| Basic Information | |
|---|---|
| Family ID | F079156 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LNGVAGTGEQDINTPSSFGVINNTVNNPRLVQFALRLNF |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 84.48 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.552 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (10.345 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.586 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01156 | IU_nuc_hydro | 46.55 |
| PF13620 | CarboxypepD_reg | 6.03 |
| PF13414 | TPR_11 | 5.17 |
| PF14559 | TPR_19 | 4.31 |
| PF13176 | TPR_7 | 3.45 |
| PF13432 | TPR_16 | 2.59 |
| PF00578 | AhpC-TSA | 2.59 |
| PF00860 | Xan_ur_permease | 1.72 |
| PF02272 | DHHA1 | 1.72 |
| PF01368 | DHH | 1.72 |
| PF01230 | HIT | 0.86 |
| PF01370 | Epimerase | 0.86 |
| PF01663 | Phosphodiest | 0.86 |
| PF00202 | Aminotran_3 | 0.86 |
| PF13181 | TPR_8 | 0.86 |
| PF13431 | TPR_17 | 0.86 |
| PF09209 | CecR_C | 0.86 |
| PF08818 | DUF1801 | 0.86 |
| PF05598 | DUF772 | 0.86 |
| PF00078 | RVT_1 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 46.55 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.86 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.55 % |
| Unclassified | root | N/A | 3.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001100|JGI12703J13194_102951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 841 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100112030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2563 | Open in IMG/M |
| 3300002568|C688J35102_118003030 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300004080|Ga0062385_10354629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 861 | Open in IMG/M |
| 3300004092|Ga0062389_101424209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 877 | Open in IMG/M |
| 3300004635|Ga0062388_100969580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 823 | Open in IMG/M |
| 3300005437|Ga0070710_11370140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300005587|Ga0066654_10213303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300005591|Ga0070761_10101605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1657 | Open in IMG/M |
| 3300005591|Ga0070761_10942671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 546 | Open in IMG/M |
| 3300005610|Ga0070763_10642804 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005952|Ga0080026_10054359 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005995|Ga0066790_10522470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 507 | Open in IMG/M |
| 3300006028|Ga0070717_11514514 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006052|Ga0075029_100375954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300006172|Ga0075018_10535767 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300006176|Ga0070765_100026351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 4443 | Open in IMG/M |
| 3300009524|Ga0116225_1062244 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300009637|Ga0116118_1247838 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009665|Ga0116135_1063247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
| 3300009700|Ga0116217_10518155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300009759|Ga0116101_1121433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300009824|Ga0116219_10264116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300009826|Ga0123355_11894066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 558 | Open in IMG/M |
| 3300009826|Ga0123355_11909208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 555 | Open in IMG/M |
| 3300010043|Ga0126380_10474674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300010366|Ga0126379_10111451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2461 | Open in IMG/M |
| 3300010373|Ga0134128_11647514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300010376|Ga0126381_103171368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300010379|Ga0136449_100569774 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300011271|Ga0137393_10843002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300012210|Ga0137378_11486942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300012960|Ga0164301_11023184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300013307|Ga0157372_10959148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300014156|Ga0181518_10512270 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300014169|Ga0181531_10966327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300014200|Ga0181526_11044599 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300014489|Ga0182018_10313235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300014495|Ga0182015_10009972 | All Organisms → cellular organisms → Bacteria | 8742 | Open in IMG/M |
| 3300014495|Ga0182015_10154745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1556 | Open in IMG/M |
| 3300014657|Ga0181522_10029127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3043 | Open in IMG/M |
| 3300017933|Ga0187801_10199110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300017940|Ga0187853_10482100 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300017943|Ga0187819_10554320 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300017943|Ga0187819_10619042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300017972|Ga0187781_10031846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3642 | Open in IMG/M |
| 3300017973|Ga0187780_11279299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300018006|Ga0187804_10251099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300018026|Ga0187857_10109716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1336 | Open in IMG/M |
| 3300018062|Ga0187784_10626044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300018085|Ga0187772_10247544 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300018085|Ga0187772_10366731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300018090|Ga0187770_10977123 | Not Available | 681 | Open in IMG/M |
| 3300018433|Ga0066667_12350695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300019260|Ga0181506_1229648 | Not Available | 517 | Open in IMG/M |
| 3300019787|Ga0182031_1446123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1544 | Open in IMG/M |
| 3300020580|Ga0210403_10297390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300021180|Ga0210396_11674497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300021401|Ga0210393_10008172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8209 | Open in IMG/M |
| 3300021404|Ga0210389_10384712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300021406|Ga0210386_11826349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300021407|Ga0210383_11316884 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021474|Ga0210390_10945771 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300021475|Ga0210392_10650869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300021476|Ga0187846_10070670 | Not Available | 1523 | Open in IMG/M |
| 3300021559|Ga0210409_10985017 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300021560|Ga0126371_13227580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300022557|Ga0212123_10937351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300022717|Ga0242661_1025120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300022721|Ga0242666_1046458 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300022721|Ga0242666_1089366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300025929|Ga0207664_11281549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300027168|Ga0208239_1012057 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300027432|Ga0209421_1008487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1928 | Open in IMG/M |
| 3300027648|Ga0209420_1119790 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300027737|Ga0209038_10136545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300027853|Ga0209274_10688912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300027889|Ga0209380_10047890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2427 | Open in IMG/M |
| 3300028037|Ga0265349_1014520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300028566|Ga0302147_10275695 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300028798|Ga0302222_10294839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300028808|Ga0302228_10088904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1453 | Open in IMG/M |
| 3300029907|Ga0311329_10850283 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300029908|Ga0311341_10094212 | Not Available | 2053 | Open in IMG/M |
| 3300029911|Ga0311361_10011088 | All Organisms → cellular organisms → Bacteria | 17796 | Open in IMG/M |
| 3300029944|Ga0311352_11032049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300030041|Ga0302274_10155673 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300030043|Ga0302306_10268876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300030049|Ga0302191_10293757 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300030058|Ga0302179_10420241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300030507|Ga0302192_10440795 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300030618|Ga0311354_10216369 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300030706|Ga0310039_10344979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300031122|Ga0170822_10297765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300031231|Ga0170824_114323242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300031234|Ga0302325_10928961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300031236|Ga0302324_100056130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7031 | Open in IMG/M |
| 3300031236|Ga0302324_100261303 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300031261|Ga0302140_10975839 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031344|Ga0265316_10032189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 4281 | Open in IMG/M |
| 3300031446|Ga0170820_13932100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1429 | Open in IMG/M |
| 3300031474|Ga0170818_113657530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300031525|Ga0302326_10163541 | All Organisms → cellular organisms → Bacteria | 3800 | Open in IMG/M |
| 3300031525|Ga0302326_10575611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1683 | Open in IMG/M |
| 3300031525|Ga0302326_12413248 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031715|Ga0307476_10535058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300031753|Ga0307477_10018206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4794 | Open in IMG/M |
| 3300031823|Ga0307478_10031777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3811 | Open in IMG/M |
| 3300031962|Ga0307479_11507638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300032160|Ga0311301_13001549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300032180|Ga0307471_102268943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300032895|Ga0335074_10386759 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300032895|Ga0335074_10545537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300033888|Ga0334792_024523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2100 | Open in IMG/M |
| 3300033977|Ga0314861_0522425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300034163|Ga0370515_0290857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.34% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.34% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 6.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.45% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.59% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.72% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.86% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.86% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12703J13194_1029511 | 3300001100 | Forest Soil | GTGEQDINTPSSFGVVNNTVNNARLVQFALRLNF* |
| JGIcombinedJ26739_1001120301 | 3300002245 | Forest Soil | AQFFLNGFADTGQQDINTPSSFGVVNNTVNNPRLIQFALRLNF* |
| C688J35102_1180030302 | 3300002568 | Soil | PQFYLGGAGGSGEQDINASSTFGVITNTVNNARLIQFALKLRF* |
| Ga0062385_103546291 | 3300004080 | Bog Forest Soil | FNHPQFFLPGIGNSGQQDINSPASFGVISNTVNNARLIQFALKLNF* |
| Ga0062389_1014242092 | 3300004092 | Bog Forest Soil | LFNHPQYFLAGVAGTGEQDINTPSSFGVINNTVGNPRLVQFALRLNF* |
| Ga0062388_1009695801 | 3300004635 | Bog Forest Soil | WLPGVSGTGEQDIGTQSSFGVISNTVNNPRLIQFALKLSF* |
| Ga0070710_113701402 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | FFNLFNHPQFYMGGAGGSGQQDINASSSFGVITNTVNNARLIQFALSVRF* |
| Ga0066654_102133031 | 3300005587 | Soil | GSGEQDINASSTFGVINNTVNNARLVQFALKLRF* |
| Ga0070761_101016053 | 3300005591 | Soil | NLFNHPQFFLPGVGDTGEQDINTPSSFGVISNTVNNARLIQFALKLKF* |
| Ga0070761_109426711 | 3300005591 | Soil | GLTGVGLLDINVSNPSNFSVLNQQVNNPRLIQFALRLNF* |
| Ga0070763_106428042 | 3300005610 | Soil | FMTGISDSGEQDIGTPSTFGVLNQTVNNPRLIQFALKLKF* |
| Ga0080026_100543591 | 3300005952 | Permafrost Soil | FNLFNHPQFYMGGSGGSGEQDINAPSTFGVINNTVNNARLIQFALKLNF* |
