| Basic Information | |
|---|---|
| Family ID | F079280 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KTKAKGGGLKLCNLGPNLRQALEIARLLPIFETCPTETAAVASF |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 87.07 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.931 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.724 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.621 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF14279 | HNH_5 | 3.45 |
| PF03544 | TonB_C | 2.59 |
| PF13751 | DDE_Tnp_1_6 | 1.72 |
| PF08974 | DUF1877 | 1.72 |
| PF05163 | DinB | 1.72 |
| PF02371 | Transposase_20 | 1.72 |
| PF07045 | DUF1330 | 1.72 |
| PF07885 | Ion_trans_2 | 1.72 |
| PF01226 | Form_Nir_trans | 1.72 |
| PF05598 | DUF772 | 1.72 |
| PF13432 | TPR_16 | 1.72 |
| PF04337 | DUF480 | 0.86 |
| PF00561 | Abhydrolase_1 | 0.86 |
| PF01850 | PIN | 0.86 |
| PF01408 | GFO_IDH_MocA | 0.86 |
| PF05228 | CHASE4 | 0.86 |
| PF02656 | DUF202 | 0.86 |
| PF02321 | OEP | 0.86 |
| PF00821 | PEPCK_GTP | 0.86 |
| PF01872 | RibD_C | 0.86 |
| PF00069 | Pkinase | 0.86 |
| PF12704 | MacB_PCD | 0.86 |
| PF02687 | FtsX | 0.86 |
| PF07883 | Cupin_2 | 0.86 |
| PF13505 | OMP_b-brl | 0.86 |
| PF05973 | Gp49 | 0.86 |
| PF00198 | 2-oxoacid_dh | 0.86 |
| PF00903 | Glyoxalase | 0.86 |
| PF04365 | BrnT_toxin | 0.86 |
| PF02604 | PhdYeFM_antitox | 0.86 |
| PF13426 | PAS_9 | 0.86 |
| PF03461 | TRCF | 0.86 |
| PF00491 | Arginase | 0.86 |
| PF05035 | DGOK | 0.86 |
| PF02472 | ExbD | 0.86 |
| PF00155 | Aminotran_1_2 | 0.86 |
| PF04191 | PEMT | 0.86 |
| PF04542 | Sigma70_r2 | 0.86 |
| PF13646 | HEAT_2 | 0.86 |
| PF01966 | HD | 0.86 |
| PF08818 | DUF1801 | 0.86 |
| PF07238 | PilZ | 0.86 |
| PF13518 | HTH_28 | 0.86 |
| PF00117 | GATase | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.45 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.59 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.72 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.72 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.72 |
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 1.72 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 1.72 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.86 |
| COG3322 | Extracellular (periplasmic) sensor domain CHASE (specificity unknown) | Signal transduction mechanisms [T] | 0.86 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.86 |
| COG3734 | 2-keto-3-deoxy-galactonokinase | Carbohydrate transport and metabolism [G] | 0.86 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.86 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.86 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.86 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.86 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.86 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.86 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.86 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.86 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.86 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.86 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.86 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.86 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.86 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.86 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.86 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.86 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.93 % |
