| Basic Information | |
|---|---|
| Family ID | F079157 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MLRADLLKPDLVSEVVLLGSGALLFVSLLLIVVTALTRA |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.33 % |
| % of genes near scaffold ends (potentially truncated) | 18.97 % |
| % of genes from short scaffolds (< 2000 bps) | 68.97 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.172 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.724 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13545 | HTH_Crp_2 | 7.76 |
| PF00027 | cNMP_binding | 5.17 |
| PF00196 | GerE | 2.59 |
| PF11154 | DUF2934 | 2.59 |
| PF04366 | Ysc84 | 2.59 |
| PF02607 | B12-binding_2 | 1.72 |
| PF12779 | WXXGXW | 1.72 |
| PF14310 | Fn3-like | 0.86 |
| PF07730 | HisKA_3 | 0.86 |
| PF08240 | ADH_N | 0.86 |
| PF00691 | OmpA | 0.86 |
| PF13751 | DDE_Tnp_1_6 | 0.86 |
| PF00075 | RNase_H | 0.86 |
| PF11964 | SpoIIAA-like | 0.86 |
| PF01479 | S4 | 0.86 |
| PF09335 | SNARE_assoc | 0.86 |
| PF13466 | STAS_2 | 0.86 |
| PF03544 | TonB_C | 0.86 |
| PF00011 | HSP20 | 0.86 |
| PF07610 | DUF1573 | 0.86 |
| PF01627 | Hpt | 0.86 |
| PF00383 | dCMP_cyt_deam_1 | 0.86 |
| PF00092 | VWA | 0.86 |
| PF13088 | BNR_2 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 2.59 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.86 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.86 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.86 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.86 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.86 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.17 % |
| Unclassified | root | N/A | 19.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10007768 | All Organisms → cellular organisms → Bacteria | 7379 | Open in IMG/M |
| 3300000789|JGI1027J11758_13000068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300000955|JGI1027J12803_105269753 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300002917|JGI25616J43925_10018250 | All Organisms → cellular organisms → Bacteria | 3110 | Open in IMG/M |
| 3300004092|Ga0062389_102138790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300004102|Ga0058888_1433764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300004104|Ga0058891_1001135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300004104|Ga0058891_1390027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300004104|Ga0058891_1500940 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1219 | Open in IMG/M |
| 3300004120|Ga0058901_1339249 | Not Available | 509 | Open in IMG/M |
| 3300004137|Ga0058883_1454703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300004631|Ga0058899_10737178 | Not Available | 874 | Open in IMG/M |
| 3300005181|Ga0066678_11021498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005338|Ga0068868_100055040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3138 | Open in IMG/M |
| 3300005354|Ga0070675_100658028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300005441|Ga0070700_101353287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300005445|Ga0070708_100502589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1144 | Open in IMG/M |
| 3300005445|Ga0070708_100605520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300005447|Ga0066689_10968325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005467|Ga0070706_100136388 | Not Available | 2291 | Open in IMG/M |
| 3300005468|Ga0070707_100011196 | All Organisms → cellular organisms → Bacteria | 8360 | Open in IMG/M |
| 3300005536|Ga0070697_100298944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1383 | Open in IMG/M |
| 3300005536|Ga0070697_100396647 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005541|Ga0070733_10038188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2995 | Open in IMG/M |
| 3300005542|Ga0070732_10004718 | All Organisms → cellular organisms → Bacteria | 7378 | Open in IMG/M |
| 3300005555|Ga0066692_10438554 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005576|Ga0066708_10511234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300005598|Ga0066706_10833545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300005602|Ga0070762_10020950 | All Organisms → cellular organisms → Bacteria | 3413 | Open in IMG/M |
| 3300005841|Ga0068863_100274824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1631 | Open in IMG/M |
| 3300006028|Ga0070717_10031639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4258 | Open in IMG/M |
| 3300006028|Ga0070717_10984786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300006172|Ga0075018_10527145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300006358|Ga0068871_100655657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300006800|Ga0066660_10159214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1682 | Open in IMG/M |
| 3300009012|Ga0066710_100099696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3880 | Open in IMG/M |
| 3300009551|Ga0105238_12463301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300010373|Ga0134128_12979036 | Not Available | 521 | Open in IMG/M |
| 3300011120|Ga0150983_10327167 | Not Available | 522 | Open in IMG/M |
| 3300011120|Ga0150983_12002057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300011120|Ga0150983_12042672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300011120|Ga0150983_12445177 | Not Available | 695 | Open in IMG/M |
| 3300011120|Ga0150983_13989070 | Not Available | 1316 | Open in IMG/M |
| 3300011269|Ga0137392_10650608 | Not Available | 874 | Open in IMG/M |
| 3300012207|Ga0137381_10010459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7077 | Open in IMG/M |
| 3300012207|Ga0137381_10082134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2709 | Open in IMG/M |
| 3300012357|Ga0137384_10144548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1991 | Open in IMG/M |
| 3300012918|Ga0137396_10172121 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300012929|Ga0137404_10170889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1823 | Open in IMG/M |
| 3300012930|Ga0137407_10103986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2440 | Open in IMG/M |
| 3300012955|Ga0164298_10414351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300012960|Ga0164301_11327441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300013296|Ga0157374_12806997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300014491|Ga0182014_10004754 | All Organisms → cellular organisms → Bacteria | 15393 | Open in IMG/M |
| 3300016698|Ga0181503_1324364 | Not Available | 541 | Open in IMG/M |