| Ga0066790_105224701 | 3300005995 | Soil | QYYLPGISGTGEQDIGTGSSFGVISQTLNNPRLIQFALKLKF* |
| Ga0070717_115145142 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LFNHPQFYMGGAGGSGEQDINASSTFGVINNTVNNARLIQFALKLRF* |
| Ga0075029_1003759541 | 3300006052 | Watersheds | NLFNHPQFYMGGAGGSGEQDINASSTFGVINNTVNNARLIQFGLKLNF* |
| Ga0075018_105357672 | 3300006172 | Watersheds | LGGSSGNGLQDVDSPATFGVANATVNNPRLIQFALKLRF* |
| Ga0070765_1000263511 | 3300006176 | Soil | QGGSGTGEQDVNSPSTYGVVTGTVNNPRLVQFALKLKF* |
| Ga0116225_10622442 | 3300009524 | Peatlands Soil | LQGAGGTGEMDINTPSSFGVINNTVNNPRLIQFAFKLKF* |
| Ga0116118_12478382 | 3300009637 | Peatland | YWMPGISGTGEQDIGTTSSFGVISSTVNNPRLVQFALKLKF* |
| Ga0116135_10632471 | 3300009665 | Peatland | YGDAGQQDINTPSSFGVVNNTVNNPRLIQFALRLNF* |
| Ga0116217_105181552 | 3300009700 | Peatlands Soil | QFATPTTDLAAGPLFGVINQSVNNPRLIQFALKLRF* |
| Ga0116101_11214331 | 3300009759 | Peatland | LNGVAGTGEQDINTPSSFGVINNTVNNPRLVQFALRLNF* |
| Ga0116219_102641162 | 3300009824 | Peatlands Soil | GGLGNSGQQDINTPSSFGVINNTVNNPRLVQFALRLAF* |
| Ga0123355_118940661 | 3300009826 | Termite Gut | NLLNHPQFFLPGVGDTGEQDINTPSSFGVISGTVNNPRLVQFALKFAF* |
| Ga0123355_119092081 | 3300009826 | Termite Gut | NLLNHPQFFLPGVGDTGEQDINTPSSFGVISGTVNNPRLVQLALKFAF* |
| Ga0126380_104746742 | 3300010043 | Tropical Forest Soil | FNLFNHPQFYLGGTGGTGEQDINALSTFGVINNTVNNARLIQFALKLRF* |
| Ga0126379_101114511 | 3300010366 | Tropical Forest Soil | NLFNHPQFYMGGAGGSGQQDINASSSFGVINNTVNNARLIQFALKLNF* |
| Ga0134128_116475141 | 3300010373 | Terrestrial Soil | GSGQQDINASSTFGVINNTVNNARLIQFALKLRF* |
| Ga0126381_1031713682 | 3300010376 | Tropical Forest Soil | FNVFNHPQYFLGGSSGNGLQDVDSFATFGVANNTVNNPRLVQFALKLQF* |
| Ga0136449_1005697741 | 3300010379 | Peatlands Soil | AGTGEMDINSPSSFGVINNTVNNPRLVQFALKLKF* |
| Ga0137393_108430021 | 3300011271 | Vadose Zone Soil | SSLTGQQDLNAPSSFGRVTQTVNNPRLIQFALKLNF* |
| Ga0137378_114869421 | 3300012210 | Vadose Zone Soil | NHPQFYMGGAGGSGEQDINASSTFGVINNTVNNARLIQFALKLRF* |
| Ga0164301_110231841 | 3300012960 | Soil | PQFYLGGAGGSGEQDINAPASFGVINNTVNNARLIQFALKLTF* |
| Ga0157372_109591482 | 3300013307 | Corn Rhizosphere | AGGSGQQDINASSSFGVINNTVNNARLVQFALKLRF* |
| Ga0181518_105122701 | 3300014156 | Bog | GISGTGEQDIGTQSSFGVINSTVNNPRLVQFALKLNF* |
| Ga0181531_109663272 | 3300014169 | Bog | GDTGEQDINTPSSFGVVNATVNNPRLIQFALKLNF* |
| Ga0181526_110445992 | 3300014200 | Bog | FNHPQFFIGGLTGVGLLDINVANPNNFSVLNQQVNNPRLVQFALRLNF* |
| Ga0182018_103132352 | 3300014489 | Palsa | LNGLGGTEGEQDINTPSSFGVVNNTVNNPRLVQFALRLNF* |
| Ga0182015_100099726 | 3300014495 | Palsa | EFFNLLNHAQFYLNGYADTGEQDISTPSSFGVVNNTVNNPRLIQFALRLNF* |
| Ga0182015_101547451 | 3300014495 | Palsa | GFADTGEQDINTPSSFGVVNNTVNNPRLIQFALRLNF* |
| Ga0181522_100291274 | 3300014657 | Bog | FFNLLNHSQYWLSGVSGTGEQDVNTPSSFGVISQTLNNPRLIQFALKLQF* |
| Ga0187801_101991101 | 3300017933 | Freshwater Sediment | NHPQFFMGGIADLGEQDINSPSSFGVINQTLNNPRLVQFGLRLNF |
| Ga0187853_104821002 | 3300017940 | Peatland | GISGTGEQDIGTQSSFGVINSTVNNPRLVQFALKLNF |
| Ga0187819_105543202 | 3300017943 | Freshwater Sediment | FFNILNHPQFFMGGVSDTGEQDINTPSNFGVVNQTVNNPRDVQFALRLKF |
| Ga0187819_106190422 | 3300017943 | Freshwater Sediment | PGVGDTGEQDVNTSSSFGVINQTVNNPRVIQFALKLKF |
| Ga0187781_100318466 | 3300017972 | Tropical Peatland | FYMTGIGDTGEQDINTASTFGVINQTVGNPRLMQFALRLNF |
