| Basic Information | |
|---|---|
| Family ID | F079152 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MAANAEIFFEHDRWGRNLTWSLGLHIAVAGAIVLYAVVAP |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 45.69 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.93 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.862 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.517 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.966 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.897 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF02472 | ExbD | 71.55 |
| PF01618 | MotA_ExbB | 20.69 |
| PF13476 | AAA_23 | 4.31 |
| PF07978 | NIPSNAP | 0.86 |
| PF02401 | LYTB | 0.86 |
| PF05016 | ParE_toxin | 0.86 |
| PF02463 | SMC_N | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 71.55 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.86 % |
| All Organisms | root | All Organisms | 49.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101749351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1221 | Open in IMG/M |
| 3300001593|JGI12635J15846_10117418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1884 | Open in IMG/M |
| 3300001686|C688J18823_10810549 | Not Available | 594 | Open in IMG/M |
| 3300004082|Ga0062384_100678171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 707 | Open in IMG/M |
| 3300004082|Ga0062384_100700607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 697 | Open in IMG/M |
| 3300004091|Ga0062387_100828731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 692 | Open in IMG/M |
| 3300004091|Ga0062387_101096771 | Not Available | 617 | Open in IMG/M |
| 3300004157|Ga0062590_101245814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 729 | Open in IMG/M |
| 3300004480|Ga0062592_102599426 | Not Available | 511 | Open in IMG/M |
| 3300005439|Ga0070711_101049468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 701 | Open in IMG/M |
| 3300005447|Ga0066689_10352979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 917 | Open in IMG/M |
| 3300005455|Ga0070663_100018484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4572 | Open in IMG/M |
| 3300005526|Ga0073909_10603355 | Not Available | 542 | Open in IMG/M |
| 3300005536|Ga0070697_101538800 | Not Available | 595 | Open in IMG/M |
| 3300005541|Ga0070733_10639899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 713 | Open in IMG/M |
| 3300005541|Ga0070733_10881502 | Not Available | 601 | Open in IMG/M |
| 3300005545|Ga0070695_100092121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2025 | Open in IMG/M |
| 3300005569|Ga0066705_10011347 | All Organisms → cellular organisms → Bacteria | 4260 | Open in IMG/M |
| 3300005842|Ga0068858_101344858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 703 | Open in IMG/M |
| 3300005891|Ga0075283_1057843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 677 | Open in IMG/M |
