NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079176

Metagenome / Metatranscriptome Family F079176

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079176
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 44 residues
Representative Sequence MMNSGPVRDGAAQAASAASEAPLLKLEDFLPHRLNVLSSLVSQ
Number of Associated Samples 103
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 47.41 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.38 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.621 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.517 % of family members)
Environment Ontology (ENVO) Unclassified
(24.138 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.276 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.39%    β-sheet: 0.00%    Coil/Unstructured: 67.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF01406tRNA-synt_1e 19.83
PF09190DALR_2 4.31
PF13176TPR_7 0.86
PF13673Acetyltransf_10 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 24.14
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 19.83
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 19.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.62 %
UnclassifiedrootN/A16.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig82546Not Available516Open in IMG/M
3300000956|JGI10216J12902_103249031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300004049|Ga0055493_10109520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria599Open in IMG/M
3300004479|Ga0062595_100459043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria939Open in IMG/M
3300005178|Ga0066688_10562607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria733Open in IMG/M
3300005181|Ga0066678_10716088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria666Open in IMG/M
3300005340|Ga0070689_100035697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3799Open in IMG/M
3300005560|Ga0066670_10015088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3440Open in IMG/M
3300005713|Ga0066905_101084012Not Available710Open in IMG/M
3300005713|Ga0066905_101316873All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300005764|Ga0066903_108471388Not Available524Open in IMG/M
3300005841|Ga0068863_101530154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300005983|Ga0081540_1094457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1306Open in IMG/M
3300006046|Ga0066652_100029499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3908Open in IMG/M
3300006046|Ga0066652_101092367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria756Open in IMG/M
3300006172|Ga0075018_10007393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3979Open in IMG/M
3300006604|Ga0074060_10001602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales622Open in IMG/M
3300006880|Ga0075429_101729882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales543Open in IMG/M
3300006894|Ga0079215_10820446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300006953|Ga0074063_10102735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria848Open in IMG/M
3300007076|Ga0075435_101140284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria682Open in IMG/M
3300009088|Ga0099830_10579749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria919Open in IMG/M
3300009100|Ga0075418_12520138Not Available561Open in IMG/M
3300009792|Ga0126374_11156252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria617Open in IMG/M
3300010046|Ga0126384_10168766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1703Open in IMG/M
3300010046|Ga0126384_10730170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria880Open in IMG/M
3300010048|Ga0126373_12236524Not Available608Open in IMG/M
3300010326|Ga0134065_10335487Not Available589Open in IMG/M
3300010360|Ga0126372_12134811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium608Open in IMG/M
3300010361|Ga0126378_10769289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1073Open in IMG/M
