| Basic Information | |
|---|---|
| Family ID | F079167 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TVKPTRAQVYGSFLAALPGIAGAYGGSLMRGVIDNLRQGK |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 97.41 % |
| % of genes from short scaffolds (< 2000 bps) | 84.48 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.862 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.862 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF12706 | Lactamase_B_2 | 40.52 |
| PF00753 | Lactamase_B | 18.97 |
| PF00557 | Peptidase_M24 | 4.31 |
| PF13407 | Peripla_BP_4 | 3.45 |
| PF13664 | DUF4149 | 3.45 |
| PF07859 | Abhydrolase_3 | 2.59 |
| PF01625 | PMSR | 1.72 |
| PF14561 | TPR_20 | 0.86 |
| PF05593 | RHS_repeat | 0.86 |
| PF00583 | Acetyltransf_1 | 0.86 |
| PF01926 | MMR_HSR1 | 0.86 |
| PF03069 | FmdA_AmdA | 0.86 |
| PF00725 | 3HCDH | 0.86 |
| PF02403 | Seryl_tRNA_N | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 2.59 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 1.72 |
| COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.86 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.86 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.69 % |
| Unclassified | root | N/A | 4.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10112657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1287 | Open in IMG/M |
| 3300001593|JGI12635J15846_10327558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 948 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100029801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4816 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100484590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100932520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 751 | Open in IMG/M |
| 3300003352|JGI26345J50200_1027238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300004092|Ga0062389_100786466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300005176|Ga0066679_10452680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300005177|Ga0066690_10367659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300005180|Ga0066685_10456412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300005436|Ga0070713_101372213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300005538|Ga0070731_10066154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2399 | Open in IMG/M |
| 3300005541|Ga0070733_11136576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300005586|Ga0066691_10165338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1278 | Open in IMG/M |
| 3300005591|Ga0070761_10177603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1255 | Open in IMG/M |
| 3300005921|Ga0070766_10478703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300005994|Ga0066789_10345717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300006162|Ga0075030_100305039 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300006172|Ga0075018_10157361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300006174|Ga0075014_100852430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300006176|Ga0070765_100058267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3186 | Open in IMG/M |
| 3300009624|Ga0116105_1054129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300009632|Ga0116102_1011268 | All Organisms → cellular organisms → Bacteria | 3249 | Open in IMG/M |