| Ga0187780_112792991 | 3300017973 | Tropical Peatland | NLLNHPQYFLQGAAGTGEMDINSPSSFGVINNTVNNPRLIQFALRLNF |
| Ga0187804_102510992 | 3300018006 | Freshwater Sediment | QYFLQGAAGTGMMDINSPSSFGVVNNTVNNPRLVQFALKLKF |
| Ga0187857_101097162 | 3300018026 | Peatland | ISGTGEQDIGTQSSFGVINSTVNNPRLVQFALKLNF |
| Ga0187784_106260441 | 3300018062 | Tropical Peatland | PQYFLPGVSATGEQDINTPSSFGVISETVNNPRLIQFALKLKF |
| Ga0187772_102475441 | 3300018085 | Tropical Peatland | NHPQYWMAGISGTGEQDINTPSSFAKITQTLNNPRLVQFALKLQF |
| Ga0187772_103667311 | 3300018085 | Tropical Peatland | VSDTGEQDINTPSNFGVVNQTVNNPRDVQFSLRLKF |
| Ga0187770_109771233 | 3300018090 | Tropical Peatland | MAGISGTGEQDIGSPSSFAKITQTLSDPFGSRVMQFALKLNF |
| Ga0066667_123506952 | 3300018433 | Grasslands Soil | GGAGGSGQQDINASSSFGVINNTVNNARLIQFALSLRF |
| Ga0181506_12296482 | 3300019260 | Peatland | FNLFNHPQFFLSGVGGTGEQDINTSSSFGVINNTVGNPRLVQFALRLNF |
| Ga0182031_14461233 | 3300019787 | Bog | MNGISATGEQDIGTPSSFGVLNGTVNNPRLVQLALKLKF |
| Ga0210403_102973901 | 3300020580 | Soil | PQLYLQGGSGTGEQDINSTATFGVVTGTVNNPRLIQFALKLRF |
| Ga0210396_116744971 | 3300021180 | Soil | PQLYLQGGSGTGEQDINSQATFGVVTGTVNNPRLIQFALKLRF |
| Ga0210393_100081721 | 3300021401 | Soil | HAQFFLNGFADTGQQDINTPSSFGVVNNTVNNPRLIQFALRLNF |
| Ga0210389_103847121 | 3300021404 | Soil | FFNLFNHAQFYLNGVGDTGEQDINTPSSFGVINNTVNNPRLIQFALRLNF |
| Ga0210386_118263492 | 3300021406 | Soil | FLQGAGGTGEQDINTPSSFGVINNTVNNPRLIQLALKLRF |
| Ga0210383_113168841 | 3300021407 | Soil | GISNTGEQDIGSPSSFGVISNIVNNPRLIQFALKLTF |
| Ga0210390_109457711 | 3300021474 | Soil | NFLNHPQYFLAGLGDTGQQDINSPSSFGVINQTLNNSRDIQFALRLNF |
| Ga0210392_106508692 | 3300021475 | Soil | LQGGSGTGEQDVNSSSTYGVVTGTVNNPRLIQFALRLNF |
| Ga0187846_100706701 | 3300021476 | Biofilm | GSPLTTMQDISSPSTFGKVTATTNNPRLIQFALKLTF |
| Ga0210409_109850172 | 3300021559 | Soil | FFNLFNHPQFFMGGIADLGEQDINTTSSFGVINQQLNNPRLIQFALRLNF |
| Ga0126371_132275802 | 3300021560 | Tropical Forest Soil | LYLQGGSGTGEQDVNSPATFGVVTGTVNNPRLIQFGLKLNF |
| Ga0212123_109373511 | 3300022557 | Iron-Sulfur Acid Spring | QFFLNGVAGSGQQDINTPSSFGVVNNTVNNPRLVQFALKVLF |
| Ga0242661_10251202 | 3300022717 | Soil | FNHPQLYLQGGSGTGEQDINSSATFGVVTGTVNNPRLIQFGLKLKF |
| Ga0242666_10464582 | 3300022721 | Soil | FNLFNHPQFFLGGLGGIGLQDINGPSTFGVLNQQVNNPRLVQFALRLNF |
| Ga0242666_10893661 | 3300022721 | Soil | NHPQYYLAGAAGTGEMDINSTSSFGVINNTVNNPRLIQFGLKVTF |
| Ga0207664_112815492 | 3300025929 | Agricultural Soil | PQFYMGGAGGSGEQDINASSTFGVINNTVNNARLIQFALKLRF |
| Ga0208239_10120572 | 3300027168 | Forest Soil | FFLGGLGGIGLQDINGPSTFGVLNQQVNNPRLVQFALRLNF |
| Ga0209421_10084872 | 3300027432 | Forest Soil | FLEGAGGTGEQDINSPSSFGVINNTVNNPRLVQFALKLKF |
| Ga0209420_11197901 | 3300027648 | Forest Soil | YMNGYADTGEQDINTSSSFGVVNNTVNNPRLIQFALRLNF |
| Ga0209038_101365451 | 3300027737 | Bog Forest Soil | YLNGYADTGEQDINTSSSFGVVNNTVNNPRLIQFALRLNF |
| Ga0209274_106889121 | 3300027853 | Soil | NLFNHPQFYMDGLGDTGQQDINTPSSFGVINNTVNNPRLVQFALRLAF |
| Ga0209380_100478903 | 3300027889 | Soil | QFYLDGYGDTGEQDINTSSSFGVVNNTVNNPRLIQFALKLNF |
| Ga0265349_10145202 | 3300028037 | Soil | NGLGGTGEQDINTPTSFGVINQTVNNPRLIQFALRLNF |
| Ga0302147_102756951 | 3300028566 | Bog | QFYMGGIEDTGAQDINTPSSFGIINQTLNNPRLIQFALRLNF |
| Ga0302222_102948392 | 3300028798 | Palsa | GLGGTEGEQDIDTPSSFGVVNNTVNNPRLVQFALRLNF |
