| Basic Information | |
|---|---|
| Family ID | F079178 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MTITPNTSQRDLVRLAVLMCGDRPGAKYSRPVKGTQNARNADPTRGFSR |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 50.86 % |
| % of genes near scaffold ends (potentially truncated) | 24.14 % |
| % of genes from short scaffolds (< 2000 bps) | 95.69 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.069 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.828 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.862 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.58% β-sheet: 0.00% Coil/Unstructured: 84.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF02469 | Fasciclin | 27.59 |
| PF08530 | PepX_C | 4.31 |
| PF05653 | Mg_trans_NIPA | 3.45 |
| PF06974 | WS_DGAT_C | 2.59 |
| PF13411 | MerR_1 | 2.59 |
| PF06114 | Peptidase_M78 | 2.59 |
| PF13538 | UvrD_C_2 | 1.72 |
| PF01904 | DUF72 | 0.86 |
| PF12833 | HTH_18 | 0.86 |
| PF14534 | DUF4440 | 0.86 |
| PF09348 | DUF1990 | 0.86 |
| PF11139 | SfLAP | 0.86 |
| PF13649 | Methyltransf_25 | 0.86 |
| PF02786 | CPSase_L_D2 | 0.86 |
| PF01266 | DAO | 0.86 |
| PF10604 | Polyketide_cyc2 | 0.86 |
| PF00015 | MCPsignal | 0.86 |
| PF06772 | LtrA | 0.86 |
| PF13361 | UvrD_C | 0.86 |
| PF00289 | Biotin_carb_N | 0.86 |
| PF00005 | ABC_tran | 0.86 |
| PF13360 | PQQ_2 | 0.86 |
| PF13604 | AAA_30 | 0.86 |
| PF07859 | Abhydrolase_3 | 0.86 |
| PF00571 | CBS | 0.86 |
| PF00400 | WD40 | 0.86 |
| PF04070 | DUF378 | 0.86 |
| PF00582 | Usp | 0.86 |
| PF00072 | Response_reg | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 27.59 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 4.31 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.72 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.86 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.86 |
| COG2155 | Uncharacterized membrane protein YuzA, DUF378 family | Function unknown [S] | 0.86 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.07 % |
| Unclassified | root | N/A | 37.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2422740 | Not Available | 681 | Open in IMG/M |
| 3300000787|JGI11643J11755_10862980 | Not Available | 624 | Open in IMG/M |
| 3300002568|C688J35102_117993537 | Not Available | 521 | Open in IMG/M |
| 3300002568|C688J35102_118382284 | Not Available | 554 | Open in IMG/M |
| 3300002568|C688J35102_120936507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2586 | Open in IMG/M |
| 3300003320|rootH2_10045304 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300003998|Ga0055472_10119943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 756 | Open in IMG/M |
| 3300004081|Ga0063454_100028833 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300004153|Ga0063455_100996916 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005329|Ga0070683_101535474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
| 3300005337|Ga0070682_101231176 | Not Available | 633 | Open in IMG/M |
| 3300005440|Ga0070705_101294354 | Not Available | 604 | Open in IMG/M |
| 3300005544|Ga0070686_101057933 | Not Available | 668 | Open in IMG/M |