| 3300005921|Ga0070766_10070302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2014 | Open in IMG/M |
| 3300006050|Ga0075028_100359640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 824 | Open in IMG/M |
| 3300006102|Ga0075015_100382011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 791 | Open in IMG/M |
| 3300006172|Ga0075018_10673359 | Not Available | 557 | Open in IMG/M |
| 3300006804|Ga0079221_11755080 | Not Available | 507 | Open in IMG/M |
| 3300006806|Ga0079220_10462697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 853 | Open in IMG/M |
| 3300006893|Ga0073928_10928610 | Not Available | 595 | Open in IMG/M |
| 3300009012|Ga0066710_100045068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5379 | Open in IMG/M |
| 3300009088|Ga0099830_11626707 | Not Available | 538 | Open in IMG/M |
| 3300009090|Ga0099827_10297716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1364 | Open in IMG/M |
| 3300009521|Ga0116222_1063960 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300009521|Ga0116222_1365181 | Not Available | 626 | Open in IMG/M |
| 3300009700|Ga0116217_10989306 | Not Available | 515 | Open in IMG/M |
| 3300010339|Ga0074046_10348676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 902 | Open in IMG/M |
| 3300010359|Ga0126376_10479120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1146 | Open in IMG/M |
| 3300011119|Ga0105246_10039851 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
| 3300011119|Ga0105246_12574484 | Not Available | 502 | Open in IMG/M |
| 3300011120|Ga0150983_13432207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1228 | Open in IMG/M |
| 3300012189|Ga0137388_10882610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 827 | Open in IMG/M |
| 3300012208|Ga0137376_11809108 | Not Available | 501 | Open in IMG/M |
| 3300012351|Ga0137386_10192364 | Not Available | 1465 | Open in IMG/M |
| 3300012685|Ga0137397_10986017 | Not Available | 621 | Open in IMG/M |
| 3300012927|Ga0137416_10788737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 839 | Open in IMG/M |
| 3300012985|Ga0164308_10575908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 954 | Open in IMG/M |
| 3300013297|Ga0157378_12745116 | Not Available | 545 | Open in IMG/M |
| 3300013503|Ga0120127_10061460 | Not Available | 775 | Open in IMG/M |
| 3300014164|Ga0181532_10239296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1047 | Open in IMG/M |
| 3300014489|Ga0182018_10492968 | Not Available | 648 | Open in IMG/M |
| 3300014654|Ga0181525_10030516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3221 | Open in IMG/M |
| 3300015052|Ga0137411_1265817 | Not Available | 635 | Open in IMG/M |
| 3300017822|Ga0187802_10201974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 764 | Open in IMG/M |
| 3300017943|Ga0187819_10104827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1689 | Open in IMG/M |
| 3300017961|Ga0187778_10650529 | Not Available | 710 | Open in IMG/M |