| Ga0302228_100889041 | 3300028808 | Palsa | NGYADTGEQDINTSSSFGVVNNTVNNPRLIQFALRLNF |
| Ga0311329_108502832 | 3300029907 | Bog | PQFYMGGIEDTGAQDINTPSSFGIINQTLNNPRLIQFALRLNF |
| Ga0311341_100942123 | 3300029908 | Bog | HAQFFLNGASDSGEQDINTPSSFGVVNNTVNNPRLVQFALRLNF |
| Ga0311361_100110881 | 3300029911 | Bog | AEFFNLFNHPQFYMGGIGDTGQQDINSPSSFGVINQTLNNPRLIQFALRLNF |
| Ga0311352_110320491 | 3300029944 | Palsa | YGAPIADINEGSLFGKVNSTVNNPRLVQLALKLSF |
| Ga0302274_101556732 | 3300030041 | Bog | FFNLFNHPQFYMGGIEDTGAQDINTPSSFGIINQTLNNPRLIQFALRLNF |
| Ga0302306_102688761 | 3300030043 | Palsa | YLSGLGDSGQQDINTPSSFGVINNTVNNPRLIQFALRLAF |
| Ga0302191_102937572 | 3300030049 | Bog | FYMGGIGDTGQQDINSPSSFGVINQTLNNPRLIQFALRLNF |
| Ga0302179_104202412 | 3300030058 | Palsa | HPQFYLSGLGDSGQQDINTPSSFGVINNTVNNPRLIQFALRLAF |
| Ga0302192_104407951 | 3300030507 | Bog | QFYMGGIGDTGQQDINSPSSFGVINQTLNNPRLIQFALRLNF |
| Ga0311354_102163692 | 3300030618 | Palsa | NHPQYYLQGAAGTGMMDISSPSSFGVINNTVNNPRLVQFALKLKF |
| Ga0310039_103449791 | 3300030706 | Peatlands Soil | GNSGQQDINTPSSFGVINNTVNNPRLVQFALRLAF |
| Ga0170822_102977652 | 3300031122 | Forest Soil | GGSGTGEQDVNSSSTYGVVTGTVNNPRLIQFALRLNF |
| Ga0170824_1143232422 | 3300031231 | Forest Soil | LQGGSGTGEQDLNSSSTYGVVTGTVNNPRLIQFALKLNF |
| Ga0302325_109289612 | 3300031234 | Palsa | PQYFLQGAAGTGEQDINTTSSFGVINNTVNNPRLVQFALKLKF |
| Ga0302324_1000561301 | 3300031236 | Palsa | NHAQFYLNGLGGTEGEQDINTPSSFGVVNNTVNNPRLIQFALRLNF |
| Ga0302324_1002613033 | 3300031236 | Palsa | LNGLGGTEGEQDINTPSSFGVVNNTVNNPRLIQFALRLNF |
| Ga0302140_109758391 | 3300031261 | Bog | EFFNLFNHPQFYMGGIGDTGEQDINSPSSFGVINQTLNNPRLIQFALRLNF |
| Ga0265316_100321895 | 3300031344 | Rhizosphere | MGGAGGSGQQDINAPSTFGVINNTVNNARLIQFALKLRF |
| Ga0170820_139321001 | 3300031446 | Forest Soil | GAGGSGEQDINASSTFGVINNTVNNARLIQFALKLRF |
| Ga0170818_1136575301 | 3300031474 | Forest Soil | GAGNGEQDINAQSTFGVITNTLNNARLIQFALKLRF |
| Ga0302326_101635414 | 3300031525 | Palsa | GLGGTEGEQDINTPSSFGVVNNTVNNPRLIQFALRLNF |
| Ga0302326_105756111 | 3300031525 | Palsa | LQGAAGTGEQDINTTSSFGVINNTVNNPRLVQFALKLKF |
| Ga0302326_124132481 | 3300031525 | Palsa | GIEDTGAQDINTPSSFGIINQTLNNPRLIQFALRLNF |
| Ga0307476_105350581 | 3300031715 | Hardwood Forest Soil | ISGTGEQDIGTTSSFGVISSTVNNPRLVQFALKLKF |
| Ga0307477_100182061 | 3300031753 | Hardwood Forest Soil | FYLGGSGGTGEQDINAPSTFGIINNTVNNARLIQFALKLRF |
| Ga0307478_100317778 | 3300031823 | Hardwood Forest Soil | NFLNHPQYFLGGLGDTGQQDINSPTSFGVINQTLNNSRDIQFALRLNF |
| Ga0307479_115076381 | 3300031962 | Hardwood Forest Soil | SGGTGEQDINAPSTFGIINNTVNNARLIQFALKLRF |
| Ga0311301_130015492 | 3300032160 | Peatlands Soil | YLQGGSGTGEQDIHSTATFGVVTGTVNNPRLIQFALKLRF |
| Ga0307471_1022689432 | 3300032180 | Hardwood Forest Soil | SSLTAMQDINASSSFGKVTATVNNPRLVQFALKLTF |
| Ga0335074_103867592 | 3300032895 | Soil | AQYYLDGYADTGEQDINTPSSFGVLNNIVNNPRLVQFALRLNF |
| Ga0335074_105455371 | 3300032895 | Soil | FLDGLGDSGEQDINTPSSFGVINNTVNNPRLVQFALKLKF |
| Ga0334792_024523_22_141 | 3300033888 | Soil | MDGLGDSGQQDINTPSSFGVINNTVNNPRLVQFALRLAF |
| Ga0314861_0522425_1_126 | 3300033977 | Peatland | YFLQGAAGTGEMDINTPSSFGVINNTVNNPRLIQFALKLKF |
| Ga0370515_0290857_2_139 | 3300034163 | Untreated Peat Soil | NHPQFFLSGVGGTGEQDINTTSSFGVINNTVGNPRLVQFALRLNF |
| ⦗Top⦘ |