| Unclassified | root | N/A | 12.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004631|Ga0058899_10114857 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300005175|Ga0066673_10591083 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005542|Ga0070732_10576337 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005555|Ga0066692_10798282 | Not Available | 581 | Open in IMG/M |
| 3300005556|Ga0066707_10017640 | All Organisms → cellular organisms → Bacteria | 3712 | Open in IMG/M |
| 3300005575|Ga0066702_10447954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300005576|Ga0066708_10294485 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005598|Ga0066706_10130942 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300005602|Ga0070762_10333217 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300006032|Ga0066696_10117620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1621 | Open in IMG/M |
| 3300006046|Ga0066652_100687974 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300006163|Ga0070715_10065275 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300006791|Ga0066653_10502951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300006914|Ga0075436_100378471 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 1023 | Open in IMG/M |
| 3300006954|Ga0079219_10510626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300009089|Ga0099828_10118436 | All Organisms → cellular organisms → Bacteria | 2311 | Open in IMG/M |
| 3300009089|Ga0099828_10224924 | Not Available | 1678 | Open in IMG/M |
| 3300010046|Ga0126384_11702489 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010301|Ga0134070_10321345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300010320|Ga0134109_10104599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300010321|Ga0134067_10469050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010358|Ga0126370_10036702 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
| 3300010359|Ga0126376_10352514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300010361|Ga0126378_13030624 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010376|Ga0126381_104757813 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010398|Ga0126383_10089717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2712 | Open in IMG/M |
| 3300011269|Ga0137392_10141545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1935 | Open in IMG/M |
| 3300011269|Ga0137392_10153144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1862 | Open in IMG/M |
| 3300011270|Ga0137391_10382542 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300012096|Ga0137389_10200187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1662 | Open in IMG/M |
| 3300012096|Ga0137389_10239021 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300012096|Ga0137389_10463883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1085 | Open in IMG/M |
| 3300012096|Ga0137389_10574101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300012363|Ga0137390_10432860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
| 3300012363|Ga0137390_11232025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300012918|Ga0137396_11006632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300012925|Ga0137419_11296566 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012929|Ga0137404_10070575 | All Organisms → cellular organisms → Bacteria | 2742 | Open in IMG/M |
| 3300012930|Ga0137407_11983290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 555 | Open in IMG/M |