| 3300017972|Ga0187781_11182766 | Not Available | 562 | Open in IMG/M |
| 3300017975|Ga0187782_10666937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 801 | Open in IMG/M |
| 3300017995|Ga0187816_10334176 | Not Available | 668 | Open in IMG/M |
| 3300017995|Ga0187816_10506567 | Not Available | 544 | Open in IMG/M |
| 3300018006|Ga0187804_10162760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 943 | Open in IMG/M |
| 3300018006|Ga0187804_10465318 | Not Available | 565 | Open in IMG/M |
| 3300018086|Ga0187769_10597169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 834 | Open in IMG/M |
| 3300018090|Ga0187770_10509984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 952 | Open in IMG/M |
| 3300018090|Ga0187770_11206970 | Not Available | 612 | Open in IMG/M |
| 3300019278|Ga0187800_1834189 | Not Available | 656 | Open in IMG/M |
| 3300019284|Ga0187797_1233671 | Not Available | 695 | Open in IMG/M |
| 3300019786|Ga0182025_1002729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1901 | Open in IMG/M |
| 3300020579|Ga0210407_11115668 | Not Available | 597 | Open in IMG/M |
| 3300020581|Ga0210399_11165962 | Not Available | 613 | Open in IMG/M |
| 3300020581|Ga0210399_11290713 | Not Available | 575 | Open in IMG/M |
| 3300020583|Ga0210401_10161571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2091 | Open in IMG/M |
| 3300021080|Ga0210382_10428823 | Not Available | 586 | Open in IMG/M |
| 3300021168|Ga0210406_10844584 | Not Available | 693 | Open in IMG/M |
| 3300021171|Ga0210405_10197019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1597 | Open in IMG/M |
| 3300021178|Ga0210408_10307960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1263 | Open in IMG/M |
| 3300021178|Ga0210408_10583376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 886 | Open in IMG/M |
| 3300021181|Ga0210388_11343223 | Not Available | 602 | Open in IMG/M |
| 3300021403|Ga0210397_11038490 | Not Available | 636 | Open in IMG/M |
| 3300021407|Ga0210383_10754423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 835 | Open in IMG/M |
| 3300021420|Ga0210394_10626199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 945 | Open in IMG/M |
| 3300021420|Ga0210394_11315758 | Not Available | 617 | Open in IMG/M |
| 3300021432|Ga0210384_11426875 | Not Available | 597 | Open in IMG/M |
| 3300021475|Ga0210392_10258801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1235 | Open in IMG/M |
| 3300021478|Ga0210402_11254114 | Not Available | 668 | Open in IMG/M |
| 3300021479|Ga0210410_10071586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3040 | Open in IMG/M |
| 3300021559|Ga0210409_10013751 | All Organisms → cellular organisms → Bacteria | 8036 | Open in IMG/M |
| 3300022557|Ga0212123_10693284 | Not Available | 628 | Open in IMG/M |
| 3300025134|Ga0207416_1107909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 988 | Open in IMG/M |
