Metagenome / Metatranscriptome Family F079453

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F079453
Family Type	Metagenome / Metatranscriptome
Number of Sequences	115
Average Sequence Length	39 residues
Representative Sequence	MRPLTARLEDGYCSITVANHQLITVIRFVVKSYTH
Number of Associated Samples	60
Number of Associated Scaffolds	115

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	31.31 %
% of genes near scaffold ends (potentially truncated)	86.09 %
% of genes from short scaffolds (< 2000 bps)	86.09 %
Associated GOLD sequencing projects	60
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (80.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (94.783 % of family members)
Environment Ontology (ENVO)	Unclassified (98.261 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (77.391 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 115 Family Scaffolds
PF05419	GUN4	0.87
PF02458	Transferase	0.87

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
All Organisms	root	All Organisms	20.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
cellular organisms	root	All Organisms → cellular organisms	20.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	19.13 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	18.26 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	18.26 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	18.26 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	17.39 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	16.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	16.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	16.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	15.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	15.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	15.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	15.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	15.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	15.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	14.78 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	14.78 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	13.04 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.87 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	13.04 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.87 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	11.30 %
Anthephorinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae	0.87 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	0.87 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	11.30 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	0.87 %
Digitaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria	0.87 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	10.43 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.87 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	0.87 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.87 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.00 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	10.43 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.87 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	0.87 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.87 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005843\|Ga0068860_102299275	Not Available	560	Open in IMG/M