| 3300016705|Ga0181507_1202649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300017929|Ga0187849_1324187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300017940|Ga0187853_10422661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300018061|Ga0184619_10158155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300018482|Ga0066669_10224838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 1461 | Open in IMG/M |
| 3300019865|Ga0193748_1007667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300019879|Ga0193723_1162186 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300019885|Ga0193747_1051451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300019887|Ga0193729_1105543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
| 3300020022|Ga0193733_1090896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300020579|Ga0210407_11388769 | Not Available | 521 | Open in IMG/M |
| 3300020580|Ga0210403_10006813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9553 | Open in IMG/M |
| 3300020581|Ga0210399_11170330 | Not Available | 612 | Open in IMG/M |
| 3300020583|Ga0210401_10079452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3087 | Open in IMG/M |
| 3300021046|Ga0215015_10477440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300021168|Ga0210406_10001348 | All Organisms → cellular organisms → Bacteria | 30117 | Open in IMG/M |
| 3300021170|Ga0210400_10001335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24620 | Open in IMG/M |
| 3300021171|Ga0210405_10002794 | All Organisms → cellular organisms → Bacteria | 17739 | Open in IMG/M |
| 3300021171|Ga0210405_10029244 | All Organisms → cellular organisms → Bacteria | 4421 | Open in IMG/M |
| 3300021344|Ga0193719_10128838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
| 3300021401|Ga0210393_11316465 | Not Available | 579 | Open in IMG/M |
| 3300021405|Ga0210387_11854386 | Not Available | 507 | Open in IMG/M |
| 3300021432|Ga0210384_10310886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1419 | Open in IMG/M |
| 3300021432|Ga0210384_10388302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1257 | Open in IMG/M |
| 3300021477|Ga0210398_10005262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12042 | Open in IMG/M |
| 3300021478|Ga0210402_10387788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
| 3300021478|Ga0210402_11857432 | Not Available | 528 | Open in IMG/M |
| 3300021479|Ga0210410_10066825 | Not Available | 3147 | Open in IMG/M |
| 3300023101|Ga0224557_1281962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 535 | Open in IMG/M |
| 3300023544|Ga0247542_100666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
| 3300025315|Ga0207697_10385665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300025901|Ga0207688_10126788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
| 3300025904|Ga0207647_10006262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 8668 | Open in IMG/M |
| 3300025910|Ga0207684_10299511 | Not Available | 1386 | Open in IMG/M |
| 3300025914|Ga0207671_10688565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300025927|Ga0207687_10130773 | Not Available | 1892 | Open in IMG/M |
| 3300025930|Ga0207701_10010838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8976 | Open in IMG/M |
| 3300025938|Ga0207704_10200836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1459 | Open in IMG/M |