| 3300005547|Ga0070693_100679308 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005578|Ga0068854_100627889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 920 | Open in IMG/M |
| 3300005614|Ga0068856_100649743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
| 3300005616|Ga0068852_101533071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300005719|Ga0068861_100910123 | Not Available | 834 | Open in IMG/M |
| 3300005937|Ga0081455_10123185 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300005981|Ga0081538_10071165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1915 | Open in IMG/M |
| 3300006046|Ga0066652_100474853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
| 3300006058|Ga0075432_10248426 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300006169|Ga0082029_1518466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 839 | Open in IMG/M |
| 3300006755|Ga0079222_11863099 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006806|Ga0079220_11632485 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006844|Ga0075428_100107240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 3045 | Open in IMG/M |
| 3300006847|Ga0075431_100624127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1060 | Open in IMG/M |
| 3300006871|Ga0075434_100766920 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300006914|Ga0075436_101512447 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009094|Ga0111539_10309405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1839 | Open in IMG/M |
| 3300009098|Ga0105245_13092575 | Not Available | 516 | Open in IMG/M |
| 3300009147|Ga0114129_11588658 | Not Available | 801 | Open in IMG/M |
| 3300009157|Ga0105092_10754094 | Not Available | 568 | Open in IMG/M |
| 3300009162|Ga0075423_10772722 | Not Available | 1016 | Open in IMG/M |
| 3300009789|Ga0126307_11455435 | Not Available | 555 | Open in IMG/M |
| 3300009840|Ga0126313_10392000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1101 | Open in IMG/M |
| 3300010038|Ga0126315_10283595 | Not Available | 1018 | Open in IMG/M |
| 3300010038|Ga0126315_10324781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 954 | Open in IMG/M |
| 3300010041|Ga0126312_11433530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 512 | Open in IMG/M |
| 3300010042|Ga0126314_10305604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1136 | Open in IMG/M |
| 3300010042|Ga0126314_10972136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
| 3300010044|Ga0126310_11651727 | Not Available | 530 | Open in IMG/M |
| 3300010045|Ga0126311_10152363 | Not Available | 1648 | Open in IMG/M |
| 3300010045|Ga0126311_10317996 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300010373|Ga0134128_11844768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 665 | Open in IMG/M |
| 3300010400|Ga0134122_10523875 | Not Available | 1078 | Open in IMG/M |
| 3300010401|Ga0134121_12321944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300010403|Ga0134123_11881330 | Not Available | 654 | Open in IMG/M |
| 3300011119|Ga0105246_12158248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 541 | Open in IMG/M |
