| Basic Information | |
|---|---|
| Family ID | F079199 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDDE |
| Number of Associated Samples | 44 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 56.90 % |
| % of genes near scaffold ends (potentially truncated) | 14.66 % |
| % of genes from short scaffolds (< 2000 bps) | 79.31 % |
| Associated GOLD sequencing projects | 35 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (38.793 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (41.379 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.897 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.27% β-sheet: 0.00% Coil/Unstructured: 58.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF11211 | DUF2997 | 12.07 |
| PF01106 | NifU | 12.07 |
| PF00462 | Glutaredoxin | 4.31 |
| PF01259 | SAICAR_synt | 4.31 |
| PF01050 | MannoseP_isomer | 2.59 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.72 |
| PF02142 | MGS | 1.72 |
| PF11189 | DUF2973 | 1.72 |
| PF06868 | DUF1257 | 1.72 |
| PF13237 | Fer4_10 | 0.86 |
| PF01327 | Pep_deformylase | 0.86 |
| PF00551 | Formyl_trans_N | 0.86 |
| PF02672 | CP12 | 0.86 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.86 |
| PF12849 | PBP_like_2 | 0.86 |
| PF03796 | DnaB_C | 0.86 |
| PF00111 | Fer2 | 0.86 |
| PF04820 | Trp_halogenase | 0.86 |
| PF00127 | Copper-bind | 0.86 |
| PF04851 | ResIII | 0.86 |
| PF00923 | TAL_FSA | 0.86 |
| PF00504 | Chloroa_b-bind | 0.86 |
| PF01126 | Heme_oxygenase | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 12.07 |
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 4.31 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.86 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.86 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.86 |
| COG3230 | Heme oxygenase | Inorganic ion transport and metabolism [P] | 0.86 |
| COG5398 | Heme oxygenase | Coenzyme transport and metabolism [H] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.59 % |
| Unclassified | root | N/A | 22.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001958|GOS2232_1054918 | All Organisms → Viruses → Predicted Viral | 1606 | Open in IMG/M |
| 3300001964|GOS2234_1056077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1650 | Open in IMG/M |
| 3300005404|Ga0066856_10027572 | All Organisms → Viruses → Predicted Viral | 2474 | Open in IMG/M |
| 3300005404|Ga0066856_10519377 | Not Available | 506 | Open in IMG/M |
| 3300005430|Ga0066849_10217413 | All Organisms → Viruses → environmental samples → uncultured virus | 741 | Open in IMG/M |
| 3300005430|Ga0066849_10255921 | Not Available | 674 | Open in IMG/M |
| 3300005599|Ga0066841_10037193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 775 | Open in IMG/M |
| 3300005605|Ga0066850_10213290 | Not Available | 696 | Open in IMG/M |
| 3300006166|Ga0066836_10017292 | All Organisms → Viruses → Predicted Viral | 3997 | Open in IMG/M |
| 3300006166|Ga0066836_10034580 | All Organisms → Viruses → Predicted Viral | 2849 | Open in IMG/M |
| 3300006166|Ga0066836_10652430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Eurybiavirus | 637 | Open in IMG/M |
| 3300006327|Ga0068499_1220928 | Not Available | 751 | Open in IMG/M |
| 3300006327|Ga0068499_1568733 | Not Available | 590 | Open in IMG/M |
| 3300006565|Ga0100228_1024675 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
| 3300006565|Ga0100228_1196062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 988 | Open in IMG/M |