| 3300009665|Ga0116135_1006683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4375 | Open in IMG/M |
| 3300009665|Ga0116135_1083130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
| 3300010358|Ga0126370_11897311 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010375|Ga0105239_13493862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010376|Ga0126381_100035714 | All Organisms → cellular organisms → Bacteria | 5977 | Open in IMG/M |
| 3300010379|Ga0136449_101031654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1319 | Open in IMG/M |
| 3300010866|Ga0126344_1128333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300010876|Ga0126361_11130531 | Not Available | 531 | Open in IMG/M |
| 3300011269|Ga0137392_10376552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1177 | Open in IMG/M |
| 3300012209|Ga0137379_11140890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300012357|Ga0137384_10283331 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300012683|Ga0137398_10356655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300012917|Ga0137395_10689463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300012960|Ga0164301_11143857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300014489|Ga0182018_10737895 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300014655|Ga0181516_10650208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300015264|Ga0137403_11167770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300015371|Ga0132258_12704429 | Not Available | 1238 | Open in IMG/M |
| 3300016750|Ga0181505_10668849 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
| 3300017925|Ga0187856_1032009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2490 | Open in IMG/M |
| 3300017934|Ga0187803_10464031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300017943|Ga0187819_10432471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300017973|Ga0187780_10226405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1307 | Open in IMG/M |
| 3300017975|Ga0187782_10506143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300018015|Ga0187866_1245976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300018026|Ga0187857_10131951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1197 | Open in IMG/M |
| 3300018042|Ga0187871_10078189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1933 | Open in IMG/M |
| 3300018085|Ga0187772_10893364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300018085|Ga0187772_10974243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300018468|Ga0066662_10462028 | Not Available | 1141 | Open in IMG/M |
| 3300019890|Ga0193728_1039092 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300020579|Ga0210407_10800209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300020580|Ga0210403_10516653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300020580|Ga0210403_10776800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300021168|Ga0210406_10149917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300021181|Ga0210388_10094056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2559 | Open in IMG/M |
| 3300021181|Ga0210388_10400494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1207 | Open in IMG/M |