| 3300012212|Ga0150985_102783442 | Not Available | 995 | Open in IMG/M |
| 3300012469|Ga0150984_117026508 | Not Available | 520 | Open in IMG/M |
| 3300012937|Ga0162653_100016219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
| 3300012961|Ga0164302_11045714 | Not Available | 640 | Open in IMG/M |
| 3300013308|Ga0157375_12116262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 670 | Open in IMG/M |
| 3300014325|Ga0163163_12556983 | Not Available | 568 | Open in IMG/M |
| 3300014326|Ga0157380_13024663 | Not Available | 536 | Open in IMG/M |
| 3300015371|Ga0132258_12823418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1209 | Open in IMG/M |
| 3300015371|Ga0132258_13691609 | Not Available | 1045 | Open in IMG/M |
| 3300015372|Ga0132256_101346259 | Not Available | 826 | Open in IMG/M |
| 3300015373|Ga0132257_102693163 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300015374|Ga0132255_103545171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300017792|Ga0163161_11519432 | Not Available | 588 | Open in IMG/M |
| 3300018422|Ga0190265_10029640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4523 | Open in IMG/M |
| 3300018422|Ga0190265_10297124 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300018422|Ga0190265_10355434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 1553 | Open in IMG/M |
| 3300018422|Ga0190265_11145338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
| 3300018429|Ga0190272_12906786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300018432|Ga0190275_11668817 | Not Available | 715 | Open in IMG/M |
| 3300018432|Ga0190275_13239717 | Not Available | 527 | Open in IMG/M |
| 3300018466|Ga0190268_12078359 | Not Available | 526 | Open in IMG/M |
| 3300018469|Ga0190270_10716181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 995 | Open in IMG/M |
| 3300018469|Ga0190270_10741694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 980 | Open in IMG/M |
| 3300018469|Ga0190270_10774733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 962 | Open in IMG/M |
| 3300018469|Ga0190270_12644890 | Not Available | 564 | Open in IMG/M |
| 3300018469|Ga0190270_13278200 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300022756|Ga0222622_10389140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 979 | Open in IMG/M |
| 3300025899|Ga0207642_10467972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 766 | Open in IMG/M |
| 3300025908|Ga0207643_10665736 | Not Available | 672 | Open in IMG/M |
| 3300025917|Ga0207660_10369329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1152 | Open in IMG/M |
| 3300025919|Ga0207657_10679761 | Not Available | 800 | Open in IMG/M |
| 3300025921|Ga0207652_10814518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300025933|Ga0207706_11385798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300025937|Ga0207669_11397898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae | 596 | Open in IMG/M |
| 3300025981|Ga0207640_11997354 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026067|Ga0207678_10206895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1678 | Open in IMG/M |