| 3300006751|Ga0098040_1049245 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300006751|Ga0098040_1072819 | All Organisms → Viruses | 1050 | Open in IMG/M |
| 3300006751|Ga0098040_1106930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 840 | Open in IMG/M |
| 3300006754|Ga0098044_1025982 | All Organisms → Viruses → Predicted Viral | 2596 | Open in IMG/M |
| 3300006754|Ga0098044_1045076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1894 | Open in IMG/M |
| 3300006789|Ga0098054_1018720 | All Organisms → Viruses → Predicted Viral | 2773 | Open in IMG/M |
| 3300006789|Ga0098054_1115338 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300006928|Ga0098041_1166097 | Not Available | 709 | Open in IMG/M |
| 3300006928|Ga0098041_1238029 | Not Available | 581 | Open in IMG/M |
| 3300009593|Ga0115011_10010159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6263 | Open in IMG/M |
| 3300009593|Ga0115011_10302866 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300009593|Ga0115011_11123409 | Not Available | 673 | Open in IMG/M |
| 3300009593|Ga0115011_11233370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 646 | Open in IMG/M |
| 3300009593|Ga0115011_12144061 | Not Available | 514 | Open in IMG/M |
| 3300009619|Ga0105236_1034174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 636 | Open in IMG/M |
| 3300009703|Ga0114933_10243913 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300009703|Ga0114933_10416173 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 879 | Open in IMG/M |
| 3300009790|Ga0115012_10254595 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300009790|Ga0115012_10631631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 852 | Open in IMG/M |
| 3300009790|Ga0115012_10717896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 803 | Open in IMG/M |
| 3300009790|Ga0115012_11226677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 632 | Open in IMG/M |
| 3300012950|Ga0163108_10052047 | All Organisms → Viruses → Predicted Viral | 2603 | Open in IMG/M |
| 3300012954|Ga0163111_11459892 | Not Available | 676 | Open in IMG/M |
| 3300020312|Ga0211542_1009794 | All Organisms → Viruses → Predicted Viral | 2348 | Open in IMG/M |
| 3300020312|Ga0211542_1037767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 928 | Open in IMG/M |
| 3300020312|Ga0211542_1044597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 832 | Open in IMG/M |
| 3300020312|Ga0211542_1054896 | Not Available | 730 | Open in IMG/M |
| 3300020312|Ga0211542_1058838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 698 | Open in IMG/M |
| 3300020345|Ga0211706_1038359 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1026 | Open in IMG/M |
| 3300020357|Ga0211611_1001459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5833 | Open in IMG/M |
| 3300020379|Ga0211652_10016780 | All Organisms → Viruses → Predicted Viral | 2197 | Open in IMG/M |
| 3300020394|Ga0211497_10045947 | All Organisms → Viruses → Predicted Viral | 1927 | Open in IMG/M |
| 3300020395|Ga0211705_10069729 | All Organisms → Viruses → environmental samples → uncultured virus | 1266 | Open in IMG/M |
| 3300020411|Ga0211587_10018378 | All Organisms → Viruses → Predicted Viral | 3535 | Open in IMG/M |
| 3300020411|Ga0211587_10018898 | All Organisms → Viruses → Predicted Viral | 3471 | Open in IMG/M |
| 3300020411|Ga0211587_10049882 | All Organisms → Viruses → Predicted Viral | 1915 | Open in IMG/M |
| 3300020411|Ga0211587_10050754 | All Organisms → Viruses → Predicted Viral | 1894 | Open in IMG/M |