3300009994\|Ga0105126_1041528	Not Available	567	Open in IMG/M
3300015270\|Ga0182183_1087029	Not Available	518	Open in IMG/M
3300015293\|Ga0182103_1065889	Not Available	586	Open in IMG/M
3300015293\|Ga0182103_1078132	Not Available	555	Open in IMG/M
3300015306\|Ga0182180_1046146	Not Available	650	Open in IMG/M
3300015310\|Ga0182162_1079466	Not Available	605	Open in IMG/M
3300015312\|Ga0182168_1016848	Not Available	1035	Open in IMG/M
3300015315\|Ga0182120_1063933	Not Available	678	Open in IMG/M
3300015317\|Ga0182136_1129964	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	520	Open in IMG/M
3300015317\|Ga0182136_1134400	Not Available	513	Open in IMG/M
3300015318\|Ga0182181_1055856	Not Available	647	Open in IMG/M
3300015318\|Ga0182181_1091542	Not Available	547	Open in IMG/M
3300015318\|Ga0182181_1101722	Not Available	527	Open in IMG/M
3300015319\|Ga0182130_1121397	Not Available	527	Open in IMG/M
3300015320\|Ga0182165_1134333	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	522	Open in IMG/M
3300015324\|Ga0182134_1059847	Not Available	710	Open in IMG/M
3300015324\|Ga0182134_1129272	Not Available	531	Open in IMG/M
3300015325\|Ga0182148_1029538	Not Available	881	Open in IMG/M
3300015327\|Ga0182114_1044528	Not Available	829	Open in IMG/M
3300015328\|Ga0182153_1112368	Not Available	569	Open in IMG/M
3300015329\|Ga0182135_1079509	Not Available	653	Open in IMG/M
3300015330\|Ga0182152_1039880	Not Available	835	Open in IMG/M
3300015330\|Ga0182152_1064567	Not Available	706	Open in IMG/M
3300015331\|Ga0182131_1018333	Not Available	1069	Open in IMG/M
3300015331\|Ga0182131_1041165	Not Available	830	Open in IMG/M
3300015331\|Ga0182131_1078569	Not Available	660	Open in IMG/M
3300015331\|Ga0182131_1129671	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	542	Open in IMG/M
3300015332\|Ga0182117_1025780	Not Available	1034	Open in IMG/M
3300015332\|Ga0182117_1092985	Not Available	650	Open in IMG/M
3300015333\|Ga0182147_1062316	Not Available	749	Open in IMG/M
3300015333\|Ga0182147_1074564	Not Available	701	Open in IMG/M
3300015333\|Ga0182147_1094848	Not Available	639	Open in IMG/M
3300015333\|Ga0182147_1151996	Not Available	527	Open in IMG/M
3300015334\|Ga0182132_1021478	Not Available	1074	Open in IMG/M
3300015334\|Ga0182132_1097118	Not Available	635	Open in IMG/M
3300015334\|Ga0182132_1110130	Not Available	603	Open in IMG/M
3300015334\|Ga0182132_1155579	Not Available	521	Open in IMG/M
3300015335\|Ga0182116_1104615	Not Available	636	Open in IMG/M
3300015337\|Ga0182151_1069974	Not Available	706	Open in IMG/M
3300015337\|Ga0182151_1089307	Not Available	645	Open in IMG/M
3300015339\|Ga0182149_1013973	Not Available	1236	Open in IMG/M
3300015339\|Ga0182149_1077324	Not Available	700	Open in IMG/M
3300015340\|Ga0182133_1071799	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	757	Open in IMG/M
3300015348\|Ga0182115_1036584	Not Available	1373	Open in IMG/M
3300015348\|Ga0182115_1096469	Not Available	925	Open in IMG/M
3300015348\|Ga0182115_1102460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	900	Open in IMG/M
3300015348\|Ga0182115_1104005	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	893	Open in IMG/M
3300015348\|Ga0182115_1108333	Not Available	876	Open in IMG/M
3300015348\|Ga0182115_1123494	Not Available	822	Open in IMG/M
3300015348\|Ga0182115_1225591	All Organisms → cellular organisms → Eukaryota	598	Open in IMG/M
3300015349\|Ga0182185_1109434	Not Available	800	Open in IMG/M
3300015349\|Ga0182185_1247329	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	543	Open in IMG/M
3300015350\|Ga0182163_1277755	Not Available	525	Open in IMG/M
3300015350\|Ga0182163_1282068	Not Available	520	Open in IMG/M
3300015352\|Ga0182169_1074436	Not Available	1060	Open in IMG/M
3300015352\|Ga0182169_1127896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	823	Open in IMG/M
3300015352\|Ga0182169_1147937	Not Available	766	Open in IMG/M
3300015353\|Ga0182179_1163222	Not Available	699	Open in IMG/M
3300015353\|Ga0182179_1295038	Not Available	527	Open in IMG/M
3300015353\|Ga0182179_1327659	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	500	Open in IMG/M
3300015354\|Ga0182167_1060716	Not Available	1323	Open in IMG/M
3300015354\|Ga0182167_1101855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1050	Open in IMG/M
3300015354\|Ga0182167_1186436	Not Available	761	Open in IMG/M
3300015354\|Ga0182167_1219287	Not Available	692	Open in IMG/M
3300015354\|Ga0182167_1233344	Not Available	667	Open in IMG/M
3300015354\|Ga0182167_1264489	Not Available	617	Open in IMG/M
3300017412\|Ga0182199_1069655	Not Available	760	Open in IMG/M
3300017414\|Ga0182195_1026159	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1097	Open in IMG/M
3300017414\|Ga0182195_1086710	Not Available	729	Open in IMG/M
3300017414\|Ga0182195_1124098	Not Available	636	Open in IMG/M
3300017432\|Ga0182196_1050685	Not Available	741	Open in IMG/M
3300017432\|Ga0182196_1062022	Not Available	692	Open in IMG/M
3300017435\|Ga0182194_1095643	Not Available	602	Open in IMG/M
3300017445\|Ga0182198_1013833	Not Available	1280	Open in IMG/M
3300026088\|Ga0207641_11699707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	633	Open in IMG/M
3300028151\|Ga0268308_1033649	Not Available	503	Open in IMG/M
3300032465\|Ga0214493_1119431	Not Available	621	Open in IMG/M
3300032466\|Ga0214503_1137669	Not Available	763	Open in IMG/M
3300032467\|Ga0214488_1015737	Not Available	1486	Open in IMG/M
3300032467\|Ga0214488_1108713	Not Available	597	Open in IMG/M
3300032467\|Ga0214488_1112738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	583	Open in IMG/M
3300032468\|Ga0214482_1010940	Not Available	1518	Open in IMG/M
3300032468\|Ga0214482_1057771	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	749	Open in IMG/M
3300032502\|Ga0214490_1026675	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	1241	Open in IMG/M
3300032514\|Ga0214502_1085290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1188	Open in IMG/M
3300032551\|Ga0321339_1011946	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1656	Open in IMG/M
3300032551\|Ga0321339_1078550	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	759	Open in IMG/M
3300032589\|Ga0214500_1089361	Not Available	872	Open in IMG/M
3300032589\|Ga0214500_1140824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	688	Open in IMG/M
3300032589\|Ga0214500_1186300	Not Available	588	Open in IMG/M
3300032757\|Ga0314753_1035486	Not Available	905	Open in IMG/M
3300032757\|Ga0314753_1075397	Not Available	600	Open in IMG/M
3300032791\|Ga0314748_1097656	Not Available	619	Open in IMG/M
3300032792\|Ga0314744_1090194	Not Available	584	Open in IMG/M
3300032823\|Ga0314723_1053920	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	770	Open in IMG/M
3300032844\|Ga0314743_1062456	Not Available	871	Open in IMG/M
3300032916\|Ga0314734_1036294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	984	Open in IMG/M
3300032916\|Ga0314734_1054708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	807	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.39%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.74%
Unclassified	Host-Associated → Plants → Unclassified	0.87%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.39%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.74%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	0.87%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.39%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.74%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	0.87%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	94.78%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	2.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.74%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	0.87%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032468	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032589	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032757	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032791	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032823	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032844	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068860_1022992752	3300005843	Switchgrass Rhizosphere	MRSLTARLEDSYCSITVANHQLITIIRFVVKSYTHP
Ga0105126_10415281	3300009994	Switchgrass Associated	TNLMRVLTTRLEDSYCSITITNHELITIIRFVAKSYAHL*
Ga0182183_10870291	3300015270	Switchgrass Phyllosphere	MRHLTARLEDGYCSITIANYRLITVIRFVAKSYTHP
Ga0182100_10185081	3300015280	Switchgrass Phyllosphere	TKLTLLLCKTNLMRPLTALLEDGYYSSTVANNELIRLIRFVAKSYTHL*
Ga0182103_10658891	3300015293	Switchgrass Phyllosphere	MKHLTARLEDSYCSITVANHRLITVIRFVVKSYTH
Ga0182103_10781321	3300015293	Switchgrass Phyllosphere	TLVTLKNLMRSLTTRLEDGYYNITVTNHQLITVVRFVAKNYTYL*
Ga0182180_10461461	3300015306	Switchgrass Phyllosphere	MKPLTARLEDGYCSITIANYRLITVIRFVAKSYTHP
Ga0182098_10196961	3300015309	Switchgrass Phyllosphere	NFRTPALVTLKNLMRPLTARLEDGYCSITIANHRLITVIRFVAKNYTHS*
Ga0182162_10591741	3300015310	Switchgrass Phyllosphere	MLVNLKNLIRPFTMRLEDGYYNITVANHQLITVIRFVVKSYTHP*
Ga0182162_10794661	3300015310	Switchgrass Phyllosphere	MRHVTAQLEDGYCSITVANHRLITIIRFVVKSYTHP
Ga0182168_10168481	3300015312	Switchgrass Phyllosphere	NLMRPLIARLEDRYCNITVVNNRLITVIRFIAKSYIYL*
Ga0182120_10639332	3300015315	Switchgrass Phyllosphere	ETNLIKPLTARLEDGYCSTTVANYELITVTRFVAKNYTHS*
Ga0182121_11328081	3300015316	Switchgrass Phyllosphere	FGTPALVTLKNLMRTLTVRLEDGYCSITVANQRLINVIRFVTKSYTHL*
Ga0182136_11299641	3300015317	Switchgrass Phyllosphere	RPLTARLEDGYCSITVANHRLITVIIFVVKSYTHP*
Ga0182136_11344001	3300015317	Switchgrass Phyllosphere	KNLMRPLTARFEDDYCSIIIAKHRLIIIIRFVAKS*
