Basic Information | |
---|---|
Family ID | F079110 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 43 residues |
Representative Sequence | GDHEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.86 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 88.79 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.345 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.828 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.138 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.483 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF12697 | Abhydrolase_6 | 23.28 |
PF01872 | RibD_C | 13.79 |
PF01565 | FAD_binding_4 | 6.90 |
PF02913 | FAD-oxidase_C | 6.03 |
PF08281 | Sigma70_r4_2 | 2.59 |
PF04237 | YjbR | 2.59 |
PF13193 | AMP-binding_C | 1.72 |
PF05977 | MFS_3 | 1.72 |
PF02720 | DUF222 | 0.86 |
PF00501 | AMP-binding | 0.86 |
PF09206 | ArabFuran-catal | 0.86 |
PF05199 | GMC_oxred_C | 0.86 |
PF13424 | TPR_12 | 0.86 |
PF04542 | Sigma70_r2 | 0.86 |
PF00561 | Abhydrolase_1 | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 13.79 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 13.79 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 6.03 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 2.59 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.72 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.86 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.86 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.86 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.86 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.21 % |
Unclassified | root | N/A | 38.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_160127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
3300004152|Ga0062386_101852654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300005163|Ga0066823_10102442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300005175|Ga0066673_10837493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300005329|Ga0070683_100252705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1676 | Open in IMG/M |
3300005341|Ga0070691_10058709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1847 | Open in IMG/M |
3300005343|Ga0070687_100261303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1080 | Open in IMG/M |
3300005343|Ga0070687_100409241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
3300005363|Ga0008090_15848364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
3300005367|Ga0070667_100534600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
3300005436|Ga0070713_100050891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3424 | Open in IMG/M |
3300005439|Ga0070711_100200428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1540 | Open in IMG/M |
3300005537|Ga0070730_10420153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
3300005548|Ga0070665_100601689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
3300005718|Ga0068866_10240351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1103 | Open in IMG/M |
3300005719|Ga0068861_100649287 | Not Available | 974 | Open in IMG/M |
3300005841|Ga0068863_100309399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1533 | Open in IMG/M |
3300005950|Ga0066787_10149096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
3300006028|Ga0070717_10345940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1328 | Open in IMG/M |
3300006028|Ga0070717_10380559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1265 | Open in IMG/M |
3300006028|Ga0070717_10522892 | Not Available | 1073 | Open in IMG/M |
3300006173|Ga0070716_100599162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
3300006175|Ga0070712_100335885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1232 | Open in IMG/M |
3300006175|Ga0070712_101528462 | Not Available | 583 | Open in IMG/M |
3300006871|Ga0075434_102424182 | Not Available | 526 | Open in IMG/M |
3300006881|Ga0068865_100325688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1237 | Open in IMG/M |
3300009520|Ga0116214_1150334 | Not Available | 867 | Open in IMG/M |
3300009525|Ga0116220_10081887 | Not Available | 1360 | Open in IMG/M |
3300009700|Ga0116217_10047840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3120 | Open in IMG/M |
3300009792|Ga0126374_10503357 | Not Available | 874 | Open in IMG/M |
3300009824|Ga0116219_10373295 | Not Available | 798 | Open in IMG/M |
3300010358|Ga0126370_10511664 | Not Available | 1017 | Open in IMG/M |
3300010362|Ga0126377_10801598 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300010403|Ga0134123_10037054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3591 | Open in IMG/M |
3300010876|Ga0126361_11119020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1706 | Open in IMG/M |
3300011269|Ga0137392_10072560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2652 | Open in IMG/M |
3300012200|Ga0137382_11140377 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300012203|Ga0137399_10587568 | Not Available | 936 | Open in IMG/M |
3300012350|Ga0137372_11179718 | Not Available | 519 | Open in IMG/M |
3300012907|Ga0157283_10243945 | Not Available | 593 | Open in IMG/M |
3300012971|Ga0126369_13122020 | Not Available | 542 | Open in IMG/M |
3300013100|Ga0157373_10747849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
3300013102|Ga0157371_10483201 | Not Available | 913 | Open in IMG/M |
3300013307|Ga0157372_11262484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
3300016445|Ga0182038_11689875 | Not Available | 570 | Open in IMG/M |
3300017821|Ga0187812_1006786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3969 | Open in IMG/M |
3300017821|Ga0187812_1013042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2885 | Open in IMG/M |
3300017926|Ga0187807_1089905 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300017942|Ga0187808_10234875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-139 | 819 | Open in IMG/M |
3300017942|Ga0187808_10481653 | Not Available | 573 | Open in IMG/M |
3300017959|Ga0187779_11021659 | Not Available | 574 | Open in IMG/M |
3300018001|Ga0187815_10120767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1106 | Open in IMG/M |
3300018007|Ga0187805_10178049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-139 | 969 | Open in IMG/M |
3300018085|Ga0187772_11300524 | Not Available | 538 | Open in IMG/M |
3300019885|Ga0193747_1055758 | Not Available | 980 | Open in IMG/M |
3300020582|Ga0210395_11360456 | Not Available | 519 | Open in IMG/M |
3300021363|Ga0193699_10367212 | Not Available | 599 | Open in IMG/M |
3300021401|Ga0210393_10326678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
3300021405|Ga0210387_10474239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-139 | 1111 | Open in IMG/M |
3300021474|Ga0210390_10130314 | Not Available | 2112 | Open in IMG/M |
3300021476|Ga0187846_10059107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albus | 1684 | Open in IMG/M |
3300021477|Ga0210398_10941203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
3300021479|Ga0210410_10460367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-139 | 1137 | Open in IMG/M |
3300021559|Ga0210409_10733668 | Not Available | 859 | Open in IMG/M |
3300021559|Ga0210409_11659891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
3300025898|Ga0207692_10018855 | All Organisms → cellular organisms → Bacteria | 3105 | Open in IMG/M |
3300025898|Ga0207692_10790120 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300025898|Ga0207692_10828497 | Not Available | 606 | Open in IMG/M |
3300025903|Ga0207680_10584383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 798 | Open in IMG/M |
3300025915|Ga0207693_10044767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3478 | Open in IMG/M |
3300025922|Ga0207646_10841217 | Not Available | 816 | Open in IMG/M |
3300025924|Ga0207694_10218610 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
3300025938|Ga0207704_10380330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1108 | Open in IMG/M |
3300025938|Ga0207704_11770434 | Not Available | 531 | Open in IMG/M |
3300025945|Ga0207679_11100088 | Not Available | 729 | Open in IMG/M |
3300025981|Ga0207640_10429620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1083 | Open in IMG/M |
3300026078|Ga0207702_11734589 | Not Available | 617 | Open in IMG/M |
3300027767|Ga0209655_10124036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
3300027894|Ga0209068_10969493 | Not Available | 505 | Open in IMG/M |
3300028381|Ga0268264_10290767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1534 | Open in IMG/M |
3300028742|Ga0302220_10014856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3948 | Open in IMG/M |
3300028742|Ga0302220_10351424 | Not Available | 532 | Open in IMG/M |
3300028806|Ga0302221_10330172 | Not Available | 664 | Open in IMG/M |
3300028906|Ga0308309_11719943 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300029951|Ga0311371_10954909 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1027 | Open in IMG/M |
3300030007|Ga0311338_10875920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
3300030007|Ga0311338_11099954 | Not Available | 762 | Open in IMG/M |
3300030013|Ga0302178_10379410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
3300030618|Ga0311354_11035261 | Not Available | 754 | Open in IMG/M |
3300030618|Ga0311354_11685771 | Not Available | 554 | Open in IMG/M |
3300030739|Ga0302311_10236969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1359 | Open in IMG/M |
3300031549|Ga0318571_10249650 | Not Available | 652 | Open in IMG/M |
3300031708|Ga0310686_115970469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → unclassified Geodermatophilus → Geodermatophilus sp. Leaf369 | 560 | Open in IMG/M |
3300031713|Ga0318496_10010621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4330 | Open in IMG/M |
3300031715|Ga0307476_11050315 | Not Available | 599 | