|Ga0306920_100181503 | All Organisms → cellular organisms → Bacteria | 3139 | Open in IMG/M |
3300032261|Ga0306920_102622895 | Not Available | 690 | Open in IMG/M |
3300032261|Ga0306920_103134739 | Not Available | 620 | Open in IMG/M |
3300033289|Ga0310914_10144831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2091 | Open in IMG/M |
3300033289|Ga0310914_10344853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1347 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 28.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.91% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A01DRAFT_10198321 | 3300000580 | Forest Soil | MSLRQFIPAVIVGLLLAALLLWLTLGWLLDVITLPVG* |
AF_2010_repII_A1DRAFT_100138663 | 3300000597 | Forest Soil | MSLRQFLPAVIAGLLLAALLLWLTLGWLLDAITLPVG* |
AF_2010_repII_A1DRAFT_101329753 | 3300000597 | Forest Soil | MSPRQFFIPAVIVGLLLAALLLSLTLGWLLDAYAACWLA |
AF_2010_repII_A100DRAFT_10188432 | 3300000655 | Forest Soil | MSLKQFIPAVIVGLLVAALLLWFTLGWLLDAITLPVG* |
Ga0066388_1028849563 | 3300005332 | Tropical Forest Soil | MLERQRIRTGPKRFIPAVIAGLLLAALLLWLTLGWLLDAITLPA |
Ga0066903_1002910614 | 3300005764 | Tropical Forest Soil | MSLKQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0066903_1003005844 | 3300005764 | Tropical Forest Soil | MSLRQFIPTVIVGLLLSALLLWLTLGWLLDAITLPVG* |
Ga0066903_1014784193 | 3300005764 | Tropical Forest Soil | MSPRQFILAVTAGLLLSALLLWLTLAWLLNAITLPVG* |
Ga0066903_1018786933 | 3300005764 | Tropical Forest Soil | MSPKLFIPGVIVGLLLAALLLWLMLGFLLDEITLPVG* |
Ga0066903_1026872602 | 3300005764 | Tropical Forest Soil | MSLKQFIPAVIVGLLLSALLLWLTLGWLLDAVTLPVG* |
Ga0066903_1027330663 | 3300005764 | Tropical Forest Soil | LCSLVMSLKQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0066903_1036071103 | 3300005764 | Tropical Forest Soil | MSPRQFFIPAVIVGLLLAALLMWLTLAPLLDAITLPVG* |
Ga0066903_1040090031 | 3300005764 | Tropical Forest Soil | VLGVFLRLSLRQFIPAVIVGLLLAALLLWLTLGWLLDAI |
Ga0066903_1055522222 | 3300005764 | Tropical Forest Soil | MSLRQFIPAVIVGLLLAALLLWLTLAWLLDAITLPVG* |
Ga0066903_1059502341 | 3300005764 | Tropical Forest Soil | MSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0066903_1063950822 | 3300005764 | Tropical Forest Soil | VQQFIPAVIAGLLLAALLLWLTLGWLLNTITLPVG* |
Ga0066903_1088032761 | 3300005764 | Tropical Forest Soil | VNRMSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLRVG* |
Ga0070717_102254022 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLRQFIPAVIVGLLLAALLLWFTLGWLLDAITLPVG* |
Ga0126374_106502522 | 3300009792 | Tropical Forest Soil | MSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0126374_111516272 | 3300009792 | Tropical Forest Soil | MSPRQFFIPAVIVGLLLAALLLSLTLGWLLDAITLPVG* |
Ga0126380_113935682 | 3300010043 | Tropical Forest Soil | MSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLQVRDTKA* |
Ga0126384_105690271 | 3300010046 | Tropical Forest Soil | MSPKRFIPAVIAGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0126384_116086272 | 3300010046 | Tropical Forest Soil | MSLRQFIPAVIVGLLVAALLLWFTLGWLLDAITLPVG* |