| 3300026067|Ga0207678_11741389 | Not Available | 547 | Open in IMG/M |
| 3300026089|Ga0207648_10456232 | Not Available | 1164 | Open in IMG/M |
| 3300027647|Ga0214468_1092977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300027880|Ga0209481_10704601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300027907|Ga0207428_10334965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1115 | Open in IMG/M |
| 3300027909|Ga0209382_10714216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
| 3300028705|Ga0307276_10127853 | Not Available | 633 | Open in IMG/M |
| 3300028722|Ga0307319_10069423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 1115 | Open in IMG/M |
| 3300028722|Ga0307319_10261767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 570 | Open in IMG/M |
| 3300028744|Ga0307318_10375316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 502 | Open in IMG/M |
| 3300028819|Ga0307296_10532566 | Not Available | 643 | Open in IMG/M |
| 3300028824|Ga0307310_10746558 | Not Available | 504 | Open in IMG/M |
| 3300030006|Ga0299907_11205303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300030785|Ga0102757_11263148 | Not Available | 620 | Open in IMG/M |
| 3300031548|Ga0307408_100344363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1263 | Open in IMG/M |
| 3300031731|Ga0307405_11449390 | Not Available | 602 | Open in IMG/M |
| 3300031824|Ga0307413_10505845 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300031824|Ga0307413_10795354 | Not Available | 794 | Open in IMG/M |
| 3300031824|Ga0307413_11053157 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031901|Ga0307406_10072302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2264 | Open in IMG/M |
| 3300031901|Ga0307406_10120720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1822 | Open in IMG/M |
| 3300031903|Ga0307407_10150844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1510 | Open in IMG/M |
| 3300031938|Ga0308175_100857967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
| 3300031996|Ga0308176_10572007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 1158 | Open in IMG/M |
| 3300032002|Ga0307416_100756204 | Not Available | 1065 | Open in IMG/M |
| 3300032002|Ga0307416_102647598 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300032004|Ga0307414_11295060 | Not Available | 676 | Open in IMG/M |
| 3300032004|Ga0307414_12310878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300032080|Ga0326721_10373724 | Not Available | 818 | Open in IMG/M |
| 3300032080|Ga0326721_10989008 | Not Available | 537 | Open in IMG/M |
| 3300032126|Ga0307415_102030415 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 11.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.48% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.86% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.86% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_24227402 | 3300000033 | Soil | MAAQTSNREACSMSLPPNTQQRDLVRLAVLVCGDRPGAKHRAPAKGVHNSSNVDPSRGYAR* |
| JGI11643J11755_108629802 | 3300000787 | Soil | MSITPNISQRELVRLAVLMCGDRSGAKSSKPVKGVHDSRNADPTRGFLR* |
| C688J35102_1179935372 | 3300002568 | Soil | MTITANTSQRDLVRLALLKCGDRPGAKYSKPVKGTHSSRNDDPTRGYAR* |