| 3300026023|Ga0207677_10215079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1538 | Open in IMG/M |
| 3300026075|Ga0207708_10106450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2175 | Open in IMG/M |
| 3300026088|Ga0207641_10014334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6496 | Open in IMG/M |
| 3300026304|Ga0209240_1026823 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300027842|Ga0209580_10004784 | All Organisms → cellular organisms → Bacteria | 5768 | Open in IMG/M |
| 3300027854|Ga0209517_10007371 | All Organisms → cellular organisms → Bacteria | 13210 | Open in IMG/M |
| 3300028792|Ga0307504_10369908 | Not Available | 557 | Open in IMG/M |
| 3300030775|Ga0074021_1588240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300031708|Ga0310686_109486334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6577 | Open in IMG/M |
| 3300031708|Ga0310686_118115191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2691 | Open in IMG/M |
| 3300031720|Ga0307469_10099035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2040 | Open in IMG/M |
| 3300031740|Ga0307468_100058803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2061 | Open in IMG/M |
| 3300031754|Ga0307475_10163770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1771 | Open in IMG/M |
| 3300031820|Ga0307473_10228475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 1125 | Open in IMG/M |
| 3300032180|Ga0307471_100370942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 1549 | Open in IMG/M |
| 3300032180|Ga0307471_101085049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300032205|Ga0307472_102580006 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300032805|Ga0335078_12604818 | Not Available | 518 | Open in IMG/M |
| 3300033158|Ga0335077_10492397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300033433|Ga0326726_12270652 | Not Available | 527 | Open in IMG/M |
| 3300034090|Ga0326723_0412698 | Not Available | 614 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023544 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030775 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100077689 | 3300000567 | Peatlands Soil | MQRADLLKPDILSEIVLLGSGVLIFVLLLLVVLTALTRA* |
| JGI1027J11758_130000682 | 3300000789 | Soil | MHRADLLKADLLSEIVLLGTGALIXXALXLVXXTALTRP* |
| JGI1027J12803_1052697531 | 3300000955 | Soil | MHRADLLKADLLSEIVLLGTGALIFFALLLVTMTALTRP* |
| JGI25616J43925_100182502 | 3300002917 | Grasslands Soil | MLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTALTQA* |
| Ga0062389_1021387901 | 3300004092 | Bog Forest Soil | MLRADLLKPDLLSELVLLCSGAVLLGSLLLIIVTALTQA* |
| Ga0058888_14337642 | 3300004102 | Forest Soil | MLRADLLKPDLLSKAVLLGSCAFLFGSLLLVVVTAFRRA* |
| Ga0058891_10011351 | 3300004104 | Forest Soil | MLRADLLKPDLLSKAVLLGSGALLFGSLLLVVVTAFKRA* |
| Ga0058891_13900272 | 3300004104 | Forest Soil | MLRADLLKPDLLSELVLLGTAVLIFVSLVLIVATALNRP* |
| Ga0058891_15009402 | 3300004104 | Forest Soil | MLRADLLKPDLLSEIVLLGSGALLFGSLLLIVVIVLTQA* |
| Ga0058901_13392492 | 3300004120 | Forest Soil | MQRADLLKSDLVSELVLLGGGVLILVSLILIVATALTRV* |
| Ga0058883_14547031 | 3300004137 | Forest Soil | MLRADLLKPDLLSKAVLLGSGALLFGSLLLVVVTAFRRA* |
| Ga0058899_107371781 | 3300004631 | Forest Soil | MLRADLLKADLLSEIVLLGSGVAILISLLLIVATVLNHA* |
| Ga0066678_110214982 | 3300005181 | Soil | EMLRTDLLKPDLVSELVLLGSGTLLFVSLLMIVVTALTRA* |