3300010361|Ga0126378_12708995Not Available566Open in IMG/M
3300010362|Ga0126377_12352993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300010366|Ga0126379_11957539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300010366|Ga0126379_12252676Not Available645Open in IMG/M
3300010371|Ga0134125_12126032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria610Open in IMG/M
3300010373|Ga0134128_10703531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1122Open in IMG/M
3300010375|Ga0105239_10965895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria979Open in IMG/M
3300010398|Ga0126383_11618707Not Available737Open in IMG/M
3300010398|Ga0126383_13059614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300010398|Ga0126383_13301016Not Available527Open in IMG/M
3300010399|Ga0134127_10682848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1065Open in IMG/M
3300010401|Ga0134121_10852632Not Available880Open in IMG/M
3300010868|Ga0124844_1135356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria937Open in IMG/M
3300011271|Ga0137393_11417285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300012208|Ga0137376_10281641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1443Open in IMG/M
3300012208|Ga0137376_10754167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria839Open in IMG/M
3300012212|Ga0150985_121238530All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012351|Ga0137386_10475376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria900Open in IMG/M
3300012358|Ga0137368_10457672Not Available828Open in IMG/M
3300012359|Ga0137385_10406964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1159Open in IMG/M
3300012362|Ga0137361_10134444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2193Open in IMG/M
3300012469|Ga0150984_111398489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300012683|Ga0137398_10081413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1998Open in IMG/M
3300012924|Ga0137413_10912293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria683Open in IMG/M
3300012930|Ga0137407_10730656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria933Open in IMG/M
3300012958|Ga0164299_10272696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1024Open in IMG/M
3300012971|Ga0126369_10627910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1147Open in IMG/M
3300012988|Ga0164306_10179618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1469Open in IMG/M
3300014307|Ga0075304_1114213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300014501|Ga0182024_10674499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1280Open in IMG/M
3300016270|Ga0182036_10188251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1503Open in IMG/M
3300016270|Ga0182036_10593931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria887Open in IMG/M
3300016422|Ga0182039_11101207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria715Open in IMG/M
3300016445|Ga0182038_12092761Not Available513Open in IMG/M
3300017792|Ga0163161_11108039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria681Open in IMG/M
3300017792|Ga0163161_11363845Not Available618Open in IMG/M
3300018066|Ga0184617_1085347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria862Open in IMG/M
3300018422|Ga0190265_12887794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria574Open in IMG/M
3300018431|Ga0066655_10324291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1007Open in IMG/M
3300018469|Ga0190270_12061748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria629Open in IMG/M
3300019876|Ga0193703_1002336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2740Open in IMG/M
3300019881|Ga0193707_1200579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300021363|Ga0193699_10435867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria541Open in IMG/M