| 3300014150|Ga0134081_10271491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300015264|Ga0137403_11364078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300016319|Ga0182033_11138984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300016387|Ga0182040_10918329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300016422|Ga0182039_10748533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300016445|Ga0182038_11741143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300017823|Ga0187818_10071456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1495 | Open in IMG/M |
| 3300017924|Ga0187820_1223030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300017955|Ga0187817_10039771 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
| 3300018085|Ga0187772_10222944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1273 | Open in IMG/M |
| 3300019278|Ga0187800_1554547 | Not Available | 608 | Open in IMG/M |
| 3300020579|Ga0210407_10349606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300020579|Ga0210407_11004198 | Not Available | 636 | Open in IMG/M |
| 3300020580|Ga0210403_10114018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2196 | Open in IMG/M |
| 3300020581|Ga0210399_10801578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300021088|Ga0210404_10644740 | Not Available | 603 | Open in IMG/M |
| 3300021168|Ga0210406_10166753 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1842 | Open in IMG/M |
| 3300021170|Ga0210400_10554950 | Not Available | 947 | Open in IMG/M |
| 3300021170|Ga0210400_10984344 | Not Available | 686 | Open in IMG/M |
| 3300021178|Ga0210408_10500429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 966 | Open in IMG/M |
| 3300021180|Ga0210396_11046732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300021401|Ga0210393_10693427 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300021405|Ga0210387_10337221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300021405|Ga0210387_10381780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1247 | Open in IMG/M |
| 3300021432|Ga0210384_11500330 | Not Available | 579 | Open in IMG/M |
| 3300021475|Ga0210392_10243379 | Not Available | 1271 | Open in IMG/M |
| 3300021475|Ga0210392_10304131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300021478|Ga0210402_10019941 | All Organisms → cellular organisms → Bacteria | 5747 | Open in IMG/M |
| 3300021478|Ga0210402_10153326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2100 | Open in IMG/M |
| 3300021478|Ga0210402_10170046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1993 | Open in IMG/M |
| 3300021478|Ga0210402_10247801 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1644 | Open in IMG/M |
| 3300021479|Ga0210410_10280776 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300024330|Ga0137417_1299684 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300025916|Ga0207663_11064006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300025922|Ga0207646_10323299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1394 | Open in IMG/M |
| 3300026340|Ga0257162_1029600 | Not Available | 672 | Open in IMG/M |
| 3300026475|Ga0257147_1042831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300026530|Ga0209807_1068837 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300026552|Ga0209577_10647528 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300026555|Ga0179593_1038846 | All Organisms → cellular organisms → Bacteria | 5314 | Open in IMG/M |
| 3300026557|Ga0179587_11089218 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026862|Ga0207724_1018553 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300026869|Ga0207821_1026925 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300027376|Ga0209004_1077177 | Not Available | 564 | Open in IMG/M |