| C688J35102_1183822841 | 3300002568 | Soil | MTMQPNMKQRDLVRLAVLMCGDRPGAKYTRPAKGNHARSADPARGFHR* |
| C688J35102_1209365072 | 3300002568 | Soil | MTIKPNTSQRDLVRLAVLMCGDRPGAKYSKPVKGTQNARNADPSRGFSR* |
| rootH2_100453042 | 3300003320 | Sugarcane Root And Bulk Soil | MVRSAPRGDAPTMTIKANTTQRDLVRLAVLMCGDRPGEKYRRPGKGAHNSSNPDPTRGFDRH* |
| Ga0055472_101199431 | 3300003998 | Natural And Restored Wetlands | MVRETPWRDAWAMTIKSNMKQRDLVRLAVLMCGDRPGAKYSRPSKGTQSSNNLDPSRGYFR* |
| Ga0063454_1000288333 | 3300004081 | Soil | MTMQPNPTQRDLVRLAVLVCGDRPGAKYSAPGKGVHNSGNVDPTRGYDR* |
| Ga0063455_1009969162 | 3300004153 | Soil | MTITPNTTQRDLVRLALLMCGERPSEKYRRPAKGFQNSANADPSRGYAL* |
| Ga0070683_1015354741 | 3300005329 | Corn Rhizosphere | MTIQPNTSQRDLVRLALLMCGDRPGEKYSKPVKGTQNSRNADPTRGFSR* |
| Ga0070682_1012311761 | 3300005337 | Corn Rhizosphere | NTSQRDLVRLALLMCGDRPGEKYSKPVKGTQNSRNADPTRGFSR* |
| Ga0070705_1012943541 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ASSMTIQPNTSQRDLVRLALLMCGDRPGEKYSKPVKGTQNSRNADPTRGFSR* |
| Ga0070686_1010579331 | 3300005544 | Switchgrass Rhizosphere | MTITANTSQRDLVRLALLTCGDRPGAKYSKPVKGTQNSRNADPTRGFSR* |
| Ga0070693_1006793082 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMKPNMKQRDLVRLAVLMCGDRPGAKYNPPAKGNHARSADPTRGFDR* |
| Ga0068854_1006278893 | 3300005578 | Corn Rhizosphere | MTIKANTTQRDLVRLAVLMCGDRPGEKYRRPGKGTHNASNPDPTRGYDRH* |
| Ga0068856_1006497431 | 3300005614 | Corn Rhizosphere | MTIQPNTSQRDLVRLALLMCGDRPGEKYSKPVKGTQNSRNADPTRGF |
| Ga0068852_1015330712 | 3300005616 | Corn Rhizosphere | MTIQPNTSQRDLVRLALLMCGERPGEKYSKPVKGTQNSRNADPTRGFSR* |
| Ga0068861_1009101232 | 3300005719 | Switchgrass Rhizosphere | TANTSQRDLVRLALLMCGDRPGEKYSKPVKGTQNSRNADPTRGFSR* |
| Ga0081455_101231851 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTIKANTTQRDLVRLAVLMCGDRPGEKYRRPGKGTHNASNPDPTRGFDR* |
| Ga0081538_100711653 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSIKPNMTQRDLVRLAVLVCGDRPGEKYRKPGKGGQNARNLDPTRGFDR* |
| Ga0066652_1004748531 | 3300006046 | Soil | MTMKPNMKQRDLVRLAVLMCGDRPSAKYEPPAKGGHSASKHDP |
| Ga0075432_102484261 | 3300006058 | Populus Rhizosphere | MVRNAPSDDASAMSIKPNMTQRDLVRLAVLVCGDRPGAKYTRPGKGAQNSSNLDPSRGFAR* |
| Ga0082029_15184662 | 3300006169 | Termite Nest | MVRAASPDDAAAMSIKPNMTQRDLVRLAVLVCGDRSGEKYRRPGKGAHNSSNPDPTRGYDR* |
| Ga0079222_118630992 | 3300006755 | Agricultural Soil | ASAMTMQPNMKQRDLVRLAVLMCGDRPGAKYVRPAKGGHGASRPDSTLRHYR* |
| Ga0079220_116324852 | 3300006806 | Agricultural Soil | MTMKPNMKQRDLVRLAVLMCGDRPGAKYVRPAKGGHSARQSDPTLRYHR* |
| Ga0075428_1001072405 | 3300006844 | Populus Rhizosphere | MSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAQNSSNLDPTRGFNR* |
| Ga0075431_1006241273 | 3300006847 | Populus Rhizosphere | MSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAHNASNPDPTRGFDR* |
| Ga0075434_1007669202 | 3300006871 | Populus Rhizosphere | MTMKPNMKQRDLVRLAVLMCGDRPGAKYSRPAKGTQNSSNLDPSRGYFR* |
| Ga0075436_1015124472 | 3300006914 | Populus Rhizosphere | TMKPNMKQRDLVRLAVLMCGDRPGAKYVRPAKGGHGASRPDSTLRHYR* |
| Ga0111539_103094053 | 3300009094 | Populus Rhizosphere | MARRPLRGQDCTMTIQAHMKQRDLVRLAVLMCGDRPGAKYTRPSKGVHDSRNLSPASGFLR* |