3300021510|Ga0222621_1002923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2765Open in IMG/M
3300025321|Ga0207656_10114348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1250Open in IMG/M
3300025910|Ga0207684_11417866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300025912|Ga0207707_11219264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria608Open in IMG/M
3300025916|Ga0207663_10242135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1323Open in IMG/M
3300025929|Ga0207664_10781713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria859Open in IMG/M
3300025942|Ga0207689_10378572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1178Open in IMG/M
3300026041|Ga0207639_10209422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1677Open in IMG/M
3300026332|Ga0209803_1310025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300027576|Ga0209003_1044343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria782Open in IMG/M
3300027655|Ga0209388_1004189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3627Open in IMG/M
3300028713|Ga0307303_10011450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1589Open in IMG/M
3300028810|Ga0307294_10071317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1051Open in IMG/M
3300028814|Ga0307302_10226821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria914Open in IMG/M
3300028814|Ga0307302_10279641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria819Open in IMG/M
3300028814|Ga0307302_10640104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300028819|Ga0307296_10101282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1543Open in IMG/M
3300028876|Ga0307286_10029810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1795Open in IMG/M
3300028878|Ga0307278_10458971Not Available558Open in IMG/M
3300029636|Ga0222749_10454023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300031198|Ga0307500_10015591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1593Open in IMG/M
3300031198|Ga0307500_10078459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860851Open in IMG/M
3300031199|Ga0307495_10247248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300031545|Ga0318541_10231204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1026Open in IMG/M
3300031564|Ga0318573_10087097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1586Open in IMG/M
3300031573|Ga0310915_10142517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1652Open in IMG/M
3300031719|Ga0306917_11510577Not Available517Open in IMG/M
3300031768|Ga0318509_10127040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1394Open in IMG/M
3300031793|Ga0318548_10265562Not Available843Open in IMG/M
3300031845|Ga0318511_10526572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300031847|Ga0310907_10879325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria506Open in IMG/M
3300031858|Ga0310892_10933388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300031879|Ga0306919_10608873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria842Open in IMG/M
3300031880|Ga0318544_10064712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1340Open in IMG/M
3300031894|Ga0318522_10367174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300031912|Ga0306921_12235560Not Available575Open in IMG/M
3300032044|Ga0318558_10034450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2158Open in IMG/M
3300032060|Ga0318505_10529182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300032089|Ga0318525_10717641Not Available508Open in IMG/M
3300032163|Ga0315281_10704524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1051Open in IMG/M
3300032180|Ga0307471_100069625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3027Open in IMG/M
3300032261|Ga0306920_101365604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1017Open in IMG/M