| Ga0068868_1000550402 | 3300005338 | Miscanthus Rhizosphere | MHRADLLKPDLLSEIVLLGAGALIFAALLLVTVTALARS* |
| Ga0070675_1006580283 | 3300005354 | Miscanthus Rhizosphere | MHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS* |
| Ga0070700_1013532871 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRADLLKPDLLSEILLLGTGALILVSVLLVTVTALARP* |
| Ga0070708_1005025892 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRADLLKPDLVSELVLLGSGALLLLSLLLFVVTAVARA* |
| Ga0070708_1006055202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRADILKPDLVSEVVLLGSGALLVVSLLLIVVTALARA* |
| Ga0066689_109683252 | 3300005447 | Soil | MLRTDLLKPDLVSELVLLGSGTLLFVSLLMIVVTALTRA* |
| Ga0070706_1001363883 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTALTRA* |
| Ga0070707_1000111966 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRADLLKPDLVSELVLLGSAALLLLSLLLVILTAAARA* |
| Ga0070739_100293453 | 3300005532 | Surface Soil | MRSKDLLCPDLLSELVLLGFGMLILASLLLFLVTALTRP* |
| Ga0070697_1002989441 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRTDLLKPDLVSELVLLGSATLLLVSLLLIVVTAFTRA* |
| Ga0070697_1003966472 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRADLLKPDLVSEVVLLGSGALLFVSLLLIVVTALTRA* |
| Ga0070733_100381884 | 3300005541 | Surface Soil | MLRADLLKADLLSEIVLLGSGVLIVVSLVLVVVAALTRA* |
| Ga0070732_100047185 | 3300005542 | Surface Soil | MLREDLLKPDLLSEIVLISSAALLVISLLMIVVTALARA* |
| Ga0066692_104385542 | 3300005555 | Soil | MLRADLLKPDLVSELVLLVSGALLFASLMLVIVTALTRA* |
| Ga0066708_105112341 | 3300005576 | Soil | MLRADLLKPDLVSELVLLGSGTLLFFLVLVVVTAVARA* |
| Ga0066706_108335453 | 3300005598 | Soil | ADILKPDLVSEVVLLGSGALLAVSLLLIVATALARA* |
| Ga0070762_100209505 | 3300005602 | Soil | MQRADLLKSDLLSELVLLGGGVLILVSLILIVATALTRV* |
| Ga0068863_1002748243 | 3300005841 | Switchgrass Rhizosphere | MHRADLLKPDLLSEIVLVGTGVLIFVALLLVTVTGLMRP* |
| Ga0070717_100316394 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRADLLKPDLLSKAVLLGSGALLFGSLLLIVLTAFARA* |
| Ga0070717_109847862 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRADLLKPDLLSKAVLLGTGALLFGSLLLIVITVLTRA* |
| Ga0075018_105271451 | 3300006172 | Watersheds | LMNPDLFSEIVLLGSGALLFVSLLLIVVNALTRA* |
| Ga0068871_1006556572 | 3300006358 | Miscanthus Rhizosphere | MHRADLLKPDLLSEIVLLGAGALIFVALLLVTVTALARS* |
| Ga0066660_101592143 | 3300006800 | Soil | MLRTDLLKPDPVSELVLLGSGTLLFVSLLMIVVTALTRA* |
| Ga0066710_1000996966 | 3300009012 | Grasslands Soil | MLRADLLKPDLVSELVLLGSGALLFASLMLVIVTALTRA |
| Ga0105238_124633011 | 3300009551 | Corn Rhizosphere | RRRAMHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS* |
| Ga0134128_129790361 | 3300010373 | Terrestrial Soil | MHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTAL |
| Ga0150983_103271671 | 3300011120 | Forest Soil | MLRADILKPDLLSEIVLLGSGVLLFSSLLLVVVAAFTQA* |
| Ga0150983_120020572 | 3300011120 | Forest Soil | MLRPDLLKPDLLSKAVLLGSGALLFGSLLLVVLTAFRRV* |
| Ga0150983_120426721 | 3300011120 | Forest Soil | EGRSEMLRADLLKPDLLSEIVLLGSGALLFSSLLLIVVIVLAQA* |
| Ga0150983_124451772 | 3300011120 | Forest Soil | MLRAEILKPDLLSEIVLLGSGVLLFSSLLLVVVTALTQA* |
| Ga0150983_139890702 | 3300011120 | Forest Soil | MLHADLLKPDLLSEIVLLGSGALLFGSLLLIVVTVLTQA* |
| Ga0137392_106506083 | 3300011269 | Vadose Zone Soil | MLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTAL |
| Ga0137381_100104592 | 3300012207 | Vadose Zone Soil | MVRADLLKPDLVSELVLLGSAALLLLSLLLVILTAAARA* |