| Ga0105245_130925752 | 3300009098 | Miscanthus Rhizosphere | VRLAVLMCGDRPGAKYSRPAKGTHNSSNLDPSRGYLR* |
| Ga0114129_115886582 | 3300009147 | Populus Rhizosphere | MSIKPNMTQRDMVRLALLVCGDRPSEKYRRPGKGAHNASNPDPTRGFDR* |
| Ga0105092_107540942 | 3300009157 | Freshwater Sediment | MTITPNTSQRDLVRLALLMCGDRPGAKYSKPVKAVHGSRNADPTRGYSR* |
| Ga0075423_107727221 | 3300009162 | Populus Rhizosphere | MTISPNTSQRDLVRLALLTCGDRPGAKYSKPAKGVQDSRNENPIRGYSR* |
| Ga0126307_114554351 | 3300009789 | Serpentine Soil | LVRLAVLMCGDRPGEKHRAPAKGAHNSSNPEPTHGFSR* |
| Ga0126313_103920004 | 3300009840 | Serpentine Soil | MTITPNTSQRDLVRLALLACGDRPGAKYSKPVKGTQNAHNDDPTRGFSR* |
| Ga0126315_102835953 | 3300010038 | Serpentine Soil | MTMKPNMTQRDLVQLAVLMCGDRPGEKYRPPGKGAHNSSNPDPTRGFDR* |
| Ga0126315_103247812 | 3300010038 | Serpentine Soil | MTIKPNMTQRDLVQLAVLVCGDRPGAKYTRPAKGTHNSTNVDPLRGFSR* |
| Ga0126312_114335302 | 3300010041 | Serpentine Soil | MTMQPNMKQRDLVRLAVLMCGDRPGAKYVRPAKGGHGARKHDPTLRYHR* |
| Ga0126314_103056044 | 3300010042 | Serpentine Soil | MVRYPSSDDAAAMTITPDTTQRDLVRLAVLVCGDRPGEKYRPPGKGAHNSSNPDPTRGFDR* |
| Ga0126314_109721362 | 3300010042 | Serpentine Soil | MTIKPNMTQRDLVQLAVLVCGDRPGAKYTRPAKGTHNSTNVDPLRGF |
| Ga0126310_116517271 | 3300010044 | Serpentine Soil | MTIKPNMTQRDLVQLAVLVCGDRPGAKYTRPAKGTHNSTNVVPLRGFSR* |
| Ga0126311_101523633 | 3300010045 | Serpentine Soil | MTITPNTSQRDLVRLALLTCGDRPGAKYSKPVKGTQNAHNDDPTRGFSR* |
| Ga0126311_103179962 | 3300010045 | Serpentine Soil | MTMKSNMTQRDLVQLAVLMCGDRPGEKYRPPGKGAHNSSNPDPTRGFDR* |
| Ga0134128_118447681 | 3300010373 | Terrestrial Soil | MTMQPDMKQRDLVRLAVLMCGDRPGAKYVRPAKGGHGASQSDPTLRHYR* |
| Ga0134122_105238752 | 3300010400 | Terrestrial Soil | MTMKPNMKQRDLVRLAVLMCGDRPGAKYNPPAKGNHARSTEPTRGFDR* |
| Ga0134121_123219441 | 3300010401 | Terrestrial Soil | MTIKPNTSQRDLVRLAVLMCGDRPGAKYSKPVKGVHDSRNTDPTRGYAR* |
| Ga0134123_118813302 | 3300010403 | Terrestrial Soil | MTMKPNMKQRDLVRLAVLMCGDRPGAKYTPPAKGNHARSGDTTRGFDR* |
| Ga0105246_121582481 | 3300011119 | Miscanthus Rhizosphere | SQRDLVRLALLVCGDRPGAKYSKPVKGPQNSRNDDPTRGFAR* |
| Ga0150985_1027834422 | 3300012212 | Avena Fatua Rhizosphere | MTITPNTSQRDLVRLAVLVCGDRPGAKYSKPVKEMHDSRNPHLTRGFSR* |
| Ga0150984_1170265081 | 3300012469 | Avena Fatua Rhizosphere | SQRDLVRLAVLMCGDRPGAKYSRPAKGTHSARNEDPTRGFSR* |
| Ga0162653_1000162192 | 3300012937 | Soil | MTMQPNMKQRDLVRLAVLMCGDRPGAKFSKPVKGLHDSRNADPTRGFSR* |
| Ga0164302_110457141 | 3300012961 | Soil | MTIQPNTSQRDLVRLALLMCGDRSGAKYSKPVKGTHNARNEDPTRGFTR* |
| Ga0157375_121162622 | 3300013308 | Miscanthus Rhizosphere | MTIKANMKQRDLVRLAVLMCGDRPGAKYSRPAKGTHNSSNLDPSRGYLR* |
| Ga0163163_125569832 | 3300014325 | Switchgrass Rhizosphere | MTIKPNTSQRDLVRLAVLMCGDRPGAKYSRPVKGTQSARNEDPSRGFSR* |
| Ga0157380_130246631 | 3300014326 | Switchgrass Rhizosphere | MSIKPNMTQRDLVQLAVLVCGDRPGEKYRRPGKGAHNVSNPDPTRGFDR* |
| Ga0132258_128234182 | 3300015371 | Arabidopsis Rhizosphere | TMKPNMKQRDLVRLAVLMCGDRPGAKYTRPGKGVHDSRNLNPASGFNR* |
| Ga0132258_136916091 | 3300015371 | Arabidopsis Rhizosphere | MLPGMTITPNTSQRDLVRLAVLVCGDRSSAKYSKPVKGVQDSRNPDPTRGFSR* |