| 3300020411|Ga0211587_10100406 | All Organisms → Viruses → Predicted Viral | 1257 | Open in IMG/M |
| 3300020411|Ga0211587_10107793 | Not Available | 1204 | Open in IMG/M |
| 3300020411|Ga0211587_10228511 | All Organisms → Viruses | 774 | Open in IMG/M |
| 3300020411|Ga0211587_10348413 | Not Available | 604 | Open in IMG/M |
| 3300020411|Ga0211587_10391349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 → Prochlorococcus phage P-SSM2 | 564 | Open in IMG/M |
| 3300020411|Ga0211587_10468721 | Not Available | 505 | Open in IMG/M |
| 3300020445|Ga0211564_10015534 | All Organisms → Viruses → Predicted Viral | 3775 | Open in IMG/M |
| 3300020445|Ga0211564_10039026 | All Organisms → Viruses → Predicted Viral | 2376 | Open in IMG/M |
| 3300020445|Ga0211564_10079841 | All Organisms → Viruses → Predicted Viral | 1631 | Open in IMG/M |
| 3300020445|Ga0211564_10145160 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
| 3300020445|Ga0211564_10169773 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300020445|Ga0211564_10445942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 634 | Open in IMG/M |
| 3300020470|Ga0211543_10027275 | All Organisms → Viruses → Predicted Viral | 3137 | Open in IMG/M |
| 3300020470|Ga0211543_10029743 | All Organisms → Viruses → Predicted Viral | 2987 | Open in IMG/M |
| 3300020470|Ga0211543_10037986 | All Organisms → Viruses → Predicted Viral | 2588 | Open in IMG/M |
| 3300020470|Ga0211543_10051986 | All Organisms → Viruses → Predicted Viral | 2164 | Open in IMG/M |
| 3300020470|Ga0211543_10063816 | All Organisms → Viruses → Predicted Viral | 1924 | Open in IMG/M |
| 3300020470|Ga0211543_10070111 | All Organisms → Viruses → Predicted Viral | 1822 | Open in IMG/M |
| 3300020470|Ga0211543_10102341 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300020470|Ga0211543_10114303 | All Organisms → Viruses | 1372 | Open in IMG/M |
| 3300020470|Ga0211543_10120180 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300020470|Ga0211543_10294727 | Not Available | 789 | Open in IMG/M |
| 3300020470|Ga0211543_10340359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 725 | Open in IMG/M |
| 3300020470|Ga0211543_10400866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 659 | Open in IMG/M |
| 3300020470|Ga0211543_10489072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 586 | Open in IMG/M |
| 3300020470|Ga0211543_10505036 | Not Available | 575 | Open in IMG/M |
| 3300020472|Ga0211579_10092334 | All Organisms → Viruses → Predicted Viral | 1822 | Open in IMG/M |
| 3300020472|Ga0211579_10195102 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
| 3300020472|Ga0211579_10531530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 662 | Open in IMG/M |
| 3300020472|Ga0211579_10723550 | Not Available | 553 | Open in IMG/M |
| 3300020478|Ga0211503_10423988 | Not Available | 710 | Open in IMG/M |
| 3300020478|Ga0211503_10592256 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED123 | 578 | Open in IMG/M |
| 3300020478|Ga0211503_10691260 | Not Available | 524 | Open in IMG/M |
| 3300025096|Ga0208011_1076362 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 738 | Open in IMG/M |
| 3300025103|Ga0208013_1096081 | All Organisms → Viruses | 751 | Open in IMG/M |
| 3300025110|Ga0208158_1005816 | All Organisms → Viruses → Predicted Viral | 3539 | Open in IMG/M |
| 3300025110|Ga0208158_1086383 | All Organisms → Viruses | 743 | Open in IMG/M |
| 3300026257|Ga0208407_1248639 | Not Available | 505 | Open in IMG/M |