| 3300025900|Ga0207710_10609165 | Not Available | 571 | Open in IMG/M |
| 3300025903|Ga0207680_10016088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3919 | Open in IMG/M |
| 3300025916|Ga0207663_11205909 | Not Available | 609 | Open in IMG/M |
| 3300025922|Ga0207646_10156384 | Not Available | 2056 | Open in IMG/M |
| 3300025922|Ga0207646_11474646 | Not Available | 590 | Open in IMG/M |
| 3300025929|Ga0207664_11974412 | Not Available | 506 | Open in IMG/M |
| 3300025936|Ga0207670_10983384 | Not Available | 709 | Open in IMG/M |
| 3300025939|Ga0207665_10746158 | Not Available | 771 | Open in IMG/M |
| 3300026214|Ga0209838_1024815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300026291|Ga0209890_10252307 | Not Available | 548 | Open in IMG/M |
| 3300027570|Ga0208043_1163636 | Not Available | 575 | Open in IMG/M |
| 3300027610|Ga0209528_1092058 | Not Available | 670 | Open in IMG/M |
| 3300027610|Ga0209528_1093560 | Not Available | 664 | Open in IMG/M |
| 3300027643|Ga0209076_1186058 | Not Available | 573 | Open in IMG/M |
| 3300027648|Ga0209420_1028253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1766 | Open in IMG/M |
| 3300027651|Ga0209217_1114889 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300027795|Ga0209139_10196197 | Not Available | 714 | Open in IMG/M |
| 3300027884|Ga0209275_10895992 | Not Available | 511 | Open in IMG/M |
| 3300027915|Ga0209069_10666828 | Not Available | 607 | Open in IMG/M |
| 3300028013|Ga0265350_106911 | Not Available | 567 | Open in IMG/M |
| 3300030002|Ga0311350_11044639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 730 | Open in IMG/M |
| 3300030760|Ga0265762_1046806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 859 | Open in IMG/M |
| 3300031090|Ga0265760_10002735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5163 | Open in IMG/M |
| 3300031233|Ga0302307_10382659 | Not Available | 716 | Open in IMG/M |
| 3300031962|Ga0307479_11199760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 722 | Open in IMG/M |
| 3300032160|Ga0311301_10751701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1354 | Open in IMG/M |
| 3300032421|Ga0310812_10478026 | Not Available | 561 | Open in IMG/M |
| 3300032828|Ga0335080_10205286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2166 | Open in IMG/M |
| 3300032829|Ga0335070_11380510 | Not Available | 644 | Open in IMG/M |
| 3300032955|Ga0335076_11283318 | Not Available | 617 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.31% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.86% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.86% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.86% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.86% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028013 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1017493513 | 3300000364 | Soil | MPASTEIFFEHDRWGRNLSWSAVLHIGVAASIVAYAVIAPANRGEGWGAGGGGDAIGVTL |