| Ga0132256_1013462592 | 3300015372 | Arabidopsis Rhizosphere | QPNPSQRDLVRLALLMCGDRPGAKYSKPVKGVHSSRNADPTRGFSR* |
| Ga0132257_1026931631 | 3300015373 | Arabidopsis Rhizosphere | MVRHAPPGEDSTMTLKPNMTQRDMVRLAVLVCGDRSGAKYSRPVKGVQNSANVDPTRGFDR* |
| Ga0132255_1035451712 | 3300015374 | Arabidopsis Rhizosphere | MVRHAPPGEDSTMTLKPNMTQRDMVRLAVLVCGDRSGAKYSRPVKGVQSAANVDPTRGFSR* |
| Ga0163161_115194322 | 3300017792 | Switchgrass Rhizosphere | MTIQPNTSQRDLVRLALLMCGDRPGEKYSKPVKGTQNSRNADPTRGFSR |
| Ga0190265_100296402 | 3300018422 | Soil | MSLPPNTQQRDLVRLAVLLNGDRTGEKYRSPAKGTHNSSNADPSRGYAR |
| Ga0190265_102971242 | 3300018422 | Soil | MSLPPNPSQRDLVRLAVLLCGDRPGEKYRSPAKGTHNSSNADPSRGYLR |
| Ga0190265_103554342 | 3300018422 | Soil | MAGRASNLDASTMSLPPNPSQRDLVRLAVLLCGDRPGEKYRSPAKGTHNSSNADPSRGYL |
| Ga0190265_111453382 | 3300018422 | Soil | MSLPPNTQQRDLVRLAVLLCGDRPSEKYRSPAKGAHNSSNADPSRGYAR |
| Ga0190272_129067861 | 3300018429 | Soil | MTITANTSQRDLVQLALLMCGDRPGAKYSKPVKGVHSSRNADPTRGFSR |
| Ga0190275_116688172 | 3300018432 | Soil | VVANASHRDAPGMTITPNTSQRDLVRLALLMCGDRPGAKYAKPVKGVQDSRNIAPTRGYS |
| Ga0190275_132397172 | 3300018432 | Soil | MTRGIPMVRSTPSDDASAMSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAHNSSDPDPTRGFDR |
| Ga0190268_120783591 | 3300018466 | Soil | MVRRAPSDDAAAMSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAHNSSDPDPTRGFD |
| Ga0190270_107161813 | 3300018469 | Soil | MPIKPNMTQRDLVKLAVLMCGDRPGEKYSRPGKGAQNSSNPDP |
| Ga0190270_107416942 | 3300018469 | Soil | MAAQPSNREACSMSLPPNTQQRDLVRLAVLVCGDRPGAKHRAPAKGVHNSSNVDPSRGYA |
| Ga0190270_107747331 | 3300018469 | Soil | MTITPNTSQRDLVRLALLMCGDRPGAKYAKPVKGVQNSRNVAPTRGYTR |
| Ga0190270_126448902 | 3300018469 | Soil | MLRSMTITPNTSQRDLVRLALLMCGDRPGAKYSKPVKGVHDSRNVAPTRGYSR |
| Ga0190270_132782001 | 3300018469 | Soil | NLDASTMSLPPNPSQRDLVRLAVLLCGDRPGEKYRSPAKGAHNSSNADPSRGYLR |
| Ga0222622_103891402 | 3300022756 | Groundwater Sediment | MTITPNTSQRDLVRLAVLMCGDRPGAKYSKPVKGTHNARNEDPTRGFSR |
| Ga0207642_104679723 | 3300025899 | Miscanthus Rhizosphere | PGTACRDAPSMTIKPNTSQRDLVRLAVLMCGDRPGAKYSRPVKGTQSARNEDPSRGFSR |
| Ga0207643_106657362 | 3300025908 | Miscanthus Rhizosphere | MTIKANTTQRDLVRLAVLMCGDRPGEKYRRPGKGTHNASNPDPTRGYDRH |
| Ga0207660_103693294 | 3300025917 | Corn Rhizosphere | VRLAVLMCGDRPGAKYTPPAKGNHARSGDTTRGFDR |
| Ga0207657_106797612 | 3300025919 | Corn Rhizosphere | MTIQPHTSQRNLVRLALLMCGDRPGAKYTPPAKGNHARSGDTTRGFDR |
| Ga0207652_108145182 | 3300025921 | Corn Rhizosphere | MTMQPDMKQRDLVRLAVLMCGDRPGAKYVRPAKGGHGASQSDPTLRHYR |
| Ga0207706_113857982 | 3300025933 | Corn Rhizosphere | MTIQPNTSQPDLVRLALLMCGDRPGEKYSKPVKGTQNSRNADPTRGFSR |
| Ga0207669_113978982 | 3300025937 | Miscanthus Rhizosphere | MTIKANMKQRDLVRLAVLMCGDRPGAKYSRPAKGTHNSSNLDPSRG |
| Ga0207640_119973542 | 3300025981 | Corn Rhizosphere | MTIKANMKQRDLVRLAVLMCGDRPGAKYTPPAKGNHARSGDTTRGFDR |
| Ga0207678_102068951 | 3300026067 | Corn Rhizosphere | MTIKPNTSQRDLVRLAVLMCGDRPGAKYSRPVKGTQSARNEDPSRGFSR |
| Ga0207678_117413892 | 3300026067 | Corn Rhizosphere | MTIKPDMKQRDLVRLAVLMCGDRPGAKYNPPAKGNHARSTEPTRGFDR |
| Ga0207648_104562322 | 3300026089 | Miscanthus Rhizosphere | MTIQPNTSQRDLVRLALLMCGDRPGEKYSKPVKGTQNARNTDRTRGFSR |