| 3300027516|Ga0207761_1104219 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027748|Ga0209689_1063636 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300027812|Ga0209656_10058068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2154 | Open in IMG/M |
| 3300027842|Ga0209580_10423224 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300027857|Ga0209166_10464796 | Not Available | 652 | Open in IMG/M |
| 3300027862|Ga0209701_10010665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5999 | Open in IMG/M |
| 3300027862|Ga0209701_10050323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2675 | Open in IMG/M |
| 3300029636|Ga0222749_10169752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300031543|Ga0318516_10375187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300031564|Ga0318573_10819839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031573|Ga0310915_10382439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300031715|Ga0307476_10500370 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031718|Ga0307474_10315925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300031720|Ga0307469_10196253 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300031754|Ga0307475_10483726 | Not Available | 994 | Open in IMG/M |
| 3300031754|Ga0307475_11021107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300031763|Ga0318537_10348949 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031820|Ga0307473_10946506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300031823|Ga0307478_10029804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3925 | Open in IMG/M |
| 3300031823|Ga0307478_10411086 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300031879|Ga0306919_10844760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300031880|Ga0318544_10177123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300031890|Ga0306925_11005277 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031890|Ga0306925_11106288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300031942|Ga0310916_11390810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300031954|Ga0306926_12344326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300031962|Ga0307479_10372383 | Not Available | 1412 | Open in IMG/M |
| 3300031962|Ga0307479_11438779 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032076|Ga0306924_12454880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300032180|Ga0307471_100447621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1430 | Open in IMG/M |
| 3300032180|Ga0307471_101089331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300032783|Ga0335079_10726421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300033289|Ga0310914_10608571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026862 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058899_101148572 | 3300004631 | Forest Soil | KAKGGSLKLCHLRPKLREALEMARLLTIFETCPSETAAVASF* |
| Ga0066673_105910832 | 3300005175 | Soil | LIEMHRKTKAKGGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0070732_105763373 | 3300005542 | Surface Soil | KLCHLRPNLTRALEMARLLPIFETCPTETAAVASF* |
| Ga0066692_107982821 | 3300005555 | Soil | IEMHRKTKAKGGGLKLCHLRPKLRQALEMARLLPIYETAPSETAAVASF* |
| Ga0066707_100176405 | 3300005556 | Soil | EMHRKTKAKGGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0066702_104479542 | 3300005575 | Soil | GLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0066708_102944851 | 3300005576 | Soil | KTKAKGGGLKLCNLGPNLRQALEIARLLPIFETCPTETAAVASF* |
| Ga0066706_101309422 | 3300005598 | Soil | GGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0070762_103332173 | 3300005602 | Soil | MHRKTKAKGGGIKLCNLGPNLRQALEIARLLPIFETCPTEAAAVASF* |