3300033290|Ga0318519_10090256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1630Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.21%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.03%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.72%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.86%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.86%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.86%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.86%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.86%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.86%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.86%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.86%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.86%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004049Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_017722502124908016MTNSGPVRDNAALVDAACAEAPLLKLEDFLPHRLNVLSSLVSQALTRV
JGI10216J12902_10324903113300000956SoilMMNSGPVRDGAAQAASTASDAPLLKLEDFLPHRLNV
Ga0055493_1010952013300004049Natural And Restored WetlandsMSTVNSGAVRENAQSTPAASPAGLLKLDDFLPHRLNVLSSLVSQALTSVYGRYG
Ga0062595_10045904333300004479SoilMMNSGPIRDGAAHADLAQDDVPRDEAAPAKLSLLKLEDFLPHRLNVLSSLVSQALTRVYG
Ga0066688_1056260713300005178SoilMMNSGPVRDGAAQAASTASDAPLLKLEDFLPHRLNVLSSL
Ga0066678_1071608823300005181SoilMMNSGPVRDGAAQAASTASDAPLLKLEDFLPHRLNVLSSLVSQALTRVYG
Ga0070689_10003569713300005340Switchgrass RhizosphereMNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLVSQALTRVYGR
Ga0066670_1001508863300005560SoilMNSGPLRDNAAHAASAASEAPLLKLEDFLPHRLNVLSSLVSQALTRVYG
Ga0066905_10108401213300005713Tropical Forest SoilLMMNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNV
Ga0066905_10131687313300005713Tropical Forest SoilMMNSGPVRDGAAQAAASAGPAEAALLKLEDFLPHRLNVLSSLVSQALTRV
Ga0066903_10847138823300005764Tropical Forest SoilLMMNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVS
Ga0068863_10153015423300005841Switchgrass RhizosphereMMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSLVSQA
Ga0081540_109445713300005983Tabebuia Heterophylla RhizosphereMMNSGPVRDSAAHSAAAPADAPLLKLEDFLPHRLN
Ga0066652_10002949963300006046SoilMTNSGPVRDNAAHVDAAQAEAPLLKLEDFLPHRLNVLSSLV
Ga0066652_10109236713300006046SoilMMNSGPIRDGAVHADLAQDDAPRDEAAPAKLSLLKLEDFLPHRLNVLSSL
Ga0075018_1000739363300006172WatershedsMMNSGPVQDGAAKVAEPDETALLKLEDFLPHKLNVLSSLVSQALTRV
Ga0074060_1000160213300006604SoilMNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSS
Ga0075429_10172988223300006880Populus RhizosphereVSSGCGVEAMANSVPVREGAPAGAPLLKLEEFLPHRLNVLSSLVSLALTR
Ga0079215_1082044613300006894Agricultural SoilMSSGAVREKATQSASAGGDAPLLKLDDFLPHRLNVLSSLV
Ga0074063_1010273513300006953SoilMMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNV
Ga0075435_10114028423300007076Populus RhizosphereMMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSL
Ga0099830_1057974913300009088Vadose Zone SoilMTNADPVHDATATAAPAEAPLLKLEDFLPHRLNVLSSLV
Ga0075418_1252013813300009100Populus RhizosphereMTNSGPVRDNAAHVDAACAEAPLLKLEDFLPHRLNVLSSLVSQALT
Ga0126374_1115625213300009792Tropical Forest SoilMMNSGPVRDGATHAASAPDQTGAPAPLLKLEDFLPHRLNVLSSLVSQALTR
Ga0126384_1016876633300010046Tropical Forest SoilMTNADPIHDDAVTGAPAAAAPTPVLKLEDFLPHRLNVLSSLVSQALTRVYGR
Ga0126384_1073017013300010046Tropical Forest SoilLMTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVL
Ga0126373_1223652413300010048Tropical Forest SoilMTNSGPVHEGASKVAASAEPLLKLEDFLPHKLNVLSSL
Ga0134065_1033548713300010326Grasslands SoilMNSGPLRDNAAHAASAASEAPLLKLEDFLPHRLNVLSS
Ga0126372_1213481113300010360Tropical Forest SoilMNSGPVRDNAAHAAAAPSEAPLLKLEDFLPHRLNVLSSLVSQALTRV
Ga0126378_1076928913300010361Tropical Forest SoilMTNADPIHDGDALSAPAPAAPVPMLKLEDFLPHRLNVLSSLVSQALTR
Ga0126378_1270899513300010361Tropical Forest SoilMTNSGPVRDNAAHVDAAQGEAPLLKLEDFLPHRLNVLSSLVSQALTRVYGRHG
Ga0126377_1235299313300010362Tropical Forest SoilMMNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQALTRVY
Ga0126379_1195753923300010366Tropical Forest SoilMMNSGPARDGAAEAAAPEPLLKLEDFLPHRLNVLSSLVSQ