| 3300026260|Ga0208408_1128812 | Not Available | 724 | Open in IMG/M |
| 3300026266|Ga0208410_1023745 | All Organisms → Viruses → Predicted Viral | 1934 | Open in IMG/M |
| 3300026321|Ga0208764_10050424 | All Organisms → Viruses → Predicted Viral | 2220 | Open in IMG/M |
| 3300027906|Ga0209404_10005335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 7288 | Open in IMG/M |
| 3300027906|Ga0209404_10204528 | All Organisms → Viruses | 1226 | Open in IMG/M |
| 3300027906|Ga0209404_10834726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 627 | Open in IMG/M |
| 3300029319|Ga0183748_1136687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 505 | Open in IMG/M |
| 3300031774|Ga0315331_10133139 | All Organisms → Viruses → Predicted Viral | 1852 | Open in IMG/M |
| 3300031774|Ga0315331_10412813 | Not Available | 986 | Open in IMG/M |
| 3300031774|Ga0315331_10762622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 678 | Open in IMG/M |
| 3300031775|Ga0315326_10428839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 856 | Open in IMG/M |
| 3300032006|Ga0310344_10006736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 8552 | Open in IMG/M |
| 3300032006|Ga0310344_10031487 | All Organisms → Viruses → Predicted Viral | 4185 | Open in IMG/M |
| 3300032006|Ga0310344_10367001 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300032006|Ga0310344_10496290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1047 | Open in IMG/M |
| 3300032006|Ga0310344_10727989 | Not Available | 844 | Open in IMG/M |
| 3300032006|Ga0310344_10857610 | Not Available | 768 | Open in IMG/M |
| 3300032006|Ga0310344_10939474 | All Organisms → Viruses → environmental samples → uncultured virus | 728 | Open in IMG/M |
| 3300032006|Ga0310344_10979762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 710 | Open in IMG/M |
| 3300032006|Ga0310344_11565631 | Not Available | 536 | Open in IMG/M |
| 3300032006|Ga0310344_11608058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 527 | Open in IMG/M |
| 3300032011|Ga0315316_10021958 | All Organisms → Viruses → Predicted Viral | 4918 | Open in IMG/M |
| 3300032011|Ga0315316_10321474 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300032011|Ga0315316_10592348 | All Organisms → Viruses → environmental samples → uncultured virus | 926 | Open in IMG/M |
| 3300032011|Ga0315316_10689328 | Not Available | 849 | Open in IMG/M |
| 3300032032|Ga0315327_10105878 | All Organisms → Viruses → Predicted Viral | 1734 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 41.38% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 33.62% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 8.62% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 7.76% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.45% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.72% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.86% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.86% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001958 | Marine microbial communities from Gulf of Mexico, USA - GS016 | Environmental | Open in IMG/M |
| 3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005599 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91A | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006327 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0125m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020345 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX556079-ERR599137) | Environmental | Open in IMG/M |