| Ga0066696_101176203 | 3300006032 | Soil | GLGALIEMHRKTKAKGGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0066652_1006879741 | 3300006046 | Soil | IEMHRKTKAKGGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0070715_100652752 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GALIEMHRKTKAKGGGLKLCNLGPNLRQALDTARLLPIFETCPTETAAVASF* |
| Ga0066653_105029511 | 3300006791 | Soil | GGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0075436_1003784712 | 3300006914 | Populus Rhizosphere | ANGARLKLSNLGPKFKQALEVARLLPIFETCPTEAAALADF* |
| Ga0079219_105106261 | 3300006954 | Agricultural Soil | KTKAKGGRLMLAHLGPKLRQALEIARLLTMFETYASEADAVASAEA* |
| Ga0099828_101184361 | 3300009089 | Vadose Zone Soil | KGGSLKLCNLRPNLRQALEMARLLPIFETCPSETVAVASF* |
| Ga0099828_102249241 | 3300009089 | Vadose Zone Soil | LIEMHRKTKAKGGSLKLCHLRPNLRQALEMARLLPIFETCPSETAAVASF* |
| Ga0126384_117024891 | 3300010046 | Tropical Forest Soil | IEAHRQTKAKGGHLKLSNLGPNFRRALDLARLLPIFDTSSTETAAVSSF* |
| Ga0134070_103213451 | 3300010301 | Grasslands Soil | KGGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0134109_101045991 | 3300010320 | Grasslands Soil | GALIEAHRKTKAQGGRLKLSNLGPNFKQALELARLLTIFDTCPTEAAAVAGF* |
| Ga0134067_104690501 | 3300010321 | Grasslands Soil | KAKGGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0126370_100367021 | 3300010358 | Tropical Forest Soil | LIEMHRKTAAKGGRLVLSNLGPNLKRALEIARLLPIFETCPTEAAAVAVF* |
| Ga0126376_103525141 | 3300010359 | Tropical Forest Soil | EAHRKTKAKGGRLKLSNIGPNFKQALEVARLLTIFETCPTEASAIAGF* |
| Ga0126378_130306242 | 3300010361 | Tropical Forest Soil | GRLKLSNLGPNFKQALELARLLTIFETCPTEAAAVAGF* |
| Ga0126381_1047578132 | 3300010376 | Tropical Forest Soil | AKGGRLMLTNLRPNFRQALEMAKLLPIFETSPTEAAAVAAF* |
| Ga0126383_100897171 | 3300010398 | Tropical Forest Soil | KTKAKGGRLKLSNIGPNFKQALEVARLLTIFETCPTEAAAVAGF* |
| Ga0137392_101415451 | 3300011269 | Vadose Zone Soil | ALIEMHRKTKAKGGSLKLCNLRPNLRQALEMARLLPIFETSPSESVAVASF* |
| Ga0137392_101531441 | 3300011269 | Vadose Zone Soil | LIEMHRKTKAKGGSLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF* |
| Ga0137391_103825423 | 3300011270 | Vadose Zone Soil | LIEMQRKTKAKGGSLKLCHLRPNLTRALEMARLLPIFETCPTETAAVASF* |
| Ga0137389_102001871 | 3300012096 | Vadose Zone Soil | TKAKGGSLKLCHLRPNLRQALEMARLLPIFETCPSESVAVASF* |
| Ga0137389_102390214 | 3300012096 | Vadose Zone Soil | RKTKAKGGSLKLCNLRPNLRQALEMARLLPIFETSPSETAAVASF* |
| Ga0137389_104638831 | 3300012096 | Vadose Zone Soil | ALIEMHRKTKAKGGSLKLCHLRPNLRQALEMARLLPIFETSPSESVAVASF* |
| Ga0137389_105741012 | 3300012096 | Vadose Zone Soil | ALIEMHRKTKAKGGSLKLCHLRPNLRQALEMARLLPIFETCPTETAAVASF* |
| Ga0137390_104328601 | 3300012363 | Vadose Zone Soil | MQRKTKAKGGSLKLCHLRPNLTRALEMARLLPIFETCPTETAAVASF* |
| Ga0137390_112320251 | 3300012363 | Vadose Zone Soil | RKTKAKGGSLKLCHLRPNLTRALEMARLLPIFETCPTETAAVASF* |
| Ga0137396_110066321 | 3300012918 | Vadose Zone Soil | ALIEMHRKTKAKGGSLKLCHLRPNLRQALEMARLLPIFETCPSETAAVASF* |
| Ga0137419_112965661 | 3300012925 | Vadose Zone Soil | MQQKTKAKSGSLKLCNLRPNLRQALEMARLLPIFETCPTETAAVASF* |
| Ga0137404_100705753 | 3300012929 | Vadose Zone Soil | EIHRKTNAKGGRLVLANLGPKLRQALEMARLLPIFETHATETDAVGSF* |
| Ga0137407_119832901 | 3300012930 | Vadose Zone Soil | GLKLCNLRPNLRQALEIARLLPIFETCPNETAAVASF* |
| Ga0134081_102714911 | 3300014150 | Grasslands Soil | HRKTKAQGGRLKLSNLGPNFKQALELARLLTIFDTCPTEAAAVAGF* |
| Ga0137403_113640782 | 3300015264 | Vadose Zone Soil | QRKTKAKGGRLTLAHLGPKLKQALEMARLLPIFETFATESDAVGSF* |
| Ga0182033_111389842 | 3300016319 | Soil | LVLSNLGPNLKRALEIARLLPIFETCPTEAAAVAVF |
| Ga0182040_109183291 | 3300016387 | Soil | MHRKTAAKGGRLVLSNLGPNLKRALEIARLLPIFETCPTEAAAVAVF |