| JGI12635J15846_101174181 | 3300001593 | Forest Soil | MEANAEIFFEHDQWGRNLAWSVALHIAVVASIILYAVVAPGGSGSTWGAGG |
| C688J18823_108105491 | 3300001686 | Soil | MESHAEIFFEHERWGRNLAWSVGLHVLVAGCIVGYAIVAPASRGSDWGAGGGGDA |
| Ga0062384_1006781711 | 3300004082 | Bog Forest Soil | MEANAEIFFEHDRWGRNLAWSAGLHVAVAVCIILYAVIWHGGSGSAWGAGG |
| Ga0062384_1007006073 | 3300004082 | Bog Forest Soil | METNAEIFFEHDRWGHNVAWSVALHILVAGSIVLYAAVASGGRRETWGIGG |
| Ga0062387_1008287313 | 3300004091 | Bog Forest Soil | MAANAEIFFEHDRWGRNLTWSLGLHIAVAGAIVLYAVVAP |
| Ga0062387_1010967712 | 3300004091 | Bog Forest Soil | MAASAEIFFEHERWGRNLAWSAGFHVAIAVCIIGYAVVVHTGGGTWGTGGG |
| Ga0062590_1012458141 | 3300004157 | Soil | MASSAEIFFEHDRWARNLTWSAVLHVAIAAAIVGYAVFAPSNSGSGWGAG |
| Ga0062592_1025994261 | 3300004480 | Soil | MAANAEIFFEHDRWGRNLSWSLGLHIAIAGAIVLYAVVAPSSSGE |
| Ga0070711_1010494681 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANAEIFFEHDRWGRNLTWSLVLHVAVAGSILLYAVVLPSRH |
| Ga0066689_103529791 | 3300005447 | Soil | MAANAEIFFEHGPWGRALAWSVGLHVAFAAFIVLYAVIIPATS |
| Ga0070663_1000184841 | 3300005455 | Corn Rhizosphere | MAANAEIFFEHDRWGRNLSWSLGLHIAIAGAIVLYAVVAPSSSGEGWG |
| Ga0073909_106033552 | 3300005526 | Surface Soil | MAANAEIFFEHDRWGRNLTWSLVLHIAVAGFILLYAVVI |
| Ga0070697_1015388002 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANAEIFFEHDRWGRNLTWSLVLHLAVAGSILLYAVVAPSSHGEGWGAGGG |
| Ga0070733_106398991 | 3300005541 | Surface Soil | MDPNAEIFFEHDRWGRNLAWSAGFHVAVAGAIVLYA |
| Ga0070733_108815022 | 3300005541 | Surface Soil | MAATEIFFEHDQWGRNLAWSAGLHTAVVAVIVFWAVVLPGSHGSDWG |
| Ga0070695_1000921214 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANAEIFFEHDRWGRNLSWSLGLHIAIAGAIVLYAVVAPSSSGEGWGAGGGG |
| Ga0066705_100113478 | 3300005569 | Soil | MAANAEIFFEHERWGRNLTWSLILHIAVAGSIILYAAVV |
| Ga0068858_1013448583 | 3300005842 | Switchgrass Rhizosphere | MPASTEIFFEHDRWGRNLSWSAVLHIGVAASIVAYAVIAPANRGEGWGAGGG |
| Ga0075283_10578433 | 3300005891 | Rice Paddy Soil | MAANAEIFFEHGDLGKPLAWSVALHIAFTLAIIGYAVIVPGGTGETWGAG |
| Ga0070766_100703024 | 3300005921 | Soil | MEANAEIFFEHDNWARNLAWSAVLHLAVAGSIILYAVVWHGSGGS |
| Ga0075028_1003596401 | 3300006050 | Watersheds | MEANAEIFFEHERWGRNLTWSLALHVAVAGSIILY |
| Ga0075015_1003820113 | 3300006102 | Watersheds | MAANAEIFLEHGEWRKPLTWSAVLHVAVTGAIVLYAT |
| Ga0075018_106733592 | 3300006172 | Watersheds | MAANAEIFFEHDRWGRNLTWSLGLHIAITGAIVLYAVVVPSSHGE |
| Ga0079221_117550801 | 3300006804 | Agricultural Soil | MAAAEIFFEHERWGRNLAWSAGFHLVVATSILAYSVIAPGGRGEG |
| Ga0079220_104626973 | 3300006806 | Agricultural Soil | MAANAEIFFEHDRWGRNLSWSLGLHLAIAGAIVLYAVVAPSSSGEGWGAGGGGDA |
| Ga0073928_109286102 | 3300006893 | Iron-Sulfur Acid Spring | MEANAEIFFEHDQWGRNLAWSVALHIAVVASIILYAVVAPGGS |
| Ga0066710_1000450681 | 3300009012 | Grasslands Soil | MAANAEIFFEHGPWGRALAWSVGLHVAFAAFIVLYAVIIPATSGQGWGA |
| Ga0099830_116267071 | 3300009088 | Vadose Zone Soil | MQASAEIFFEHERWGRNLAWSAGLHVAVVGTIILYAAFASGGRGQG |
| Ga0099827_102977161 | 3300009090 | Vadose Zone Soil | MAANAEIFFEHERWGHNLAWSLALHVVVTGGILLYSTI |
| Ga0116222_10639604 | 3300009521 | Peatlands Soil | MEANAEIFFEHDRWVRNLTWSVALHLAVAGSIVLYAVIAHGGSGSTWGAGG |
| Ga0116222_13651812 | 3300009521 | Peatlands Soil | MAANAEIFFERDSWGRNLAWSAGLHVVFTAAIVLYAMISPGGES |
| Ga0116217_109893062 | 3300009700 | Peatlands Soil | MAANAEIFFEHDRWGRNLAWSAGLHVAIAGSIVLYAVF |
| Ga0074046_103486761 | 3300010339 | Bog Forest Soil | MEANAEIFFEHDRWGRNLAWSVALHAAVAGSIVLYALIGPGGHGSTWGAG |
| Ga0126376_104791201 | 3300010359 | Tropical Forest Soil | MANAEIFFEHERWGRNLSWSLGLHIGIAAAIVLYAALANSRNSTW |
| Ga0105246_100398511 | 3300011119 | Miscanthus Rhizosphere | MAANAEIFFEHDRWGRNLSWSLGLHIAIAGAIVLYA |
| Ga0105246_125744842 | 3300011119 | Miscanthus Rhizosphere | MASSAEIFFEHDRWARNLTWSAVLHVAIAAAIVGYAVFAPSNSG |
| Ga0150983_134322071 | 3300011120 | Forest Soil | MAANAEIFFEHDRWSRNLAWSAALHIAVAGSIVLYAVVGPGGSGSNW |
| Ga0137388_108826103 | 3300012189 | Vadose Zone Soil | MAANAEIFFEHDRWGRNLTWSLGLHIAIAGAIVLYAVVAPSSHGEGWGAGGGG |
| Ga0137376_118091081 | 3300012208 | Vadose Zone Soil | MAAAEIFFEHERWGRNLAWSAGFHIAIAASILAYTVIAPGSR |
| Ga0137386_101923641 | 3300012351 | Vadose Zone Soil | MAANAEIFFEHGPWGRALAWSVGLHVAFAAFIVLYAVIIPATSGQGWGAG |
| Ga0137397_109860173 | 3300012685 | Vadose Zone Soil | MAANAEIFFEHDRWGRNLTWSLGLHIAIVGAIVLYAVV |
| Ga0137416_107887371 | 3300012927 | Vadose Zone Soil | MAANAEIFFEHGPWGRALAWSVGLHMAFAAFIVLYAVIIPATSGQGWGAGGGGEAM |
| Ga0164308_105759081 | 3300012985 | Soil | VASAEIYFEHDRWGRNLTWSLVLHIAVAGFILLYAVV |
| Ga0157378_127451161 | 3300013297 | Miscanthus Rhizosphere | MAANAEIFFEHDRWGRNLTWSLGLHIAIAGAIVLYAVVAPNSHGDSW |
| Ga0120127_100614602 | 3300013503 | Permafrost | MATAEIFFEHERWGRNLAWSAGFHLAVAASILAYSVIAPASRGEGWGAGGGGDAIGVTLV |
| Ga0181532_102392963 | 3300014164 | Bog | MEANAEIFFEHDKWGRNLAWSAGLHIAVAGSIILYAAVASSGKGSA |
| Ga0182018_104929683 | 3300014489 | Palsa | MAANAEIFFEHDRWGRNLAWSLTLHLAVVVAIVLYTVIAPGGGTTWG |
| Ga0181525_100305164 | 3300014654 | Bog | MEANAEIFFEHERWGRALGWSAAFHVAVAAVILVYTMVA |
| Ga0137411_12658171 | 3300015052 | Vadose Zone Soil | MAANAEIFFEHDRWGRNLTWTWSLGLHIAIVGAIVLYAVVAPGSHG |
| Ga0187802_102019741 | 3300017822 | Freshwater Sediment | MESNAEIFFEHDRWGHNLGWSVALHIAVAGSIVLYA |
| Ga0187819_101048271 | 3300017943 | Freshwater Sediment | MEANAEIFFEHDRWGRNLGWSVALHAAFAGFVVLYTVVVPGGHGGTWGA |
| Ga0187778_106505293 | 3300017961 | Tropical Peatland | MAANAEIFFEHDRWGRNLVWSVALHAAFTAGVFLFAYFSGGH |
| Ga0187781_111827661 | 3300017972 | Tropical Peatland | VAASAEIFFEHDRWGRALTWSLVLHIAVVSGLFGYAAVLGGHGG |
| Ga0187782_106669371 | 3300017975 | Tropical Peatland | MAASSEIFLEHDRWGRNLAWSASLHLAVAGAIVLYTVVVPPGRGSEWGAGGGGDALGATLVNSVP |
| Ga0187816_103341763 | 3300017995 | Freshwater Sediment | MEANADIFFEHDRWGRNLAWSVGLHIAVAGSIVLYAVIGPGGHGSTWGAG |
| Ga0187816_105065671 | 3300017995 | Freshwater Sediment | MEANAEIFFEHDRWGRNLAWSVGLHLAVAGAIILYAVIGPSGSGST |
| Ga0187804_101627601 | 3300018006 | Freshwater Sediment | MSANAEIYFEHDRWGRNLGWSVVLHIGVAASIVAYAIFAPA |
| Ga0187804_104653182 | 3300018006 | Freshwater Sediment | MEANAEIFFEHDRWGRNLAWSVGLHLAVAGSIILYAVFAHGGS |
| Ga0187769_105971693 | 3300018086 | Tropical Peatland | MQANTEIFFEHDRWGRNLTWSLALHMAVTGAILLY |
| Ga0187770_105099843 | 3300018090 | Tropical Peatland | MAASTEIFLEHDRWGRNLAWSAGLHIAVAGAIVFYTVVVPAGRGSEW |
| Ga0187770_112069703 | 3300018090 | Tropical Peatland | MEANAEIFFEHDRWGRNLAWSAGLHVAVAGCIVLYAMIA |
| Ga0187800_18341891 | 3300019278 | Peatland | MAASTEIFLEHDRWGRNLAWSAGLHIAVAGAIVFYTVVVPAGRGSE |
| Ga0187797_12336713 | 3300019284 | Peatland | MAANAEIFFEHDRWGRNLVWSVALHAAFTAGIFLF |
| Ga0182025_10027291 | 3300019786 | Permafrost | MAASAEIFFEHERWGRNLAWSVGLHIGIAACIILYAVVIHSSG |
| Ga0210407_111156682 | 3300020579 | Soil | MATNAEIFFEHDRWGHNVAWSVGLHVVVAGCIVLYAAVAS |
| Ga0210399_111659621 | 3300020581 | Soil | MATNAEIFFEHDRWGHNVAWSVALHVVVAGGIVLYASVASGGRRE |
| Ga0210399_112907132 | 3300020581 | Soil | MEANAEIFFEHDNWFRNLAWSVALHIAVAGSIILYAVVWHGGG |
| Ga0210401_101615711 | 3300020583 | Soil | MEPNTEIFFEHDRWGHNVAWSVALHLVVAGCIVFYAAVVTGGRR |
| Ga0210382_104288231 | 3300021080 | Groundwater Sediment | MAANAEIFFEHDRWGRNLTWSLVLHLAVAGFILLYAVVIPSSHG |
| Ga0210406_108445843 | 3300021168 | Soil | MEANAEIFFEHDRWARNLTWSVVLHLAVAGSIVAYAVVGPGGGGSTWGA |
| Ga0210405_101970191 | 3300021171 | Soil | MEANAEIFFEHDKWGRNLAWSAGLHLAVAGSIILYAAVASGGKGSAWGAGGG |
| Ga0210408_103079603 | 3300021178 | Soil | MAANAEIFFEHGPWGRALAWSVGLHVAFAAFIVLYA |
| Ga0210408_105833761 | 3300021178 | Soil | MEANAEIFFEHDRWGRNLTWSLVLHIAVAGGILLYAVVAPSSHGEGWGAGGGGD |
| Ga0210388_113432231 | 3300021181 | Soil | MANNAEIFFEHDNWGRNLAWSAGLHVAVAASITLYALVWHGGTGSTWGAG |
| Ga0210397_110384901 | 3300021403 | Soil | MAANAEIFFEHDRWGRNLAWSAGLHIAIAGSIVLYAVIGPGGH |
| Ga0210383_107544231 | 3300021407 | Soil | METNAEIFFEHDRWGHNVAWSLGLHVAVAGCVVLYAAVASGGRRE |
| Ga0210394_106261991 | 3300021420 | Soil | MEANAEIFFEHDRWGRNLAWSVALHIAVAASIIVYAVVGPG |
| Ga0210394_113157583 | 3300021420 | Soil | MAANAEIFFEHDRWGRNLTWSLGLHIAIAGAIVLY |
| Ga0210384_114268751 | 3300021432 | Soil | MAANAEIFFEHDRWGRNLAWSAGLHIAIAGFIVLYAVFGP |
| Ga0210392_102588013 | 3300021475 | Soil | MEANAEIFFEHDNWFRNLAWSVALHIAVAGSIILYAVV |
| Ga0210402_112541143 | 3300021478 | Soil | MAANAEIFFEHDRWGRNLTWSLGLHIAIAGAIVLYAVVAPSSHGEGWGAG |
| Ga0210410_100715864 | 3300021479 | Soil | MEANAEIFFEHERWGRALGRSAAFHVAVAAVILVYTM |
| Ga0210409_1001375111 | 3300021559 | Soil | MEANAEIFFEHDNWVRNLAWSVGLHIAVAGSIILYAVVWHGS |
| Ga0212123_106932841 | 3300022557 | Iron-Sulfur Acid Spring | MEANAEIFFEHDQWGRNLAWSVALHIAVVASIILYAVVA |
| Ga0207416_11079091 | 3300025134 | Iron-Sulfur Acid Spring | MEANAEIFFEHDQWGRNLAWSAGLHVAVAAAIILY |
| Ga0207710_106091651 | 3300025900 | Switchgrass Rhizosphere | MAANAEIFFEHDRWGRNLSWSLGLHVAVVGAILLYA |
| Ga0207680_100160888 | 3300025903 | Switchgrass Rhizosphere | MAANAEIFFEHDRWGRNLSWSLGLHIAIAGAIVLYAVVAPSSSGEGWGAGGGGDA |
| Ga0207663_112059091 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANAEIFFEHDRWGRNLTWSLVLHVAVAGSILLYAVVLPSRHGEGWG |
| Ga0207646_101563844 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANAEIFFEHDRWGHNLAWSLALHVVVTGGILLYSTIASGGRGEGWGA |
| Ga0207646_114746462 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAANAEIFLEHDRWGRNLAWSGALHIAVAGSILLYAVIAPGSRGEGWGAG |
| Ga0207664_119744122 | 3300025929 | Agricultural Soil | MAANAEIFFEHDRWGRNLAWSLVLHAAVTGAILLYAVVIP |
| Ga0207670_109833841 | 3300025936 | Switchgrass Rhizosphere | MAANAEIFFEHDRWGRNLSWSLGLHIAIAGAIVLYAVVAPSSSGEGWGAGGGGDAM |
| Ga0207665_107461581 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MEANAEIFFEHDRWGRNLSWSLVLHLAVAGGILLYAVVVPGSHGESWGAGGGGDAMGV |
| Ga0209838_10248153 | 3300026214 | Soil | MAASAEIFFEHERWGRNLAWSAGFHVAIAVCIIGYAVVAHT |
| Ga0209890_102523071 | 3300026291 | Soil | MAANAEIFFEHDRWGRNLSWSVGLHIAIAGSILLYAVVAPSSHGDGWGA |
| Ga0208043_11636361 | 3300027570 | Peatlands Soil | MEANAEIFFEHDRWVRNLTWSVALHLAVAGSIVLYAVIAHGGSGSTWGA |
| Ga0209528_10920581 | 3300027610 | Forest Soil | MAANAEIFFEHERWGRALAWSVGLHLAIASSLLLYSAVFSGP |
| Ga0209528_10935601 | 3300027610 | Forest Soil | MAANAEIFFEHGPWGRALAWSVGLHVAFAAFIVLYAVIIPASSGQSWGAGG |
| Ga0209076_11860582 | 3300027643 | Vadose Zone Soil | MAAAEIFFEHERWGRNLAWSAGFHVAVAASILAYAV |
| Ga0209420_10282534 | 3300027648 | Forest Soil | MEANAEIFFEHDNWGRNLAWSAGLHIAVAGSIILYAMVVSGGKG |
| Ga0209217_11148891 | 3300027651 | Forest Soil | MEANAEIFFEHDRWGRNLSWSLALHLAVVGGIVAYAVVAPGSSGQGWGAGG |
| Ga0209139_101961971 | 3300027795 | Bog Forest Soil | MAGNAEIFFEHDHWGRNLAWSAGLHVAVAGCIVLYAVIWHGSGGST |
| Ga0209275_108959921 | 3300027884 | Soil | MEANAEIFFEHDKWGRNLAWSAGLHLAVAGSIILYAAVASGGKGSAWGAG |
| Ga0209069_106668283 | 3300027915 | Watersheds | MAANAEIFFEHDRWGRNLTWSLGLHIAIAGAIVLYA |
| Ga0265350_1069112 | 3300028013 | Soil | MEANAEIFFEHERWGRALGWSAAFHAAVAAVILVY |
| Ga0311350_110446391 | 3300030002 | Fen | MPANPEIFFEHDRWGHNLAWSLGLHVTVAVAILVYAVVA |
| Ga0265762_10468061 | 3300030760 | Soil | MEANAEIFFEHERWGRALGWSAAFHVAVAVVILVYTMVAT |
| Ga0265760_100027358 | 3300031090 | Soil | MEANAEIFFEHDNWFRNLAWSVALHVAVAGSIILYAVVWHGSGG |
| Ga0302307_103826591 | 3300031233 | Palsa | MEANAEIFFEHERWGRALGWSAAFHVAVAAVILVYAMVA |
| Ga0307479_111997603 | 3300031962 | Hardwood Forest Soil | MAANAEIFFEHGPWGRALAWSVGLHVAFAAFIVLYAVIIP |
| Ga0311301_107517013 | 3300032160 | Peatlands Soil | MAANAEIFFEHERWGRALAWSAGLHIAITGAVLLWSVVFT |
| Ga0310812_104780262 | 3300032421 | Soil | MAANAEIFFEHGAWGKPLAWSVGLHVAFTVFVVLWAVVVHPTVGSGWGGG |
| Ga0335080_102052861 | 3300032828 | Soil | MEANAEIFFEHDRWGRNLAWSTALHIAVAGAIVAYTVIAPSSGGGSWG |
| Ga0335070_113805103 | 3300032829 | Soil | MANHAEIFFEHDRWGRNLAWSAALHVGFAGFVVLYTAMIHGGRGGAWGAGG |
| Ga0335076_112833181 | 3300032955 | Soil | MAASAEIFFEHDSWGRNLAWSLVLHVAVTGGILLY |
| ⦗Top⦘ |