| 3300021401|Ga0210393_11129261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300021407|Ga0210383_10241882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1548 | Open in IMG/M |
| 3300021420|Ga0210394_10459834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300021420|Ga0210394_11363936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300021433|Ga0210391_10327831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1201 | Open in IMG/M |
| 3300021475|Ga0210392_10624263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300021479|Ga0210410_10365261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1294 | Open in IMG/M |
| 3300021559|Ga0210409_10660548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 915 | Open in IMG/M |
| 3300021559|Ga0210409_10858001 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300021559|Ga0210409_11475438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300022557|Ga0212123_10872991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300025134|Ga0207416_1244736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300025448|Ga0208037_1008712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2944 | Open in IMG/M |
| 3300025913|Ga0207695_11392585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300025916|Ga0207663_10364158 | Not Available | 1098 | Open in IMG/M |
| 3300025942|Ga0207689_10815891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300026335|Ga0209804_1130274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300026557|Ga0179587_10765538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300027076|Ga0208860_1033713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300027545|Ga0209008_1032651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1208 | Open in IMG/M |
| 3300027604|Ga0208324_1207955 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027745|Ga0209908_10233662 | Not Available | 514 | Open in IMG/M |
| 3300027846|Ga0209180_10103622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300027867|Ga0209167_10001528 | All Organisms → cellular organisms → Bacteria | 13472 | Open in IMG/M |
| 3300027908|Ga0209006_10010481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8374 | Open in IMG/M |
| 3300027911|Ga0209698_11100623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300028800|Ga0265338_10513142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300028808|Ga0302228_10111479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1277 | Open in IMG/M |
| 3300028874|Ga0302155_10135079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1090 | Open in IMG/M |
| 3300028877|Ga0302235_10021721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3475 | Open in IMG/M |
| 3300029999|Ga0311339_10323639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1646 | Open in IMG/M |
| 3300030053|Ga0302177_10164710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1241 | Open in IMG/M |
| 3300030057|Ga0302176_10001422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11250 | Open in IMG/M |
| 3300030058|Ga0302179_10471281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300030518|Ga0302275_10118288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1727 | Open in IMG/M |