| Ga0182039_107485331 | 3300016422 | Soil | IEMHRKTAAKGGRLVLSNLGPNLKRALEIARLLPIFETCTTEAAAMAAF |
| Ga0182038_117411431 | 3300016445 | Soil | KTKAKGGRLMLSNLRPNFKHALEIARLLPIFETCPTEAAAVDSF |
| Ga0187818_100714561 | 3300017823 | Freshwater Sediment | LIEMHRKTKAKGGGLKLCNLGPNLRQALEIARLLPIFETCPTETAAVASF |
| Ga0187820_12230301 | 3300017924 | Freshwater Sediment | SHRKTKAKGGRLLLANLGPKLKQALEIARLLPIFETCATEADALASF |
| Ga0187817_100397715 | 3300017955 | Freshwater Sediment | LIESHRKTKAKGGRLLLTNLGPKLKQALELAGLLPLFETCATEADAVASF |
| Ga0187772_102229441 | 3300018085 | Tropical Peatland | TTKEKGGRLALCCLGRNFRQALEYAKLLPIFETFPNQDAAVQSFGA |
| Ga0187800_15545471 | 3300019278 | Peatland | RKTKAKGGRLMLSNLRPNLKHALEMSRLLPIFETSPTEDAAVASF |
| Ga0210407_103496061 | 3300020579 | Soil | GGGLKLCNLGPNLRQALEIARLLPIFETCPTETVAVASF |
| Ga0210407_110041981 | 3300020579 | Soil | KTKAKGGVLKLCNLGPNLRQALEIARLLPIFETCPTETAAVASF |
| Ga0210403_101140181 | 3300020580 | Soil | HRTTKAKGGRLVLAHLGPKLRQALEIARLLTLFETFATEADAVASF |
| Ga0210399_108015781 | 3300020581 | Soil | ALIEMHRKTKAKGGGLKLCNLGPNLRQALEIARLLPIFETCASETAAVASF |
| Ga0210404_106447401 | 3300021088 | Soil | IEMQRKTKAKGGGLKLCHLGPNLRQALEMARLLPIFETCPTETAAVASF |
| Ga0210406_101667531 | 3300021168 | Soil | THRKTKATGGRLALAHLGPKLKQALEIARLLTLFETFATEADAVASF |
| Ga0210400_105549501 | 3300021170 | Soil | AKGGRLVLAHLGPKLRQALEIARLLTIFETFAIEADAVASF |
| Ga0210400_109843442 | 3300021170 | Soil | AKGGRLTLCNLGPKFKQALQVVRLMDMFETFPTEAAAVESLGS |
| Ga0210408_105004292 | 3300021178 | Soil | KGGRLMLTNLGPKLRQALELAGLLTIFETCATEADAVARF |
| Ga0210396_110467322 | 3300021180 | Soil | IEMHRKTKAKGGNLKLCNLRPNLRQALEIARLLPIFETCPTETAAVASF |
| Ga0210393_106934271 | 3300021401 | Soil | RLLPTTRGPKLRQALEIARLLTLFETFATEADAVASF |
| Ga0210387_103372211 | 3300021405 | Soil | KLCNLGPNLRRALEMARLLPIFETCSSETAAVDSF |
| Ga0210387_103817801 | 3300021405 | Soil | ETQRKTKATGGRLALAHLGPKLKQALEIARLLTLFETFATEAEAVASF |
| Ga0210384_115003301 | 3300021432 | Soil | GRLMLTNLGPQLRQALEIAGLLTIFETCATEADGVARF |
| Ga0210392_102433791 | 3300021475 | Soil | RLALAHLGPKLKQALEIARLLTLFETFATEADAVASF |
| Ga0210392_103041311 | 3300021475 | Soil | TGGRLALAHLGPKLKQALEIARLLTLFETFATEADAVASF |
| Ga0210402_100199411 | 3300021478 | Soil | LLTNLGPKLRQALEIARLLTLFETFATEAEGVASF |
| Ga0210402_101533261 | 3300021478 | Soil | LIEMHRKTKAKGGALKLCHLGPNLRQALEMARLLPIFETCPTETAAVASF |
| Ga0210402_101700461 | 3300021478 | Soil | LIETHRKTKATGGRLALAHLGPKLKQALEIARLLTLFETFATEADAVASF |
| Ga0210402_102478011 | 3300021478 | Soil | ALIETHRKTKATGGRLALAHLGPKLKQALEIARLLTLFETFATEADAVASF |
| Ga0210410_102807762 | 3300021479 | Soil | HRKTKAKGGRLVLCSLGPKLRQALEIARLQPMFEISSTEAAAIASF |
| Ga0137417_12996843 | 3300024330 | Vadose Zone Soil | AKGGSLKLCHLRPNLTRALEMARLLPIFETCPTETAAVASF |
| Ga0207663_110640061 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TKANGARLKLSNLGPKFKQALEVARLLPIFETCPTESAAIASF |
| Ga0207646_103232992 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LIEMHRKTKAKGGGLKLCNLGPNLRRALEIARLLPIFETCPTETAAVASF |
| Ga0257162_10296001 | 3300026340 | Soil | TTKAKGGRLTLCNLGPKFKQALQVVRLIDMFETFPTEAAAVESLGL |
| Ga0257147_10428311 | 3300026475 | Soil | KIKAKGGRLMLANLGPKLRQALEIARLLPIFETYVTEAEAVASF |
| Ga0209807_10688372 | 3300026530 | Soil | EMHRKTKAKGGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF |
| Ga0209577_106475281 | 3300026552 | Soil | RKTKAKGGGLKLCHLGPKLRQALEMARLLPIFETCPSETAAVASF |
| Ga0179593_10388466 | 3300026555 | Vadose Zone Soil | MQQKTKAKSGSLKLCNLRPNLRQALEMARLLPIFETCPTETAAVASF |
| Ga0179587_110892181 | 3300026557 | Vadose Zone Soil | QRKTKAKGGRLTLAHLGPKLKQALEMARLLPIFETFATETDAVGSF |