| 3300020357 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555950-ERR598956) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
| 3300026266 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2232_10549182 | 3300001958 | Marine | MIDTSWGSIRIALVMVMAVVWFYLLNMEIRSRDEED* |
| GOS2234_10560776 | 3300001964 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDEDDK* |
| Ga0066856_100275727 | 3300005404 | Marine | MTVAGTIDTSPSSIRMFAIIVMSVVWFYLLNVELRSSDDE* |
| Ga0066856_105193771 | 3300005404 | Marine | PRTSYSMIDTSPDSIRLFAIIVLGVIWFYLLNIELREGDD* |
| Ga0066849_102174132 | 3300005430 | Marine | MTILPGGTIDTSPSSLRTFAILVMGIIWFYLLNVELRNRDEDE* |
| Ga0066849_102559213 | 3300005430 | Marine | IHYRCYLVMIDTSPSSIRVALILVLVVVWFYLLNQHLRDEGED* |
| Ga0066841_100371933 | 3300005599 | Marine | GTEVYTRKMMGTIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDEDDK* |
| Ga0066850_102132903 | 3300005605 | Marine | GTIDTSPSSIRMFTVLVLGLVWFYLLNVELRSRDEE* |
| Ga0066836_1001729214 | 3300006166 | Marine | MIDTSPDSIRLFAIIVLGVIWFYLLNIELREGDD* |
| Ga0066836_100345805 | 3300006166 | Marine | MGTIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDEDDK* |
| Ga0066836_106524302 | 3300006166 | Marine | MIDTSWSSIRVALILVLGVIWFYLLNVELRSGDDD* |
| Ga0068499_12209281 | 3300006327 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDED |
| Ga0068499_15687333 | 3300006327 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDEEDK* |
| Ga0100228_10246755 | 3300006565 | Marine | MIDTSWGSIRIAIAMVLGVVWFYLLNEELRSRDKDD* |
| Ga0100228_11960621 | 3300006565 | Marine | MIDTSWGSIRIALAMILGVVWFYLLNEELRSRDKDD* |
| Ga0098040_10492455 | 3300006751 | Marine | MGMGTIDTSPSSIRMFTVLVLGLVWFYLLNVELRSRDEE* |
| Ga0098040_10728194 | 3300006751 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDDE* |
| Ga0098040_11069303 | 3300006751 | Marine | MIGTIDTSWSSIRVALIMIMGVVWFYLLNEQLRSGDD* |
| Ga0098044_10259826 | 3300006754 | Marine | MIDTSPSSIRVALIMVMGVVWFYLLNQYIREDNDE* |
| Ga0098044_10450763 | 3300006754 | Marine | MIATIDTSWSSIRVALIMVLGVIWFYLLNEQLRSGDD* |
| Ga0098054_10187207 | 3300006789 | Marine | MEEGKMIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDDE* |
| Ga0098054_11153384 | 3300006789 | Marine | MIATIDTSWSSIRVALIMVLGVIWFYLLNEQLRSGDDD* |
| Ga0098041_11660972 | 3300006928 | Marine | MIDTSPDSIRVFSILVLGVVWFYLLNEELKNRDKK* |
| Ga0098041_12380291 | 3300006928 | Marine | IMIDTSWESIRLFLIIVLGVVWFYFLNVELRSGDD* |
| Ga0115011_1001015911 | 3300009593 | Marine | MIDTSPDSIRMFAIIVLGVVWFYLLNVELRSRDDD* |
| Ga0115011_103028664 | 3300009593 | Marine | MEKGEMIDTSWSSIRVALIMVMAVIWFYLLNVELRSGDDE* |
| Ga0115011_111234092 | 3300009593 | Marine | MIDTSWSSIRIALVMVMAVVWFYLLNVELRSGDEDDK* |
| Ga0115011_112333702 | 3300009593 | Marine | SSSGFMIDTSWGSIRIALVMVMAVVWFYLLNVEIRSRDEED* |
| Ga0115011_121440612 | 3300009593 | Marine | MTGTIDTSPASIRMFAIIVLGVVWFYLLNMELRSSDDE* |
| Ga0105236_10341742 | 3300009619 | Marine Oceanic | MIDTSWSSIRIALVMVMAVIWFYLLNVELRSRNEEE* |
| Ga0114933_102439133 | 3300009703 | Deep Subsurface | MIDTSWSSIRVALIMVMAVLWFYLLNLELRSNDDDE* |
| Ga0114933_104161734 | 3300009703 | Deep Subsurface | MEKGEMIDTSWSSIRVALILVMAVIWFYLLNVELRSGDDE* |
| Ga0115012_102545953 | 3300009790 | Marine | MIATIDTSWTSIRVALIMVLGVIWFYLLNEQLRSGEDDD* |
| Ga0115012_106316312 | 3300009790 | Marine | MIDTSPDSIRVFSIIVLGVVWFYLLNEELKNRDKK* |
| Ga0115012_107178962 | 3300009790 | Marine | MIDTSPDSIRLFVIIVLGVVWFYLLNQELRNRDEE* |
| Ga0115012_112266772 | 3300009790 | Marine | VIDTSPESIRVALAMVLGVYWFYLLNVELRSRDEED* |
| Ga0163108_100520473 | 3300012950 | Seawater | MIDTSQSSIVYAIVMVMGVVWFYLLNVEIRSRDDDG* |