Ga0126382_119223661 | 3300010047 | Tropical Forest Soil | HRMSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0126373_110141552 | 3300010048 | Tropical Forest Soil | MSPKRFIPGVIAGLLLAALLLWLTLGWLLDAITLPAG* |
Ga0126373_120820381 | 3300010048 | Tropical Forest Soil | GDRMSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0126373_123037432 | 3300010048 | Tropical Forest Soil | MSLRQFIPAVIAGLLLAALLLWLTLGWLLNTITLPVG* |
Ga0126370_101246754 | 3300010358 | Tropical Forest Soil | MSPKRFIPAVIAGLLLAALLLWLTLGWLLDAITLPAG* |
Ga0126370_125109082 | 3300010358 | Tropical Forest Soil | MSLRQFILAVIVGLLLAALLLWLTLARLLDAITLPVG* |
Ga0126376_101265271 | 3300010359 | Tropical Forest Soil | VSLRQFILAVIVGLLLAALLLWLTLAWLLDAITLPVG* |
Ga0126378_103072561 | 3300010361 | Tropical Forest Soil | MSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPV |
Ga0126378_107382542 | 3300010361 | Tropical Forest Soil | MSLRQFIPAIIAGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0126378_130543732 | 3300010361 | Tropical Forest Soil | RMSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0126379_110916283 | 3300010366 | Tropical Forest Soil | MSLRQFIPAVIVGLLLATLLLWLTLGWLLDAITLPVG* |
Ga0126379_119424823 | 3300010366 | Tropical Forest Soil | MSPKRFIPAVIAGLLVAALLLWLTLGWLLDAITLPAG* |
Ga0126379_121143051 | 3300010366 | Tropical Forest Soil | MSLWQFIPAVIAGLLLAALLLWFTLGWLLTTITLPVG* |
Ga0126381_1002527251 | 3300010376 | Tropical Forest Soil | MSLKQFIPAVIVGLLLAALLLWLTLGWLLNAITLPVG* |
Ga0126381_1003542781 | 3300010376 | Tropical Forest Soil | HHASHHMSLRQFIPAVIVGLLLAALLLWLALGWLLDAITLPVG* |
Ga0126381_1005134784 | 3300010376 | Tropical Forest Soil | MSLKRFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0126381_1012864161 | 3300010376 | Tropical Forest Soil | RMSPKRFIPAVIAGLLVAALLLWLTLGWLLDAITLPAG* |
Ga0126381_1039515332 | 3300010376 | Tropical Forest Soil | MSLRQFIPAVIVGLLLTALLLWLTLGWLLDAITLPVG* |
Ga0126383_103583532 | 3300010398 | Tropical Forest Soil | MSLRHFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG* |
Ga0126383_105047873 | 3300010398 | Tropical Forest Soil | MNLRSFIPAVIVGLLLAALLLWLTLGWLLDAITLSAG* |
Ga0124850_10369181 | 3300010863 | Tropical Forest Soil | KQFIPAVIVGLLVAALLLWFTLGWLLDAITLPVG* |
Ga0124850_11092901 | 3300010863 | Tropical Forest Soil | MSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLRVG* |
Ga0124844_12443381 | 3300010868 | Tropical Forest Soil | MSLRQFILAVTAGLLLSALLLWLTLARLLDAITLPAG* |
Ga0150983_150452302 | 3300011120 | Forest Soil | MSLRQFIPAIIVGLLLAALLLWLTLAWLLDAITLPVG* |
Ga0137377_110828682 | 3300012211 | Vadose Zone Soil | MSLKHFIPAVIVGLLVAALLLWLTLGWLLNAITLPVG* |
Ga0164303_104079601 | 3300012957 | Soil | MSLRQFIPAIIVGLLLASLLLWLTLAWLLDAITIPVG* |
Ga0126369_104167664 | 3300012971 | Tropical Forest Soil | LIREQFIPAVIVGLLLAALLLWLTLGWLLDAITLPAG* |
Ga0126369_111650161 | 3300012971 | Tropical Forest Soil | MSLRQFIPVVIVGLLLAALLLWLTLAWLLDAITLPVG* |
Ga0126369_111935562 | 3300012971 | Tropical Forest Soil | MSLRHFIPAVIAGLLLAAVPLWLTLDWLLNAITMPVG* |