| Ga0137381_100821341 | 3300012207 | Vadose Zone Soil | MLRADLLKPDLVSELVLLGSGALLFASLMLVIVTALTRA* |
| Ga0137384_101445483 | 3300012357 | Vadose Zone Soil | MVRADLLKTDLVSELVLLGSAALLLLSLLLVILTAAARA* |
| Ga0137396_101721212 | 3300012918 | Vadose Zone Soil | MHREDLLSPDLLSEIVLLGSGTLLLISVWLLVVIAFTRT* |
| Ga0137404_101708893 | 3300012929 | Vadose Zone Soil | MLRADLLKPDLVSELVLLGSGALLFFLVLVVVTAVARA* |
| Ga0137407_101039863 | 3300012930 | Vadose Zone Soil | MLRADLLKPDLVSELVLLGSAALLFAFIVAGLLTAAARA* |
| Ga0164298_104143512 | 3300012955 | Soil | TEMQRTDLLKPDLVSELVLLGCGALLVVSLLLVVIAALAPR* |
| Ga0164301_113274412 | 3300012960 | Soil | MLRTDLLKPDLVSELVLLGSGTLLFVSLLLIVVTALARP* |
| Ga0157374_128069972 | 3300013296 | Miscanthus Rhizosphere | AMHRADLLKPDLLSEIVLLGAGALIFVALLFVTVTALARS* |
| Ga0182014_1000475418 | 3300014491 | Bog | MLRAEILKPDLLSEIVLLGSGVLLFSSLLLVVVTVLTQA* |
| Ga0181503_13243641 | 3300016698 | Peatland | VLRADLLQPDLFSKIVLMGSGALFLGSLFMVVMTALARA |
| Ga0181507_12026492 | 3300016705 | Peatland | VLRADLLKPDLFGKIVLMGSGALFLGSLFMVVMTALARA |
| Ga0187849_13241872 | 3300017929 | Peatland | CRSEKLRADLLKSRLLSKAVLLGSGPLLFGSLLLIVVTALIQA |
| Ga0187853_104226611 | 3300017940 | Peatland | KLRADLLKSRLLSKAVLLGSGPLLFGSLLLIVVTALIQA |
| Ga0184619_101581551 | 3300018061 | Groundwater Sediment | MLRTDLLKPDLVSELVLLGSGTLLFVSLLMIVVTALTRA |
| Ga0066669_102248382 | 3300018482 | Grasslands Soil | MLRADLLKPDLVSELVLLGSGTLLFFLVLVVVTAVARA |
| Ga0193748_10076672 | 3300019865 | Soil | MLRTDLLKPDLVSELVLLGSGTLLFVSVLLIVVTALARP |
| Ga0193723_11621862 | 3300019879 | Soil | MLRADILKPDLVSEVVLLGSGALLVVSLLLIVLTALARA |
| Ga0193747_10514512 | 3300019885 | Soil | MLRADILKPDLVSEVVLLGSGALLAISLLLIVVTALARA |
| Ga0193729_11055431 | 3300019887 | Soil | MLRADLLKPDLLSEIVLLGSGALLFSSLLLIVVTVLTQT |
| Ga0193733_10908961 | 3300020022 | Soil | RRRSEMLRTDLLKPDLVSELVLLGSGTLLFVSLLMIVVTALTRA |
| Ga0210407_113887692 | 3300020579 | Soil | MLRADLLKPDLLSKAVLLGSGALLFGSLLLVVVTAFKRA |
| Ga0210403_1000681312 | 3300020580 | Soil | MLRADLLKPDLLSEIVLLGSGALLFGSLLLIVVIVLTQA |
| Ga0210399_111703302 | 3300020581 | Soil | MLRADLLKPDLLSEIVLLGSGALLFGSLLLLVVIVLTQA |
| Ga0210401_100794524 | 3300020583 | Soil | MLRADLLKADLLSEIVLLGSGVLIVVSLVLVVVAALTRA |
| Ga0215015_104774402 | 3300021046 | Soil | MLRADLLKPDLLSEIVLLGTGALLFGSLLLIVLTALTRA |
| Ga0210406_1000134833 | 3300021168 | Soil | MLRADLLKPDLLSELVLLGTAVLIFVSLVLIVATALNRP |
| Ga0210400_1000133513 | 3300021170 | Soil | MLRADLLKPGLLSKAVLLGSGALLFGSLLLVVVTAFKRA |
| Ga0210405_1000279412 | 3300021171 | Soil | MLRADLLKRDLLSEIVLLGSGALLFGSLLLIVVTVLTQA |
| Ga0210405_100292445 | 3300021171 | Soil | MQRADLLKSDLLSELVLLGGGVLILVSLILIVATALTRV |
| Ga0193719_101288383 | 3300021344 | Soil | MLRADILKPDLVSEVVLLGSGALLVVSLLLIVLTALTRA |
| Ga0210393_113164651 | 3300021401 | Soil | MLRADLLKADLLSEIVLLGSGVAILISLLLIVATVLN |
| Ga0210387_118543862 | 3300021405 | Soil | MLRADLLKPDLLSELVLLGTAVLIFVSLVLILATALNRA |
| Ga0210384_103108863 | 3300021432 | Soil | MLRADLLKPDLLSEIVLLGSGALLFSSLLLIVVIVLAQA |
| Ga0210384_103883022 | 3300021432 | Soil | MLRADLLKPDLLSKAVLLGSGALLFGSLLLVVVTALRRA |
| Ga0210398_100052623 | 3300021477 | Soil | MLRADLLKADLLSEIVLLGSALAILMSLFLIVATVLNHA |
| Ga0210402_103877881 | 3300021478 | Soil | MLRADLLKRDLLSETVLVGSLILLVISLTLIVAVALTST |
| Ga0210402_118574321 | 3300021478 | Soil | PTRRTEMLRADLLKPDLLSELVLLGTAVLIFVSLVLILATALNRA |
| Ga0210410_100668256 | 3300021479 | Soil | MLRADILKPDLLSEIVLLGSGVLLFSSLLLVVVAAFTQA |
| Ga0224557_12819621 | 3300023101 | Soil | LRAEILKPDLLSEIVLLGSGVLLFSSLLLVVVTVLTQA |
| Ga0247542_1006662 | 3300023544 | Soil | MLRADLLKPDRLSKVVLLGSGALLFGSLLLIVATALTRA |
| Ga0207697_103856652 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | RADLLKPDLLSEILLLGTGALILVSVLLVTVTALARP |
| Ga0207688_101267883 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRADLLKPDLLSEIVLLGAGALIFVALLFVTVTALARS |
| Ga0207647_100062626 | 3300025904 | Corn Rhizosphere | MHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS |
| Ga0207684_102995111 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTALTRA |
| Ga0207671_106885653 | 3300025914 | Corn Rhizosphere | SEWEAHMHRADLLKPDLLSEILLLGTGALILVSVLLVTVTALARP |
| Ga0207687_101307732 | 3300025927 | Miscanthus Rhizosphere | MHRADLLKPDLLSEIVLLGAGALIFVALLLVTVTALARS |
| Ga0207701_1001083814 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRADLLKPDLLSEILLLGTGALILVSVLLVTVTALARP |
| Ga0207704_102008364 | 3300025938 | Miscanthus Rhizosphere | MHRADLLKPDLLSEIVLLGTGSLIFVALLLVTVAALMRP |
| Ga0207658_117248321 | 3300025986 | Switchgrass Rhizosphere | VDPSMRRAMHRADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS |
| Ga0207677_102150793 | 3300026023 | Miscanthus Rhizosphere | MHRADLLKPDLLSEIVLLGAGALIFAALLLVTVTALARS |
| Ga0207708_101064501 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RADLLKPDLLSEIVLLGAGALIFAALLFVTVTALARS |
| Ga0207641_1001433410 | 3300026088 | Switchgrass Rhizosphere | MHRADLLKPDLLSEIVLVGTGVLIFVALLLVTVTGLMRP |
| Ga0209240_10268233 | 3300026304 | Grasslands Soil | MLQADLLKPDVLSETVLLGSGALLFVSLLLIVVTALTQA |
| Ga0209580_100047847 | 3300027842 | Surface Soil | MVSPEWESKMLREDLLKPDLLSEIVLISSAALLVISLLMIVVTALARA |
| Ga0209517_1000737116 | 3300027854 | Peatlands Soil | MQRADLLKPDILSEIVLLGSGVLIFVLLLLVVLTALTRA |
| Ga0307504_103699081 | 3300028792 | Soil | MLRLREDLLKPDLLSEVLLLVSGVVLFIPLLLVVVA |
| Ga0074021_15882402 | 3300030775 | Soil | MLCADLLKPDLFSEIVLPGSGALLLGLLLLVVMTALARA |
| Ga0310686_1094863342 | 3300031708 | Soil | MLRADLLKPDLLSEIVLLGSGALLLGSLLLVVMSALARA |
| Ga0310686_1181151911 | 3300031708 | Soil | MLRADLLKPDLLSEIVLLGSGALLFGSLLLIVVSVLTRA |
| Ga0307469_100990353 | 3300031720 | Hardwood Forest Soil | MLRADLLKPDLLSKAVLLGTGAVIFGSLLLIVITVLTRA |
| Ga0307468_1000588032 | 3300031740 | Hardwood Forest Soil | MLRADLLKPDLVSELVLLGSGALLLLSLLLFVVTAVERA |
| Ga0307475_101637702 | 3300031754 | Hardwood Forest Soil | MLRADLLKPDLLSKAVLLDTGALLFGSLLLIVITVLTRA |
| Ga0307473_102284751 | 3300031820 | Hardwood Forest Soil | VLRADLLKPDLVSELVLLGSGALLFFLLLVVVTAVAR |
| Ga0307471_1003709422 | 3300032180 | Hardwood Forest Soil | MLRADLLKPDLVSELVLLGSGALLFFLLLVVVTAVARA |
| Ga0307471_1010850493 | 3300032180 | Hardwood Forest Soil | ADILKPDLVSEVVLLGSGALLVVSLLLIVVTALARA |
| Ga0307472_1025800061 | 3300032205 | Hardwood Forest Soil | MLRADILKPDLVSEVILLGSGALLAVSLLLVVVTALARA |
| Ga0335078_126048181 | 3300032805 | Soil | MLRSELLKPDLLSEIVLLVTGALIFAFLLLIALTALTRA |
| Ga0335077_104923971 | 3300033158 | Soil | MLRADLLKPDLLSKIVLLGSGALIFFSLLLVVVTALTRA |
| Ga0326726_122706521 | 3300033433 | Peat Soil | SAMHRADLLKPDLLSEILLLGSGMLLFGCLLLIVVTALMRI |
| Ga0326723_0412698_108_227 | 3300034090 | Peat Soil | MHRADLLKPDLLSEIVLLGTGALVFVSLLVVAVTALARI |
| ⦗Top⦘ |