| Ga0163111_114598922 | 3300012954 | Surface Seawater | MIDTSPDSIRIFSIIVLGVVWFYLLNEELKNRDKK* |
| Ga0211542_10097943 | 3300020312 | Marine | MIDTSPSSIRMFLIIVMAVVWFYLLNVELRSGDDD |
| Ga0211542_10377673 | 3300020312 | Marine | MIDTSWGSIRIALVLIMGVVWFYLLNVEIRSREED |
| Ga0211542_10445972 | 3300020312 | Marine | MIDTSWSSIRVALIMVMAVIWFYLLNVELRSRDEEEDR |
| Ga0211542_10548963 | 3300020312 | Marine | MMATIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDDE |
| Ga0211542_10588382 | 3300020312 | Marine | MTGTIDTSPASIRMFAIIVLGVVWFYLLNVELRSRDDD |
| Ga0211706_10383595 | 3300020345 | Marine | VLIHMIDMSWSSIRVALIMVMAVVWFYLFNQYIRENEDE |
| Ga0211611_10014595 | 3300020357 | Marine | MIDTSPSSIRMFAILVLGVVWFYLLNTELRSRDDE |
| Ga0211652_100167805 | 3300020379 | Marine | MIDISPDSIRVFLIIVLSVLWFYLFNQEIGSNDED |
| Ga0211497_100459473 | 3300020394 | Marine | MIDTSPDSIRMFAIIVLGVVWFYLLNVELRSSDDD |
| Ga0211705_100697293 | 3300020395 | Marine | MIDTSWGSIRIALAMILGVVWFYLLNEELRSRDKDD |
| Ga0211587_100183785 | 3300020411 | Marine | MIDTSPDSIRMFAIIVLGVVWFYLLNQELRSKNSD |
| Ga0211587_100188988 | 3300020411 | Marine | MTLAAIDTSWSSIRVALIMILGVIWFYLLNEQLRSGDD |
| Ga0211587_100498822 | 3300020411 | Marine | MIDTSWSSIRMLLILVMGVIWFYLLNVELRSGDEDDK |
| Ga0211587_100507547 | 3300020411 | Marine | MIDTSWSSIRVALIMIMAVIWFYLLNVELRSRDEEE |
| Ga0211587_101004063 | 3300020411 | Marine | MIDTSPDSIRMFAIIVLGVVWFYILNVELRSRDDD |
| Ga0211587_101077933 | 3300020411 | Marine | MIDTSPSSIRAFVIIVLGVVWFYLLNQQLRENESNN |
| Ga0211587_102285112 | 3300020411 | Marine | MIDTSWGSIRVAAIMVMAVIWFYLLNVELRSRDEE |
| Ga0211587_103484131 | 3300020411 | Marine | CPSIMIDTSWSSIRVALIMVMAVIWFYLLNVELRSRDEEEDR |
| Ga0211587_103913493 | 3300020411 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSKNEDDK |
| Ga0211587_104687211 | 3300020411 | Marine | MIDTSWSSIRVALILVMGVVWFYLLNVELRSGDDE |
| Ga0211564_100155345 | 3300020445 | Marine | MTVAGTIDTSPSSIRMFAIIVMSVVWFYLLNVELRSSDDE |
| Ga0211564_100390265 | 3300020445 | Marine | MIDTSWSSIRVGLIMVLAVIWFYLLNVELRSNDED |
| Ga0211564_100798415 | 3300020445 | Marine | MIDTSPDSIRVFSIIVLGVVWFYLLNEELKNRDKK |
| Ga0211564_101451602 | 3300020445 | Marine | MIATIDTSWTSIRVALIMVLGVIWFYLLNEQLRSGDDD |
| Ga0211564_101697733 | 3300020445 | Marine | MIDTSPDSIRLFVIIVLGVVWFYLLNQELRNRDEE |
| Ga0211564_104459422 | 3300020445 | Marine | MIDTSPDSIRIFVIIVLGVVWFFLLNQYLRESEEDIK |
| Ga0211543_100272758 | 3300020470 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSRDED |
| Ga0211543_100297438 | 3300020470 | Marine | MIDTSPSSIRMFAVIVLGVVWFYLLNQHLRDGGED |
| Ga0211543_100379862 | 3300020470 | Marine | MTILPGGTIDTSPSSLRTFAILVMGIVWFYLLNVELRNRDEDE |
| Ga0211543_100519868 | 3300020470 | Marine | VIDTSWGSIRIALVMVMAVIWFYLLNVELRSRDEE |
| Ga0211543_100638165 | 3300020470 | Marine | MTILPGGTIDTSPSSLRTFAILVMGIIWFYLLNVELRSKDEE |
| Ga0211543_100701117 | 3300020470 | Marine | MMGTIDTSWSSIRIALVMVMAVVWFYLLNVELRSNDDE |
| Ga0211543_101023411 | 3300020470 | Marine | PVMIDTSQSSIVYAIVMVMGVVWFYLLNVEIRSRDEDE |
| Ga0211543_101143033 | 3300020470 | Marine | MVDLSPSSIRVALIMVMGVIWFYLLNVELRSRDDE |
| Ga0211543_101201802 | 3300020470 | Marine | MIDTSWSSIRIALILVMGVIWFYLLNVELRSGDDEDN |
| Ga0211543_102947272 | 3300020470 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSSDDDDK |
| Ga0211543_103403592 | 3300020470 | Marine | MIDTSWGSIRIALVMVMAVVWFYLLNVEIRSRDEED |
| Ga0211543_104008662 | 3300020470 | Marine | MIDTSWSSIRIALVLVMGVIWFYLLNVELRSGDEDDK |
| Ga0211543_104890722 | 3300020470 | Marine | MIDTSWSSIRVALIMIMAVVWFYLLNVELRSGDEDDK |