| Ga0207724_10185531 | 3300026862 | Tropical Forest Soil | LIETHRKTKAKGGRFLLCHMGPKLTKALELARLMPIFETSPNEAAAVASL |
| Ga0207821_10269251 | 3300026869 | Tropical Forest Soil | QERALIETHRKTKAKGGRFLLCHMGPKLTKALELARLMPIFETSPNEAAAVASL |
| Ga0209004_10771772 | 3300027376 | Forest Soil | RKAKAKGGHMKLTNLGPKLKQALEISRLLPLFETCATEAAAIASF |
| Ga0207761_11042192 | 3300027516 | Tropical Forest Soil | GKLKLCNLRPNLKQALEIARLLPIFDTCPTESDAMSSF |
| Ga0209689_10636361 | 3300027748 | Soil | TKAKGGGLKLCHLRPNLKQALEMARLLPIFETCPSETAAVASF |
| Ga0209656_100580683 | 3300027812 | Bog Forest Soil | LGALIEMHRKTKAKEGGGLKLCNLGPNLRQALEIARLLPIFETCPTETAAVASF |
| Ga0209580_104232242 | 3300027842 | Surface Soil | MSAGLGALIEMQRKTKAKGGSLKHCHLRPNLLRALEMARLLPIFETCPTETAAVASF |
| Ga0209166_104647961 | 3300027857 | Surface Soil | GRLMLANLGPKLRQALEMARLLPIFETYATETEAVASF |
| Ga0209701_100106651 | 3300027862 | Vadose Zone Soil | AKGGGLKLCNLGPNLRQALEIARLLPIFETCPTETAAVASF |
| Ga0209701_100503231 | 3300027862 | Vadose Zone Soil | AKGGGLKLCNLGPNLRQALEIARLLPIFETCPTETAAIASF |
| Ga0222749_101697522 | 3300029636 | Soil | GGLKLCNLGPNLRQALEIARLMPIFDTSPTETAAVASF |
| Ga0318516_103751871 | 3300031543 | Soil | GGRLVLSNLGPNLKRALEIARLLPIFETCPTEAAAVAVF |
| Ga0318573_108198392 | 3300031564 | Soil | HRKTAAKGGRLVLSNLGPNLKRALEIARLLPIFETCPTEAAAVAVF |
| Ga0310915_103824393 | 3300031573 | Soil | MHRKTAAKGGRLVLSNLGPNLKRALEIARLLPIFETCTTEAAAMAAF |
| Ga0307476_105003701 | 3300031715 | Hardwood Forest Soil | LGALIELHRKTKAKGGGFKLCNLGPNLRQALEIARLLPIFETCPTETAALASF |
| Ga0307474_103159251 | 3300031718 | Hardwood Forest Soil | KAKGGGIKLCNLGPNLKRALEMARLMPIFETCSSETAAVASF |
| Ga0307469_101962533 | 3300031720 | Hardwood Forest Soil | KAKSGRLILTHLGPKLRQALELAGLLTIFETHATEADALARF |
| Ga0307475_104837262 | 3300031754 | Hardwood Forest Soil | MQRKTKAKGGGLKLCNLGPNLRQALEMARLLPIFETCATETAAVASF |
| Ga0307475_110211071 | 3300031754 | Hardwood Forest Soil | LGALIEMHRKTKAKGGGLKLCNLGPNLRQALDTARLLPIFETCPTETAAVARS |
| Ga0318537_103489492 | 3300031763 | Soil | IEAHRKTKAQGGRLKLSNIGPNFKQALEVARLLTIFETCPTEAAAVAGF |
| Ga0307473_109465062 | 3300031820 | Hardwood Forest Soil | LGALIEMHRKTKAKGGGLKLCHLRPNLRQALEMARLLPIFETCPSETAAVASF |
| Ga0307478_100298041 | 3300031823 | Hardwood Forest Soil | GALIEMQRKTKAKGGSLKLCHLRPNLTRALEMARLLPIFETCATETAAVASF |
| Ga0307478_104110862 | 3300031823 | Hardwood Forest Soil | EMHRKTKAQGAGLKLCNLGPNLRNALEIARLLPIFETFPTETVAIASF |
| Ga0306919_108447601 | 3300031879 | Soil | GLGALIEAHRITKAKRGRLKLCDLGPQFRQALELARLLPIFETFPTEAAAVESPWS |
| Ga0318544_101771231 | 3300031880 | Soil | IEMHRKTAAKGGRLVLSNLGPNLKRALEIARLLPIFETCPTEAAAVAVF |
| Ga0306925_110052771 | 3300031890 | Soil | LLCHLGPKLKQALELARLLPLFETSPTEEAAMASF |
| Ga0306925_111062881 | 3300031890 | Soil | LGALIEMHRKTAAKGGRLVLSNLGPNLKRALEIARLLPIFETCTTEAAAMAAF |
| Ga0310916_113908101 | 3300031942 | Soil | LVLSNLGPNLKRALEIAQLLPIFETCPTEAAAVAVF |
| Ga0306926_123443261 | 3300031954 | Soil | KLCDLGPQFRQALELARLLPIFETFPTEAAAVESPWS |
| Ga0307479_103723831 | 3300031962 | Hardwood Forest Soil | GTLIEMQRKTKAKSGSLKLCHLRPNLKQALEMARLLPLFETCPSETAAVASF |
| Ga0307479_114387792 | 3300031962 | Hardwood Forest Soil | TKAKGGGLKLCNLGPNLRQALEIARLLPIFETCPTETVAVASF |
| Ga0306924_124548801 | 3300032076 | Soil | GALIEAHRTTKANGGRLALCSLGPNFRQALEFARLLPIFEIFPNEAAAVRSFES |
| Ga0307471_1004476212 | 3300032180 | Hardwood Forest Soil | GGRLMLTNLGPKLRQALEIARLLTIFETFATEADAVASL |
| Ga0307471_1010893312 | 3300032180 | Hardwood Forest Soil | EMQRKTKAKGGSLKLCHLRPNLTRALEMARLLPIFDTCPTETAAVASF |
| Ga0335079_107264211 | 3300032783 | Soil | GGRLMLTNLRPNLRKALELSRLLPIFETSPTEDAAVASF |
| Ga0310914_106085711 | 3300033289 | Soil | GALIEMHRKTAAKGGRLVLSNLGPNLKRALEIARLLPIFETCPTEAAAVAVF |
| ⦗Top⦘ |