| 3300030618|Ga0311354_11834751 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031231|Ga0170824_121888241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300031708|Ga0310686_111402548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300031718|Ga0307474_10589676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300031720|Ga0307469_10296506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1329 | Open in IMG/M |
| 3300031823|Ga0307478_10347672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
| 3300031962|Ga0307479_10318803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
| 3300031962|Ga0307479_10865644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300032001|Ga0306922_10044083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4594 | Open in IMG/M |
| 3300032160|Ga0311301_10681978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1451 | Open in IMG/M |
| 3300032180|Ga0307471_103124986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300032770|Ga0335085_11366723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300032828|Ga0335080_10225291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2056 | Open in IMG/M |
| 3300032892|Ga0335081_12720930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300032895|Ga0335074_10993504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300033158|Ga0335077_10588769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1163 | Open in IMG/M |
| 3300033402|Ga0326728_10184804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2144 | Open in IMG/M |
| 3300033412|Ga0310810_10264920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1878 | Open in IMG/M |
| 3300033561|Ga0371490_1110343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300033808|Ga0314867_013333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1935 | Open in IMG/M |
| 3300034163|Ga0370515_0473721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.72% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.72% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.86% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.86% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101126573 | 3300001356 | Peatlands Soil | AAYVVLTVKPTRAQIYGSFLAFLPGIAGAYGGSFMREVVDNLRQGK* |
| JGI12635J15846_103275583 | 3300001593 | Forest Soil | TVKPTRAQVYGSFLAALPGIAGAYGGSLMRGVIDNLRQGK* |
| JGIcombinedJ26739_1000298011 | 3300002245 | Forest Soil | LKPTRAQVYGSFLAFLPGIAGAYGGSLMRGVMDNLWQGK* |
| JGIcombinedJ26739_1004845902 | 3300002245 | Forest Soil | GQAYGSLLTALPGMAGAYGGAVVRRVMDNLRERK* |
| JGIcombinedJ26739_1009325201 | 3300002245 | Forest Soil | VKPTRAQVFGSFLAFLPGIAGAYGGSLMRGVIDNLWQGK* |
| JGI26345J50200_10272382 | 3300003352 | Bog Forest Soil | LTVKPTRGQVYGSFLTALPGTAGAYGGAVMRRVIDNLRQGK* |
| Ga0062389_1007864661 | 3300004092 | Bog Forest Soil | LTTIKPSRAQVYGSFLTALPGTAGAYGGAVVRRVIENLRLRK* |
| Ga0066679_104526801 | 3300005176 | Soil | AYILLTQKPTRAQVYESLLVFLPGIAGSYGGSMMRGVIDNLMAGN* |
| Ga0066690_103676592 | 3300005177 | Soil | VAMTQKPYRSRIYESFLAFLPGIAGAYGGSLMRGVINNLRAGK* |
| Ga0066685_104564121 | 3300005180 | Soil | ISTVKPTRAQIYGSFLASLPGIAGAYGGSFMRGVVRNLRQGR* |
| Ga0070713_1013722132 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IRTVKPSRAQIYASFLAFLPGIAGAYGGSVMRRVIDNLRQGK* |
| Ga0070731_100661541 | 3300005538 | Surface Soil | TVKPTRAQVYGSFLAFLPGIAGAYGGSFMRRAMENLKQGK* |