| Ga0211543_105050362 | 3300020470 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSRDDEDN |
| Ga0211579_100923343 | 3300020472 | Marine | MIGTIDTSWSSIRVALIIIMSVVWFYLLNVELRSGDDEE |
| Ga0211579_101951024 | 3300020472 | Marine | MIDTSPSSIRTFVIIVLGVVWFYLLNQELSNRDEE |
| Ga0211579_105315301 | 3300020472 | Marine | VIDTSPHSIRVALAMVLGVYWFYLLNVELRSRDEED |
| Ga0211579_107235502 | 3300020472 | Marine | MIATIDTSWTSIRVALIMVLGVIWFYLLNEQLRSGEDDD |
| Ga0211503_104239882 | 3300020478 | Marine | LMIDTSPSSIRMFLIIVMAVVWFYLLNVELRSGDDD |
| Ga0211503_105922562 | 3300020478 | Marine | MIDTSWGSIRIALVLIMAVIWFYLLNVELRSRDEE |
| Ga0211503_106912602 | 3300020478 | Marine | MGTIDTSWSSIRVALIMIMAVVWFYLLNVELRSNNDE |
| Ga0208011_10763622 | 3300025096 | Marine | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDDE |
| Ga0208013_10960813 | 3300025103 | Marine | MIATIDTSWSSIRVALIMVLGVIWFYLLNEQLRSGDDD |
| Ga0208158_10058162 | 3300025110 | Marine | MIDTSPDSIRVFSILVLGVVWFYLLNEELKNRDKK |
| Ga0208158_10863833 | 3300025110 | Marine | MIGTIDTSWSSIRVALIMIMGVVWFYLLNEQLRSGDD |
| Ga0208407_12486392 | 3300026257 | Marine | MTILPGGTIDTSPSSLRTFAILVMGIIWFYLLNVELRNRDEDE |
| Ga0208408_11288123 | 3300026260 | Marine | LYTRNLMGMGTIDTSPSSIRMFTVLVLGLVWFYLLNVELRSRDEE |
| Ga0208410_10237451 | 3300026266 | Marine | TIDTSPSSIRMFAIIVMSVVWFYLLNVELRSSDDE |
| Ga0208764_100504245 | 3300026321 | Marine | MMGTIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDEDDK |
| Ga0209404_1000533515 | 3300027906 | Marine | MIDTSPDSIRMFAIIVLGVVWFYLLNVELRSRDDD |
| Ga0209404_102045285 | 3300027906 | Marine | MIATIDTSWSSIRVALIMVLGVIWFYLLNEQLRSGDD |
| Ga0209404_108347262 | 3300027906 | Marine | MTGTIDTSPASIRMFAIIVLGVVWFYLLNMELRSSDDE |
| Ga0183748_11366872 | 3300029319 | Marine | MIDTSWGSIRIALVLIMAVIWFYLLNVELRSHDDE |
| Ga0315331_101331394 | 3300031774 | Seawater | MIDTSPDSIRIFSIIVLGVVWFFLLNQHLNESDNND |
| Ga0315331_104128132 | 3300031774 | Seawater | MIDTSWGSIRVLIAMILGVVWFYLLNEELRSRDED |
| Ga0315331_107626224 | 3300031774 | Seawater | SSMIDTSPDSIRLFAIIVLGVIWFYLLNIELREGDD |
| Ga0315326_104288391 | 3300031775 | Seawater | RIPMIDTSWGSIRVALIMVMAVLWFYLLNVELRSNDDDE |
| Ga0310344_1000673620 | 3300032006 | Seawater | MIDTSPESIRMFAILVLGVVWFYLLNVELRSRDDD |
| Ga0310344_1003148710 | 3300032006 | Seawater | MNLGTIDTSWSSIRVALIMIMAVVWFYLLNVELRSGDDDK |
| Ga0310344_103670011 | 3300032006 | Seawater | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDEDDK |
| Ga0310344_104962904 | 3300032006 | Seawater | MIDTSWSSIRVALIMVMAVVWFYLLNVELRSGDEEDK |
| Ga0310344_107279893 | 3300032006 | Seawater | YSRKMIDTSWSSIRVALIMVMAVIWFYLLNVELRSGDDDDK |
| Ga0310344_108576102 | 3300032006 | Seawater | MIDTSWSSIRIALVFVMGVVWFYLLNVELRSRDDDESN |
| Ga0310344_109394742 | 3300032006 | Seawater | MIDTSLGSIRIAIAMVLGVVWFYLLNEELRSRDKDD |
| Ga0310344_109797623 | 3300032006 | Seawater | MIDTSWSSIRVALIIVMAVVWFYLLNVELRSGDEEDK |
| Ga0310344_115656313 | 3300032006 | Seawater | MIQMGTIDTSWSSIRVALIMVMAVIWFYLLNIELRSNDEE |
| Ga0310344_116080583 | 3300032006 | Seawater | MIDTSWSSIRMFLIIVMGVVWFYLLNVELRSGDEDDK |
| Ga0315316_1002195817 | 3300032011 | Seawater | LQERIPMIDTSWGSIRVALIMVMAVLWFYLLNVELRSNDDDDE |
| Ga0315316_103214742 | 3300032011 | Seawater | MIDTSWSSIRVALILVMAVIWFYLLNVELRSGDDE |
| Ga0315316_105923482 | 3300032011 | Seawater | MIGTIDTSWSSIRVALIIIMAVVWFYLLNVELRSGDDEE |
| Ga0315316_106893282 | 3300032011 | Seawater | MIDTSWGSIRVALMLVMAVLWFYLLNVELRSEDDE |
| Ga0315327_101058782 | 3300032032 | Seawater | MIDTSWGSIRVALIMVMAVLWFYLLNVELRSNDDDDE |
| ⦗Top⦘ |