Ga0126369_134135072 | 3300012971 | Tropical Forest Soil | MSPRQFFIPAVIVGLLLAALLLSLTLGWLLDAITL |
Ga0182041_100525114 | 3300016294 | Soil | LRQFILAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0182041_101519745 | 3300016294 | Soil | MTAVIVGLLLAALLLWLTLGWLLDAITLPVGWRRVCPPSIVDIA |
Ga0182033_100910761 | 3300016319 | Soil | ESHRMSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITMPVG |
Ga0182032_108138891 | 3300016357 | Soil | RHEHRSARCMSLKQFIPAVIVGLLVAVLLLWLTLGWLLDAITLPVG |
Ga0182032_109946062 | 3300016357 | Soil | ESHRMSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLPVG |
Ga0182034_100880893 | 3300016371 | Soil | VRSFTNSHRMSLRQFIPAVIAGLLLAALLLWLTLGWLLHAITLPVG |
Ga0182034_102167522 | 3300016371 | Soil | HESHRMSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITMPVG |
Ga0182034_102903551 | 3300016371 | Soil | MSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLPV |
Ga0182034_113738151 | 3300016371 | Soil | CMSLKQFIPAVIVGLLVAALLLWLTLGWLLDAITLPVG |
Ga0182034_116749291 | 3300016371 | Soil | MGLKQFIPAVIVGLLLAALLLWLTLGWLLDAITLPV |
Ga0182037_101598123 | 3300016404 | Soil | LRQFIPAVIAGLLLAALLLWLTLGWLLHAITLPVG |
Ga0182037_102235141 | 3300016404 | Soil | VIVGLLLAALLLWLTLGWLLDAITLPVGWRRVCPPSIVDIA |
Ga0182037_115175862 | 3300016404 | Soil | MNSHRMSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLPVG |
Ga0182038_101762355 | 3300016445 | Soil | HRMSRRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVGWRRVCPPSIVDIA |
Ga0126371_101753935 | 3300021560 | Tropical Forest Soil | VSLRQFILAVIVGLLLAALLLWLTLAWLLDAITLPVG |
Ga0126371_102950321 | 3300021560 | Tropical Forest Soil | MSLRQFLPAVIAGLLLAALLLWLTLGWLLDAITLPVG |
Ga0126371_115334963 | 3300021560 | Tropical Forest Soil | MSLKQFIPAVIVGLLVAALLLWFTLGWLLDAITLPVG |
Ga0126371_136410111 | 3300021560 | Tropical Forest Soil | MSLRQFIPVVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0207700_114772592 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLRQFIPAIIVGLLLAALLLWLTLAWLLDAITLPVG |
Ga0318516_102259922 | 3300031543 | Soil | MSLKQFIPAVIVGLLVAALLLWLTLGWLLDAITLPVG |
Ga0318541_102973811 | 3300031545 | Soil | MSLRHFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0318573_102596141 | 3300031564 | Soil | MGLKQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0318515_102066981 | 3300031572 | Soil | HRMSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLPVG |
Ga0310915_100315331 | 3300031573 | Soil | RFGCGVRSFTNSHRMSLRQFIPAVIAGLLLAALLLWLTLGWLLHAITLPVG |
Ga0310915_100542803 | 3300031573 | Soil | MSRRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVGWRRVCPPSIVDIA |
Ga0310915_101367392 | 3300031573 | Soil | MSLKQFIPAVIVGLLLAALLLWLTLAWLLDAITLPVG |
Ga0310915_101861073 | 3300031573 | Soil | NSHRMSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLSVG |
Ga0310915_110769932 | 3300031573 | Soil | SLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLPVG |
Ga0306917_103080792 | 3300031719 | Soil | MSLRQFIPAVIVGLLLAALLLWLTLAWLLDAITLPVG |