Ga0126379_1225267613300010366Tropical Forest SoilMMNSGPVRDGAAQAALAASEAPLLKLEDFLPHRLNV
Ga0134125_1212603223300010371Terrestrial SoilMNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTRVYGR
Ga0134128_1070353123300010373Terrestrial SoilMNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLVSQALT
Ga0105239_1096589513300010375Corn RhizosphereMMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSLVSQALTRVYGRHG
Ga0126383_1161870713300010398Tropical Forest SoilMMNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNVLSSL
Ga0126383_1305961413300010398Tropical Forest SoilMMNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSS
Ga0126383_1330101613300010398Tropical Forest SoilMMNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNV
Ga0134127_1068284813300010399Terrestrial SoilMNSGPVRENTAPAGLALSEAPVLRLEEFLPHRLNVLSSLVSQDLTRRYGRY
Ga0134121_1085263213300010401Terrestrial SoilMMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSLVSQALTR
Ga0124844_113535613300010868Tropical Forest SoilMNSGPVRDNAAQAATAPSEAPLLKLEDFLPHRLNVLSSL
Ga0137393_1141728513300011271Vadose Zone SoilMIKSGSHRDAAALDASPPAQAPLLKLEHFLPHRLNVLSSLISQALTGVYGR
Ga0137376_1028164133300012208Vadose Zone SoilMMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLS
Ga0137376_1075416713300012208Vadose Zone SoilMTNSGPVRDNAAHIDAAQPETPLLKLDDFLPHRLNVLSSLVSQALTRV
Ga0150985_12123853013300012212Avena Fatua RhizosphereMSNPNPVPDTDVDGANAPILKLEDFLPHRLNVLSSLVSQALT
Ga0137386_1047537613300012351Vadose Zone SoilMNPGPLRDNAAHAASAPSEAPLLKLEDFLPHRLNVLSSLVSQALTR
Ga0137368_1045767223300012358Vadose Zone SoilMSSGPVRDNAAHAAPPEAPLLKLEDFLPHRLNVLSS
Ga0137385_1040696413300012359Vadose Zone SoilMINSGPVQESAANAEKAAESALLKLEDFLPHRLNVLSSL
Ga0137361_1013444413300012362Vadose Zone SoilMMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLN
Ga0150984_11139848923300012469Avena Fatua RhizosphereMNSGPVRENTAPAGSAPPEAPLLRLEEFLPHRLNVLSS
Ga0137398_1008141333300012683Vadose Zone SoilMMNSGPVHDGAAKVAVPGEPALLRLEDFLPHKLNVLSS
Ga0137413_1091229323300012924Vadose Zone SoilMMSSGPAREGAAQAAAATSEAPLLKLEDFLPHRLNVLSSLVSQAL
Ga0137407_1073065623300012930Vadose Zone SoilMMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLSSLVSQALTRV
Ga0164299_1027269613300012958SoilMNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLVS
Ga0126369_1062791013300012971Tropical Forest SoilMMNSGPARDGAAEAAAPEPLLKLEDFLPHRLNVLSSLVSQA
Ga0164306_1017961833300012988SoilMNSGPVRENTSPAGSAPPEAPLLRLEEFLPHRLNVLSSLVSQALTRV
Ga0075304_111421323300014307Natural And Restored WetlandsMSTVNSGAVRENAQSTPAASPAGLLKLDDFLPHRLNVLS
Ga0182024_1067449933300014501PermafrostMMNSGPVQDGATQVAAPSETILLKLEDFLPHRLNVLSSLVSQALARVYGQ
Ga0182036_1018825143300016270SoilMRQPGPDNMTNSGPVHDGASKVAASAEPLLKLEDFLPHKLNVLSSLVSQALSRVYGE
Ga0182036_1059393123300016270SoilMMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVL
Ga0182039_1110120713300016422SoilMTNSGPVRDSAARAASAGEDLAPTKSALLKLEDFLPHRLNVLSSLVSQALTRV
Ga0182038_1209276113300016445SoilLMMNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHR
Ga0163161_1110803913300017792Switchgrass RhizosphereMNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSS
Ga0163161_1136384523300017792Switchgrass RhizosphereMTNSGPVRDNAAHVDAACAEAPLLKLEDFLPHRLNVLSSLVSQALTRV
Ga0184617_108534713300018066Groundwater SedimentMNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTR
Ga0190265_1288779423300018422SoilLIMSSGAVREKATQSASAGGDAPLLKLDDFLPHRLNVLSSLVS
Ga0066655_1032429113300018431Grasslands SoilMTNSGPVRDNAAHVDAAQAEAPLLKLEDFLPHRLNVLSSLVSQALTRVY
Ga0190270_1206174813300018469SoilMNSGPVRENTASAGSAPSEAPLLRLEEYLPHRLNDL
Ga0193703_100233613300019876SoilMNSGPVRENTAPAGSAPPEAPLLRLEEFLPHRLNVLSSLVSQALTRVYGRYGI
Ga0193707_120057913300019881SoilMMNSGPVRDSAAPAGTAPSEAPLLRLDEFLPHRLNVLSSLVSQALTRVYGRYG
Ga0193699_1043586723300021363SoilMNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLLSQAL
Ga0222621_100292343300021510Groundwater SedimentMMNSGPVRDSAQPAGTAPSEAPLLRLDDFLPHRLNVLSSLVSQALTRV