| Ga0070733_111365762 | 3300005541 | Surface Soil | PSRSQVWGSFLTALPGTAGAYGGAVMRRAIDTLKQGK* |
| Ga0066691_101653381 | 3300005586 | Soil | KPYRSQIYESFLALLPGIAGAYGGSLMRGVIDNLRAGK* |
| Ga0070761_101776031 | 3300005591 | Soil | AVKPTRGQVYGSFLTALPGTAGAYGGAVMRRVIDHLRQGN* |
| Ga0070766_104787031 | 3300005921 | Soil | ILTVKPTRAQVYGSFLAALPGIAGAYGGALARGAIDHLRQGK* |
| Ga0066789_103457171 | 3300005994 | Soil | LTVKPTRAQIYGSFLAFLPGIAGAYGGSFMRDVVDNLRQGK* |
| Ga0075030_1003050391 | 3300006162 | Watersheds | AQIYGSFLAFLPGIAGAYGGSLMRGVIENLRQGK* |
| Ga0075018_101573611 | 3300006172 | Watersheds | YRAQVFGSFLAFLPGIAGSVGGSLMRGVWDNLAQGK* |
| Ga0075014_1008524302 | 3300006174 | Watersheds | VKPSRAQVYGSFLTCLPGIAGAYGGSVMRAVIDNLRQGK* |
| Ga0070765_1000582671 | 3300006176 | Soil | AESAAYLVLALKPTRGQIYGSFLTALPGTAGAYGGAVLRVVLNNLRQGK* |
| Ga0116105_10541291 | 3300009624 | Peatland | YTILALKPTRGQFYGSFLTALPGMAGAYGGAVMRRVIDNLRQGK* |
| Ga0116102_10112686 | 3300009632 | Peatland | PTRGQVYGSFLTALPGIAGAYGGSLMRGVIDNLRQGK* |
| Ga0116135_10066831 | 3300009665 | Peatland | TEWVANLLTAIKPTRAQMYGSFLTALPGIAGAYGGSQVRGVLDNLRQGK* |
| Ga0116135_10831302 | 3300009665 | Peatland | ALLDVKPTRGQVYGAFLTALPGVAGAYGGAVVRRVLDNLREGK* |
| Ga0126370_118973111 | 3300010358 | Tropical Forest Soil | TVKPTRAQVYGSFLAFLPGVAGAYGGAILRRVIDNLRHGK* |
| Ga0105239_134938622 | 3300010375 | Corn Rhizosphere | RAQMYGSFLTILPGVAGAYGGAVMRKVFDNLWAGR* |
| Ga0126381_1000357141 | 3300010376 | Tropical Forest Soil | AAYLVLTVKPTRAQAYGSFLAFLPGIAGAYGGAIVRSVVDNLRQGR* |
| Ga0136449_1010316541 | 3300010379 | Peatlands Soil | STVKPTRAQVYGSFLASLPGIAGAYGGAVMRGVINNLRQGK* |
| Ga0126344_11283331 | 3300010866 | Boreal Forest Soil | TILTVKPTRGQAYGSLLTALPGMAGAYGGAVMRRVMDTLRERK* |
| Ga0126361_111305311 | 3300010876 | Boreal Forest Soil | VAYSVLKVKPTRGQVYGSFLTALPGVAGAYGGAVMRRVIQNLRQGK* |
| Ga0137392_103765521 | 3300011269 | Vadose Zone Soil | QKPYRSQIYESFLAFLPGIAGAYGGSLMRGVIDNLRAGK* |
| Ga0137379_111408901 | 3300012209 | Vadose Zone Soil | VKPTRSQIYGSFLAFLPGIAGAYGGSLMRGVIENLRQGK* |
| Ga0137384_102833312 | 3300012357 | Vadose Zone Soil | AYVILTVKPTRAQIYGSFLAFLPGIAGAYGGSLMRGVIENLRQGK* |
| Ga0137398_103566551 | 3300012683 | Vadose Zone Soil | QVAKPTQAQIWGSLLAWLPGIAGAYGGSFMRGVVSNLRQGK* |
| Ga0137395_106894631 | 3300012917 | Vadose Zone Soil | AGAVKPTHAQIYGSFLAWLPGVAGAYGGSFMRGVVNNLRQGK* |
| Ga0164301_111438572 | 3300012960 | Soil | VKPTRAQIYGSFLAFLPGIAGAYGGSVMRGVMENLRQGK* |
| Ga0182018_107378952 | 3300014489 | Palsa | KPTRAQVYGSFLASLPGIAGAYGGSLMRGVLDNLRQGK* |
| Ga0181516_106502081 | 3300014655 | Bog | ISPSRGQIYGAFLTALPGIAGAYGGAVMRRVIDNLRLGR* |
| Ga0137403_111677702 | 3300015264 | Vadose Zone Soil | PEPARAQVYGSFLVFLPGIAGAYGGALLRGVIDNLRQGK* |
| Ga0132258_127044292 | 3300015371 | Arabidopsis Rhizosphere | SRAQVYGPVLAFLPGVAGAYGGSLMRGVVENLKQGK* |
| Ga0181505_106688494 | 3300016750 | Peatland | AAYAILAVKPTRGQVYGSFLTALPGTAGAYGGAVMRRVMDNLRQGK |
| Ga0187856_10320095 | 3300017925 | Peatland | AYTILTVQPTRGQVYGSFLTALPGIAGAYGGSLMRGVIDNLRQGK |
| Ga0187803_104640312 | 3300017934 | Freshwater Sediment | QTLKPSQAQIYGSFLAFLPGVAGAYGGSFMRGVIDNLRQGK |
| Ga0187819_104324711 | 3300017943 | Freshwater Sediment | LAAYLVLTVKPTRAQIYGSFLAFLPGVAGAYGGSTMRTVVDNLRLGR |
| Ga0187780_102264053 | 3300017973 | Tropical Peatland | SVKPSRAQVYGSFLAFLPGIAGAYGGSIMRSVIDNLREGK |