Ga0182181_10558561	3300015318	Switchgrass Phyllosphere	GTMKNLMRSLTVRLEDGYCSVTIANNRLIAVIRFVAKNYIHS*
Ga0182181_10915421	3300015318	Switchgrass Phyllosphere	PALVTLKNLMRSVTVRLEYGYCNITIANHQLITVVRFVSKSYTHP*
Ga0182181_11017221	3300015318	Switchgrass Phyllosphere	TLTARVEDGYCSIIIANHQLITVIRFVAKNYTHH*
Ga0182130_11213971	3300015319	Switchgrass Phyllosphere	MRHLTAVDDGYCSITVENRQLITVIRFVSKSYTYS
Ga0182165_11343332	3300015320	Switchgrass Phyllosphere	MRFLAARLEDSYCSINVANHELITIIRFVAKNYTH
Ga0182134_10598471	3300015324	Switchgrass Phyllosphere	LMRASTACLEDDYCIITVANYGLITAIRFVAKSYTHL*
Ga0182134_11292722	3300015324	Switchgrass Phyllosphere	MRSLTARLEDGYCSITVVNHRLITIIRFVVKNYTTREK
Ga0182148_10295381	3300015325	Switchgrass Phyllosphere	LRETNLMRPLTARLEDDYCSINVANHRLITVIRFVVKSYTHP*
Ga0182114_10445281	3300015327	Switchgrass Phyllosphere	MRSLTARLEDGYCSITITNHQLITVIRFVAKSYTHP
Ga0182153_11123681	3300015328	Switchgrass Phyllosphere	MTLKNLMRPLNARLEDGYCSITVANHRLITVIRFVAKSYTH
Ga0182135_10795091	3300015329	Switchgrass Phyllosphere	MRPLTVRFEDGYCSITVANHQLITIIRFVVKSYTHP
Ga0182152_10398801	3300015330	Switchgrass Phyllosphere	AVVNLKNLIKPLTALLEDGYYSITVSNHQLITVIRFVAKNYTYL*
Ga0182152_10645671	3300015330	Switchgrass Phyllosphere	LFRETNLMMSLTVRLEDRYCSITVANHELIIIIRFVAKNYTHP*
Ga0182131_10183331	3300015331	Switchgrass Phyllosphere	RHLTVWLENGYYTIAVVNHRLITVIRFVAKNYNHL*
Ga0182131_10411651	3300015331	Switchgrass Phyllosphere	NPALVILKNLTRPLTARLEDGYCSIIVANYQLIIVIRFVAKSYTHP*
Ga0182131_10785691	3300015331	Switchgrass Phyllosphere	MRPLTARLEDGYCSITVANHRLITVIRFIVKSYTHL
Ga0182131_11296712	3300015331	Switchgrass Phyllosphere	MQFTKPTSVILKNLIKSLTVRLENDYCSITVSNYRLITVIRFVEKSY
Ga0182117_10257801	3300015332	Switchgrass Phyllosphere	LVTLKNLMRSLTARLEDGYCSINVANHRLITVIRFVAKSYTHP*
Ga0182117_10929851	3300015332	Switchgrass Phyllosphere	VTLKNLMRFLIVRLEDDYCSITVANHILIIIIRFVAKNYT
Ga0182147_10623161	3300015333	Switchgrass Phyllosphere	PFTVRLEDGYCSITAVNHRLITIIRFVVKSYTYP*
Ga0182147_10693001	3300015333	Switchgrass Phyllosphere	NFTISALLRKTNLMMPLTARLDDSYCSIAVADYELIIVIRFVAKSYTHP*
Ga0182147_10745642	3300015333	Switchgrass Phyllosphere	ETNIMRPLTARFEDGYCSITVANHRLITIIRFVVKNYTHP*
Ga0182147_10948481	3300015333	Switchgrass Phyllosphere	MMPLTARLEDSYCNITVANHRLITVIRFVAKSYTH
Ga0182147_11519961	3300015333	Switchgrass Phyllosphere	MALKNLTRSLTARLEDSYCSITVANHRLITVIRFVMKNY
Ga0182132_10214781	3300015334	Switchgrass Phyllosphere	MRPLTALEDGYYSITVVNHRLITVIRFVAKSYTNP
Ga0182132_10971181	3300015334	Switchgrass Phyllosphere	HLTAWFEDGYCSITVANYRLIIISRFIAKSYTHP*
Ga0182132_11101301	3300015334	Switchgrass Phyllosphere	CLEASYCSIIVSNHRLITVIRFVAKNYTHRENIL*
Ga0182132_11555791	3300015334	Switchgrass Phyllosphere	MKNLMRSLTVRLENDYFSITVANHQLITVVKFVMNSYTHP
Ga0182116_11046151	3300015335	Switchgrass Phyllosphere	MRASTACLEDDYCIITVANYGLITAIRFVAKSYTH
Ga0182151_10699742	3300015337	Switchgrass Phyllosphere	MTLKNLMRSLTVRLENGYFSITVTNHRLITVIKFVAKNY
Ga0182151_10893072	3300015337	Switchgrass Phyllosphere	MRLLTARLENDYCSITVANHRLITVIRFVAKSYIH
Ga0182149_10139732	3300015339	Switchgrass Phyllosphere	TLKNLITRPLTARLENSYCSINVANYLLITVIRFVAKSYTHP*
Ga0182149_10773241	3300015339	Switchgrass Phyllosphere	MRPLTARLEDGYCSITVANHQLITVIRFVVKSYTH
Ga0182133_10717991	3300015340	Switchgrass Phyllosphere	VLVTLKNLMRNLTARLDDGYCSITVANYRLITVIRFVVKNY