| Ga0214468_10929771 | 3300027647 | Soil | ACSMSLPPNTQQRDLVRLAVLLCGDRPSEKYRSPAKGAHNSSNADPSRGYAR |
| Ga0209481_107046011 | 3300027880 | Populus Rhizosphere | DLVRLAVLMCGDRPGAKYTRPEKGVHDSRNLSPASGFLR |
| Ga0207428_103349651 | 3300027907 | Populus Rhizosphere | MTIQAHMKQRDLVRLAVLMCGDRPGAKYTRPSKGVHDSRNLSPASGFLR |
| Ga0209382_107142163 | 3300027909 | Populus Rhizosphere | MSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAQNSSNLDPTRGFNR |
| Ga0307276_101278531 | 3300028705 | Soil | MTIQPNIQQRDLVRLALLMCGERPGEKYRPPTKGSASSRTAEPWRGYAR |
| Ga0307319_100694232 | 3300028722 | Soil | MARRPLGGQACTMTMQPNMKQRDLVRLAVLMCGDRSGAKFSKPVKGLHDSRNADPTRGFS |
| Ga0307319_102617672 | 3300028722 | Soil | MTIKPNTTQRDLVRMAVLLNGDRPGAKYSRPSKGHSSRNTDPTRGFSR |
| Ga0307318_103753162 | 3300028744 | Soil | MARRPLPGQACSMTIKPNTTQRDLVRMAVLLNGDRPGAKYSKPSKGHSSRNTDPTRGFSR |
| Ga0307296_105325661 | 3300028819 | Soil | DALSMTITPNTSQRDLVRLALLMCGDRPGAKYSKPVKGTHNARNEDPTRGFSR |
| Ga0307310_107465581 | 3300028824 | Soil | MTITPNTSQRDLVRLAVLMCGDRPGAKYSRPVKGTQNARNADPTRGFSR |
| Ga0299907_112053032 | 3300030006 | Soil | TQQRDLVRLAVLLCGDRPSEKYRSPAKGAHNSSNADPSRGYAR |
| Ga0102757_112631482 | 3300030785 | Soil | MTIQPNIQQRDLVRLALLVCGERPSEKYRFPGKGAHNSSNPDPSRGYAR |
| Ga0307408_1003443631 | 3300031548 | Rhizosphere | MPMKPNMTQRDLVRLAVLVCGDRPGEKYRRPGKGSQDTSNPDPTRGFDR |
| Ga0307405_114493902 | 3300031731 | Rhizosphere | MTMKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAHNSSDPDPTRGFDR |
| Ga0307413_105058452 | 3300031824 | Rhizosphere | MSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAHNSSDPDPTRGFDR |
| Ga0307413_107953541 | 3300031824 | Rhizosphere | MPMKPNMTQRDLVRLAVLVCGDRSGEKYRRPGKGSQNTSNPDPTRGYDR |
| Ga0307413_110531573 | 3300031824 | Rhizosphere | MVGKPPPDDASAMSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAQNSSNLDPTRGFA |
| Ga0307406_100723023 | 3300031901 | Rhizosphere | MVGKPPPDDASAMSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAQNTSNPDPTRGFD |
| Ga0307406_101207203 | 3300031901 | Rhizosphere | MTIKPNTTQRDLVRLAVLLNGDRPGAKYSRPAKGVQSSANVDPTRGFDR |
| Ga0307407_101508443 | 3300031903 | Rhizosphere | MSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAQNTSNPDPTRGFDR |
| Ga0308175_1008579673 | 3300031938 | Soil | MTIQPNTTQRDLVRLALLVCGDRPSEKYRAPGKGTNDTRNPDPTRGYDR |
| Ga0308176_105720071 | 3300031996 | Soil | MDRRARPREALTMTIQPNTTQRDLVRLALLVCGDRPSEKYRTPGKGTNDTRNP |
| Ga0307416_1007562042 | 3300032002 | Rhizosphere | MVGKPPPDDASAMSIKPNMTQRDLVQLAVLMCGDRPGEKYRRPGKGAHNSSDPDPTRGFD |
| Ga0307416_1026475981 | 3300032002 | Rhizosphere | PPWRDPAGMTITANTSQRDLVRLALLTCGDRPAAKYSKPVKGVQDSRNEDPTRGYSR |
| Ga0307414_112950602 | 3300032004 | Rhizosphere | MTQRDLVQLAVLMCGDRPGEKYRRPGKGAHNSSDPDPTRGFDR |
| Ga0307414_123108782 | 3300032004 | Rhizosphere | MKQRDLVRLAVLMCGDRPGAKYSRPGKGVHDTRNSDPARGFLR |
| Ga0326721_103737242 | 3300032080 | Soil | MPMQPNMTQRDLVKLALLVCGDRPGEKYRRPGKGSQNVSNPDPTRGFDR |
| Ga0326721_109890082 | 3300032080 | Soil | MVRNAPSDDASAMTIKANMTQRDLVQLAVLMCGDRPGEKYRRPGKGAHNSSDPDPTRGFD |
| Ga0307415_1020304152 | 3300032126 | Rhizosphere | MVRAAPPGDASAMTMKPNMTQREMVRLAVLMCSDRPGEKFRRPSKGGHDSSNADPSRGFD |
| ⦗Top⦘ |