| Ga0187782_105061431 | 3300017975 | Tropical Peatland | AYKIQGITPSRGQVYGAFLAFLPGIAGAYGGAIMRAVIDNLRQGK |
| Ga0187866_12459762 | 3300018015 | Peatland | LALKPTRGQVYGSFLTALPGMAGAYGGAVMRRVIDNLRQGK |
| Ga0187857_101319513 | 3300018026 | Peatland | YTILALKPTRGQVYGSFLTALPGMAGAYGGAVMRRVIDNLRQGK |
| Ga0187871_100781894 | 3300018042 | Peatland | ILTVKPTLSQTYGAFLTALPGMAGAYGGSVMRRAIDNLRQGK |
| Ga0187772_108933642 | 3300018085 | Tropical Peatland | ELTAYLTLTVKPTRAQIYGSFLAFFPGIAGAYGGAFMRGVIDNLREGK |
| Ga0187772_109742432 | 3300018085 | Tropical Peatland | LIMAVKPTRGQVYGSFLTALPGTAGAYGGAVMRRVIDNLRLGK |
| Ga0066662_104620282 | 3300018468 | Grasslands Soil | LIRTVKPSRAQIYGSFLAFLPGIAGAYGGAVMRRVMDNLRLGK |
| Ga0193728_10390921 | 3300019890 | Soil | RGQMYGSFLLALPGIAGAYGGAVVRGVIDNLRQGK |
| Ga0210407_108002092 | 3300020579 | Soil | AAYVILTVKPTRPQVYGSYLAFLPGIAGAYGGAIMRRVMDNLKQGK |
| Ga0210403_105166531 | 3300020580 | Soil | VLTVKPTRAQVYGSFLAFLPGIAGAYGGSLMRGVIDNLWQGK |
| Ga0210403_107768002 | 3300020580 | Soil | IRTVKPSRAQIYGSFLAFLPGIAGAYGGSVMRRVVDNLRQGK |
| Ga0210406_101499171 | 3300021168 | Soil | EFGAYFVQTVKPSRGQVYGSFLAFLPGIAGAYGGSLLRGVVDNMRGGK |
| Ga0210388_100940564 | 3300021181 | Soil | YVLLTVKPTRAQVYGSFLAFLPGIAGAYGGSIVRNVMDTLRHGK |
| Ga0210388_104004942 | 3300021181 | Soil | LAAFLILTVKPTRAQVYGSFLASLPGFAGAYGGSVVRAVVDHLRQGT |
| Ga0210393_111292612 | 3300021401 | Soil | AAYKILTVKPTRPQVYGSFLAFLPGIAGAYGGSVVRTVVDNLRQGR |
| Ga0210383_102418823 | 3300021407 | Soil | AFLVQTVKPSRAQIYGSFLAFLPGVAGAYGGAVVRNVVDNLRAGK |
| Ga0210394_104598342 | 3300021420 | Soil | ADMVRAVRPTRAQVYESFLAFLPGIAGAYGGSVVRAVVENLRQGK |
| Ga0210394_113639361 | 3300021420 | Soil | AFVVLTVKPTRAQVYGSFLAFLPGIAGAYGGSLMRGVIDNLWQGK |
| Ga0210391_103278312 | 3300021433 | Soil | LVLAVKPTRAQVYGSFLAALPGIAGAYGGSIVRNVVDNLRQGK |
| Ga0210392_106242632 | 3300021475 | Soil | AAYLVLALKPTRGQIYGSFLTALPGTAGAYGGAVVRAVLDHLREGN |
| Ga0210410_103652611 | 3300021479 | Soil | AAYLILTVKPTRAQVYGSFLAALPGIAGAYGGSLMRGVIDNLRQGK |
| Ga0210409_106605481 | 3300021559 | Soil | RAQIYGSFLAFLPGIAGAYGGSVMRRVVDNLRQGK |
| Ga0210409_108580011 | 3300021559 | Soil | AAYLVFTVKPTRGQIYGSFLAALPGIAGAYGGSLMRGVLDNLRQGK |
| Ga0210409_114754381 | 3300021559 | Soil | YLVLALKPTRGQIYGSFLTALPGTAGAYGGAVVRAVLDHLREGN |
| Ga0212123_108729911 | 3300022557 | Iron-Sulfur Acid Spring | YALLTVKPTRAQAYGSFLAFLPGIAGAYGGAIFRRVMDHLRQGR |
| Ga0207416_12447361 | 3300025134 | Iron-Sulfur Acid Spring | LLTVKPTRAQAYGSFLAFLPGIAGAYGGAIFRRVMDHLRQGR |
| Ga0208037_10087121 | 3300025448 | Peatland | YTILTVQPTRGQVYGSFLTALPGIAGAYGGSLMRGVIDNLRQGK |
| Ga0207695_113925852 | 3300025913 | Corn Rhizosphere | KPSRAQVYGSFLAFLPGIAGAYGGSVMRKVFDNLQGGR |
| Ga0207663_103641582 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PSRAQIYASFLAFLPGIAGAYGGSVMRRVIDNLRQGK |
| Ga0207689_108158911 | 3300025942 | Miscanthus Rhizosphere | PYRAQVFQSFLALLPALVAAYGGAFGRGVINNLRGTK |
| Ga0209804_11302741 | 3300026335 | Soil | YVAMTQKPYRSRIYESFLAFLPGIAGAYGGSLMRGVINNLRAGK |
| Ga0179587_107655381 | 3300026557 | Vadose Zone Soil | PTRAQVYGSFLAFLPGIAGAYGGSFMRGVVDNLRQGK |
| Ga0208860_10337132 | 3300027076 | Forest Soil | LAAYLILTVKPTRVQVYGSFLAALPGIAGAYGGSLMRGVLDNLRQGK |
| Ga0209008_10326511 | 3300027545 | Forest Soil | VKPTRGQAYGSLLTALPGMAGAYGGAVVRRVMDNLRERK |
| Ga0208324_12079552 | 3300027604 | Peatlands Soil | TLKPTRAQIYGSFLAFLPGIAGAYGGSIMRGVIDNLRHGK |