Ga0306917_103918983 | 3300031719 | Soil | CMSLKQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0318500_105306191 | 3300031724 | Soil | LPQDVGDRMSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0318501_108380061 | 3300031736 | Soil | SARCMSLKQFIPAVIVGLLVAALLLWLTLGWLLDAITLPVG |
Ga0306918_104010951 | 3300031744 | Soil | DVDLCSLVMSLRHFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0306918_105873262 | 3300031744 | Soil | MSPRLFIPAVIVGLLLAALLLWLTLGWLLDAITLPAG |
Ga0306918_114032051 | 3300031744 | Soil | ARCMSLKQFIPAVIVGLLVAALLLWLTLGWLLDAITLPVG |
Ga0318554_105712571 | 3300031765 | Soil | LRHFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0318546_100493791 | 3300031771 | Soil | RMGLKQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0318547_106550632 | 3300031781 | Soil | MSLRQFILAVTAGLLLSALLLWLTLAWLLDAITLPVG |
Ga0318576_100865024 | 3300031796 | Soil | YRHRMSRRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0318512_105177402 | 3300031846 | Soil | LTCVRSFTSLRQFIPAVIAGLLLTALLLWLTLGWLLDAITLPV |
Ga0306919_100432602 | 3300031879 | Soil | MSLRQFILAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0306919_104181421 | 3300031879 | Soil | DLCSLVMSLRHFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0306925_100275456 | 3300031890 | Soil | MSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITMPVG |
Ga0306925_120201951 | 3300031890 | Soil | LKQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0306923_115974481 | 3300031910 | Soil | MSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLSVG |
Ga0306921_107698541 | 3300031912 | Soil | MSLKQFIPAVIVGLLVAALLLSLTLGWLLDAITLPVG |
Ga0310916_104669761 | 3300031942 | Soil | VFAMNSHRMSLRQFIPAAIAGLLLAALLLWLTLGWLLDAITLPVG |
Ga0310913_103545011 | 3300031945 | Soil | MSRRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVGWRRVC |
Ga0310913_112928241 | 3300031945 | Soil | HRVRHEHRSARCMSLKQFIPAVIVGLLVAVLLLWLTLGWLLDAITLPVG |
Ga0310910_109107371 | 3300031946 | Soil | RSARCMSLKQFIPAVIVGLLVAALLLWLTLGWLLDAITLPVG |
Ga0306922_103851981 | 3300032001 | Soil | AHRMGLKQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVG |
Ga0318507_100795592 | 3300032025 | Soil | SHRARHERRSARCMSLKQFIPAVIVGLLVAALLLWLTLGWLLDAITLPVG |
Ga0318559_103029501 | 3300032039 | Soil | TSLRQFIPAVIAGLLLTALLLWLTLGWLLDAITLPVG |
Ga0318532_100474601 | 3300032051 | Soil | ARHERRSARCMSLKQFIPAVIVGLLVAALLLWLTLGWLLDAITLPVG |
Ga0318506_104917211 | 3300032052 | Soil | MSRRQFIPAVIVGLLLAALLLWLTLGWLLDAITLPVGWRRVCPTSI |
Ga0318540_105581321 | 3300032094 | Soil | MSPRLFIPAVIVGLLLAALLLWLTLGWLLDAITLP |
Ga0306920_10001444811 | 3300032261 | Soil | MSLRQFIPAVIAGLLLAALLLWLTLGWLLHAITLPVG |
Ga0306920_1001815031 | 3300032261 | Soil | HRMSLRQFIPAVIAGLLLAALLLWLTLGWLLDAITMPVG |
Ga0306920_1026228951 | 3300032261 | Soil | MSLKQFIPAVIVGLLVAVLLLWLTLGWLLDAITLPVG |
Ga0306920_1031347392 | 3300032261 | Soil | MSLKQFIPAVIVGLLVAALLLWLTLGWLLDAITLP |
Ga0310914_101448311 | 3300033289 | Soil | ISLRQFIPAVIAGLLLAALLLWLTLGWLLDAITLPVG |
Ga0310914_103448532 | 3300033289 | Soil | MSLRQFIPAVIVGLLLAALLLWLTLGWLLDAITLSVG |
⦗Top⦘ |