Ga0182115_10365841	3300015348	Switchgrass Phyllosphere	MRPLTARLDDDYCSIIVSNHQLITVIKFISKSYAH
Ga0182115_10964691	3300015348	Switchgrass Phyllosphere	VLVALKNLMRPLTMRLEDGYCSITVANHRLITVIR
Ga0182115_11024601	3300015348	Switchgrass Phyllosphere	ALGILKILMMPLTVRFEDVYCSITVPNRRLITVIRFVAKNYIHP*
Ga0182115_11040051	3300015348	Switchgrass Phyllosphere	MKNLMSPLTERLEDGYCSITVANYRLITIIRFVVK
Ga0182115_11083332	3300015348	Switchgrass Phyllosphere	MRPLTARLDVSYCSITVANPRLITVTRFVAKSYIH
Ga0182115_11234943	3300015348	Switchgrass Phyllosphere	VTFKNLMRYLTVRLEDGYYSITVVNHQLITVIKFVAQRYTHP*
Ga0182115_12255911	3300015348	Switchgrass Phyllosphere	KTNLMRPLTARLDDSYCSITVADYGLMTVIRFVAKSYTYP*
Ga0182185_11094341	3300015349	Switchgrass Phyllosphere	MSPLTARVEDGYCSITVTNHRLIIVIRFVAKNYTN
Ga0182185_12108572	3300015349	Switchgrass Phyllosphere	ANLMKSLTAQLEVGYIIVANHRLITVSKFVAKTYTYF*
Ga0182185_12473291	3300015349	Switchgrass Phyllosphere	MRPLTVRLEDGYCSITVANHRLITVIRFVVKNYTH
Ga0182163_10883151	3300015350	Switchgrass Phyllosphere	QNTALVTLKNLIRYLIVRLEDGYCSIYVANHRLITVIRFVAKNYTHL*
Ga0182163_11034751	3300015350	Switchgrass Phyllosphere	ETDLMRYLTARLEDGYCSITVANHRLIIVIRFVVKKVL*
Ga0182163_12777551	3300015350	Switchgrass Phyllosphere	IREINLMRLLTARLEDGSYSVTVANYELITDFRFVAKSYAHH*
Ga0182163_12820681	3300015350	Switchgrass Phyllosphere	MRSLTARLDDVYCSITVANHKLITIIRFIAKSYTH
Ga0182169_10744361	3300015352	Switchgrass Phyllosphere	MRLLTVRLENIYCSIIVANHRLITVIRFVAKNYIHP
Ga0182169_11278962	3300015352	Switchgrass Phyllosphere	ALVTLKNLMRPLTARLEDGYCSITIANYRLITVIRFVAKSYTHP*
Ga0182169_11479371	3300015352	Switchgrass Phyllosphere	HVLFRETNLMRPLTARLEVDYCSITVSNHQLITVIKFIAKSYTHP*
Ga0182179_10081923	3300015353	Switchgrass Phyllosphere	LRTLKNLMRFLIALLEHGYCSITVANHELITVIRFVVKSYIHL*
Ga0182179_11632221	3300015353	Switchgrass Phyllosphere	MRLLTARLEDGYCSITVANHRLITIIRFVVKSYTHP
Ga0182179_12950381	3300015353	Switchgrass Phyllosphere	MRPLTARLEDSYCSITVAYHRLIPIIRFAVKSYAYL
Ga0182179_13276592	3300015353	Switchgrass Phyllosphere	MRPLTARLEDGYCSITVVNHRLITVIRFVVKSYTH
Ga0182167_10607161	3300015354	Switchgrass Phyllosphere	MRALTARLEDGYCSITVSNHRLITIIRFVVKSYTH
Ga0182167_11018552	3300015354	Switchgrass Phyllosphere	MRFLAARLEDSYCSINVANHELITIIRFVAKSYTH
Ga0182167_11109491	3300015354	Switchgrass Phyllosphere	RTPALVTLKNLMSFLTARLEDGYCSITVVNHQSITVIRFVAKKL*
Ga0182167_11864361	3300015354	Switchgrass Phyllosphere	LRKTNLMRPLTARLDDSYCSITVADYGLITVIRFVAKNYTHP*
Ga0182167_12192871	3300015354	Switchgrass Phyllosphere	LRETNLMRPLTARLEDDYCIITVADHRLITIIRFVVKSYIHP*
Ga0182167_12333441	3300015354	Switchgrass Phyllosphere	TNLMRPLTERLEDGYCNITIANYRLITIIRFIVKIYTHR*
Ga0182167_12644891	3300015354	Switchgrass Phyllosphere	TNLMRPLTARLDDSYCSITVADYGLITVIRFVAKSYTHP*
Ga0182167_12909791	3300015354	Switchgrass Phyllosphere	RNPALVTLKNLMSPLTARLENGYCNITVVNHRLITVIRFVAKSYIYF*
Ga0182199_10696551	3300017412	Switchgrass Phyllosphere	PRVNRETNLMRPLTVRLEDGYYSITVANHRLITVIRFVAKIYTHP
Ga0182195_10261591	3300017414	Switchgrass Phyllosphere	MKPLTARLEDGYCSITVANHQLITIIRFVVKSYTH
Ga0182195_10867101	3300017414	Switchgrass Phyllosphere	MRHLTARLEDGYCSITVANHRLITVIRFVVKSYTH
Ga0182195_11240981	3300017414	Switchgrass Phyllosphere	TNLMRLLTARLEDSYYSITVVNHGLITVIRFVAKNYTHP