| Ga0209908_102336621 | 3300027745 | Thawing Permafrost | KVQPTRGQVYGSFLTALPGMAGAYGGAVMRRVIDNLRHGK |
| Ga0209180_101036221 | 3300027846 | Vadose Zone Soil | RAQIYGSFLTSLPGVAGAYGGSLMRRALDHLRQGA |
| Ga0209167_100015281 | 3300027867 | Surface Soil | LILTVKPTRAQVFGSFLAFLPGVAGAFGGSIMRKLADHLRHGT |
| Ga0209006_100104811 | 3300027908 | Forest Soil | VKPTRAQVYGSFLAFLPGIAGAYGGSVVRAAVDNLRQGK |
| Ga0209698_111006232 | 3300027911 | Watersheds | VVQTVKPTRAQIYGSFLAFLPGIAGAYGGSLMRGVIENLKQGK |
| Ga0265338_105131421 | 3300028800 | Rhizosphere | LAAYVILTVKPTRAQVYESFLAFLPGIAGAYGGSIMRNVINNLREGK |
| Ga0302228_101114793 | 3300028808 | Palsa | FVAYLVLTVKPTRAQVYGSFLAFLPGIAGAYGGSLMRGVIDNLWQGK |
| Ga0302155_101350793 | 3300028874 | Bog | TRAQVYGSFLAALPGIAGAYGGSLMRGVLDNLRQGK |
| Ga0302235_100217214 | 3300028877 | Palsa | RGQVYGSFLTALPGTAGAYGGAVMRRVLDNLRQGK |
| Ga0311339_103236391 | 3300029999 | Palsa | PTRAQVYGSFLAFLPGIAGAYGGSLMRGVIDNLWQGK |
| Ga0302177_101647101 | 3300030053 | Palsa | PTRAQVYGSFLASLPGIAGAYGGSLMRGVLDNLRQGK |
| Ga0302176_1000142215 | 3300030057 | Palsa | VKPTRAQVYGSFLASLPGIAGAYGGSLMRGVLDNLRQGK |
| Ga0302179_104712812 | 3300030058 | Palsa | TVKPTRAQVYGSFLAALPGIAGAYGGSLMRGVIDNLRQGK |
| Ga0302275_101182883 | 3300030518 | Bog | PTRAQIYGSFLAFLPGIAGAYGGAVMRQAIDNLRQGK |
| Ga0311354_118347511 | 3300030618 | Palsa | AYLILTVKPTRAQVYGSFLASLPGIAGAYGGSLMRGVLDNLRQGK |
| Ga0170824_1218882411 | 3300031231 | Forest Soil | PSRAQVYGSFLAFFPGIAGAYGGSVVRAVVDNLKNKR |
| Ga0310686_1114025482 | 3300031708 | Soil | VLTVKPTRAQVFGSFLAFLPGIAGAYGGSLMRGVIDNLWQGK |
| Ga0307474_105896762 | 3300031718 | Hardwood Forest Soil | VKPTRGQVYGSFLTALPGTAGAYGGAVMRRVLDNLRQGK |
| Ga0307469_102965063 | 3300031720 | Hardwood Forest Soil | AYVISTLKPTRAQIYGSFLASLPGIAGAYGGALLRRVMDNLRQGN |
| Ga0307478_103476722 | 3300031823 | Hardwood Forest Soil | AYMVLTVRPTRAQIYGSFLAFLPGIAGAYGGSVVRAAVENLRQGK |
| Ga0307479_103188031 | 3300031962 | Hardwood Forest Soil | LMAVRPSRAQIYGSFLVFLPGIAGAYGGSLMRGVLDNLVQKK |
| Ga0307479_108656442 | 3300031962 | Hardwood Forest Soil | YLILRVKPTRAQVYGSFLASLPGIAGAYGGSLMRGAVDNLRQRK |
| Ga0306922_100440835 | 3300032001 | Soil | MVRTVKPTRSQIYGSFLAFLPGIAGAYGGSFMRRVVENLRQGK |
| Ga0311301_106819783 | 3300032160 | Peatlands Soil | LISTVKPTRAQVYGSFLASLPGIAGAYGGAVMRGVINNLRQGK |
| Ga0307471_1031249861 | 3300032180 | Hardwood Forest Soil | KPTRAQVYGSFLAALPGIAGAYGGAVVRDVIDHLRQGK |
| Ga0335085_113667232 | 3300032770 | Soil | AAYLVLTVKPTRAQIYGSFLAFLPGIAGAYGGSFMRDVVDNLRQGK |
| Ga0335080_102252914 | 3300032828 | Soil | QRLQRSQLYGSLLTILPAIAGAYGGSLMRGVIKNLRAGS |
| Ga0335081_127209302 | 3300032892 | Soil | KPSRAQVYASVLACLPGIAGAYGGAILRTAIDHLRAGN |
| Ga0335074_109935041 | 3300032895 | Soil | SFLAKDIKADRAQIYGGFLTVLPGIAGAYGGAVMRQVIDNLWQGK |
| Ga0335077_105887691 | 3300033158 | Soil | RAQIYGSILAFFPGIAGAYGGSFMRGVVDNLLAGK |
| Ga0326728_101848044 | 3300033402 | Peat Soil | ILTVKPTRAQIYGSFLAFLPGTAGAYGGSIMRGVIDNLRQGK |
| Ga0310810_102649204 | 3300033412 | Soil | VKPSRAQVYGSFLAFLPGIAGAYGGSVMRKVFDNLQGGK |
| Ga0371490_11103432 | 3300033561 | Peat Soil | TRGQVYGSFLTALPGMAGAYGGAVMRRVIDNLRQGK |
| Ga0314867_013333_32_151 | 3300033808 | Peatland | VKPSRAQIYASVLAFLPGVAGAYGGSIMRGVIDNLRQGR |
| Ga0370515_0473721_28_168 | 3300034163 | Untreated Peat Soil | VAYFVLTVKPTRAQVFGSFLAFLPGIAGAYGGSLMRGVIDNLWQGK |
| ⦗Top⦘ |