Ga0207656_1011434833300025321Corn RhizosphereMNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVL
Ga0207684_1141786613300025910Corn, Switchgrass And Miscanthus RhizosphereMNSGPVRDNAAHTAAAPPEAPLLKLEDFLPHRLNVLSSLVSQALTRVYGRYG
Ga0207707_1121926423300025912Corn RhizosphereMNSGPVRENTAPAGSAPSEAPLLRLEDFLPHRLNVLSSLVSQALTR
Ga0207663_1024213533300025916Corn, Switchgrass And Miscanthus RhizosphereMNSGPVRENTAPAGSAPSEAPLLRLEDFLPHRLNVL
Ga0207664_1078171323300025929Agricultural SoilMMNSRPVHDGTAKLAVPSETALLRLEDFLPHRLNVLSSLVSQALTRVYGRR
Ga0207689_1037857233300025942Miscanthus RhizosphereMNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLVSQA
Ga0207639_1020942233300026041Corn RhizosphereMNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLV
Ga0209803_131002513300026332SoilMMNSGPVRDGAAQAASTASDAPLLKLEDFLPHRLNVLSSLVSQA
Ga0209003_104434313300027576Forest SoilMMNSGPVRDGAAQAASAASDGPLLKLEDFLPHRLNVLSSL
Ga0209388_100418963300027655Vadose Zone SoilMMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLSSLV
Ga0307303_1001145033300028713SoilMMNSGPVRDSAAPAGTAPSEAPLLRLDEFLPHRLNV
Ga0307294_1007131713300028810SoilMNSGPVRENTAPAGSAPPEAPLLRLEEFLPHRLNVLSSLVSQALTRVYGRYG
Ga0307302_1022682113300028814SoilMNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTRV
Ga0307302_1027964113300028814SoilMMNSGPVRDSTAPAGTAPSEAPLLRLDEFLPHRLNVLSSLVS
Ga0307302_1064010423300028814SoilMMNSGPVRDSAAPAGTAPSEAPLLRLDEFLPHRLNVLSSLVSQALTRV
Ga0307296_1010128233300028819SoilMMNSGPVRDSTAPAGTAPSEAPLLRLDEFLPHRLNVLSSLVSQAL
Ga0307286_1002981033300028876SoilMNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTRVYG
Ga0307278_1045897113300028878SoilMSSGPVLDNAAHAAAPPEAPLLKLEDFLPHRLNVLSS
Ga0222749_1045402323300029636SoilMMNSGPVQDGAAAVAQPGETALLKLEDFLPHKLNVLSSLVSQALNRV
Ga0307500_1001559113300031198SoilMNSGPLRENTPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTRVYGRYG
Ga0307500_1007845923300031198SoilMSSNQVRDSAAQAASTPAQAGSQAGSQAGLLKLEDFLPHRLNVLSSLVSQALTRVYG
Ga0307495_1024724823300031199SoilMMNSGPVRDSAPPAGTAPSEAPLLRLDEFLPHRLNVLSSLV
Ga0318541_1023120423300031545SoilMNSGPVRDNAAQAAATPSEAPLLKLEDFLPHRLNVLSRLV
Ga0318573_1008709733300031564SoilMMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLSSLVSQALT
Ga0310915_1014251733300031573SoilMTNSGPFRDGATHAASAPDQTGAQAPLLKLEDFLPH
Ga0306917_1151057713300031719SoilLMTNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNVLSSL
Ga0318509_1012704023300031768SoilMTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLN
Ga0318548_1026556223300031793SoilMTNSGPFRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQALTRVYG
Ga0318511_1052657213300031845SoilMNSGPVRDNAAQAAATPSEAPLLKLEDFLPHRLNVLSSLVSHALTRVYGRRYGIG
Ga0310907_1087932523300031847SoilMMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLS
Ga0310892_1093338823300031858SoilMMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSLVSQALTRVYGRHGIG
Ga0306919_1060887313300031879SoilMTNSGPFRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQA
Ga0318544_1006471213300031880SoilMTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQA
Ga0318522_1036717423300031894SoilMMNSGPVRDGAAQAASAASEAPLLKLEDFLPHRLNVLSSLVSQ
Ga0306921_1223556013300031912SoilLMTNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNVLS
Ga0318558_1003445033300032044SoilMTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRL
Ga0318505_1052918213300032060SoilMMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLSSLVS
Ga0318525_1071764113300032089SoilMTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSS
Ga0315281_1070452423300032163SedimentMINSGPASRDAAAQSAPDLKLEDFLPHRLNVLSSLVSQALTHVYGHH
Ga0307471_10006962553300032180Hardwood Forest SoilLNGPRDTPARVTMNSGPVRDNAAHAVAAPSEAPLLKLEDFLPHRLNVLSSLV
Ga0306920_10136560413300032261SoilMRNSGPLHEGLAKAHSPAETALLKLEDFLPHRLNVLSSLVSHAL
Ga0318519_1009025633300033290SoilMTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQALTRVYG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.