Ga0182201_11201301	3300017422	Switchgrass Phyllosphere	NFRTPALVTLKNLMRPLTARLEDGYCSITVANYRLITVIRFVVKSYTHP
Ga0182196_10506851	3300017432	Switchgrass Phyllosphere	KNLMRPLTVIRGWYCSITVANHRLITVIRFVEKSYTHL
Ga0182196_10620221	3300017432	Switchgrass Phyllosphere	NLMRPLTARLEDGYCSITVANNQLITVIRFVSKSYIRP
Ga0182194_10956432	3300017435	Switchgrass Phyllosphere	MRHLTVRLEDGYCSITVANYRLITVIRFVAKSYTHP
Ga0182198_10138331	3300017445	Switchgrass Phyllosphere	MRPLTARLEDGYCSITIANYRLITVIRFVVKNYTHP
Ga0207641_116997071	3300026088	Switchgrass Rhizosphere	VLVTLKNLMRPLTARLEDGYCNITIANYRLITVIRFIAKSY
Ga0268322_10125231	3300028049	Phyllosphere	TPALVILKNLMRPLTAQLEDGYWSITVANQRLINVIRLITKSYTHP
Ga0268308_10336491	3300028151	Phyllosphere	MRSLTARLEDGYCSITITNHQLITVIRFVAKSYTH
Ga0268310_10006461	3300028262	Phyllosphere	MLVTIKNLTRPLTARLEDGYCSITVVNNQLITVIRFVAKSYTHP
Ga0214493_11194311	3300032465	Switchgrass Phyllosphere	ETNLMKPLTARLEDVYCSVTIVTYGLIRLNRFVVKSYAHL
Ga0214503_11376692	3300032466	Switchgrass Phyllosphere	MRPLTARLEDNYCSITIANHRLITVIRFIAKSYTH
Ga0214488_10157371	3300032467	Switchgrass Phyllosphere	MRPLAARLEDGYCSVTVANHQLITVIRFVAKNYTHP
Ga0214488_11087132	3300032467	Switchgrass Phyllosphere	MKNLMRPLTARLEYSYCSITVANYRLIAVIRFVAKN
Ga0214488_11127381	3300032467	Switchgrass Phyllosphere	LHNPRVNRETNLMRPLTARLEDGYCSITVVNHQLITVIRFVAKSYIHS
Ga0214482_10109401	3300032468	Switchgrass Phyllosphere	VNRETNLMRPLTARLEDGYCSVTVANHQLITVIRFVAKSYIHP
Ga0214482_10214161	3300032468	Switchgrass Phyllosphere	NFRTLALVILKNLMRSLTERLENRYCSITVSNYRLLTVIRFVTKSYTHP
Ga0214482_10577712	3300032468	Switchgrass Phyllosphere	MTLKNLIRHLTMRLDDDYCSITVVNHQLIIVIRFVAKNYT
Ga0214490_10266751	3300032502	Switchgrass Phyllosphere	PVLVTLKNPMRSLTVRLEDAYCSITVANYRLIIVIRFVAKSYTHF
Ga0214502_10852902	3300032514	Switchgrass Phyllosphere	MKNLTRPLAARLEDGYCSVTVANHQLITVIRFVAKNY
Ga0321339_10119461	3300032551	Switchgrass Phyllosphere	MRPLAARLEDGYCIVTVANHQLITVIRFVAKNYTH
Ga0321339_10785501	3300032551	Switchgrass Phyllosphere	ALLTMKNLMKSLIVRLDDGYGSITVANHRLITVIRFITKSYTHP
Ga0214500_10893611	3300032589	Switchgrass Phyllosphere	KNLMRPLTARLEDGYCSITVANYRLITVIRFVVKSYIHP
Ga0214500_11408243	3300032589	Switchgrass Phyllosphere	LVTLKNLMRPLTARLEDGYCSITIANYRLITVIRFVAKSYTHP
Ga0214500_11863001	3300032589	Switchgrass Phyllosphere	MRSLTARLEDGYYRITVANHRLITVIRFVAKNYTVIRFVAK
Ga0314753_10354861	3300032757	Switchgrass Phyllosphere	MRHVTAKLEDVYCSITVANHRLITVIRFIAKSYTHP
Ga0314753_10753971	3300032757	Switchgrass Phyllosphere	MILKNLMKPLTARLDDGYGGITVANHQLITVIRFITKSYTI
Ga0314748_10976561	3300032791	Switchgrass Phyllosphere	MKNLMRPLAARLEDGYCSVAVANHQLITVIRFVAKNYTR
Ga0314744_10901941	3300032792	Switchgrass Phyllosphere	MRSLTARLDDVYCSITVANHKLITIIRFIAKSYTHF
Ga0314745_10823671	3300032812	Switchgrass Phyllosphere	VLVTLKNLMRSLTTRLEECYCSITVVNHRLINIIRFVTKNYT
Ga0314723_10539201	3300032823	Switchgrass Phyllosphere	MRPLTARLNDGYYSITVANNRLIAIIKFIAKNYIHS
Ga0314743_10624561	3300032844	Switchgrass Phyllosphere	TNLMRSLTVRSEDDYCSITVANHQLITIIRFVSKSYTNP
Ga0314734_10362941	3300032916	Switchgrass Phyllosphere	ETNLMRPLTARLEDGYCIITVANHRLITVIRFVAKNYIHL
Ga0314734_10547081	3300032916	Switchgrass Phyllosphere	KPLTARLDDGYGGITVANHQLITVIRFITKSYTILKKFYK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F079453

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences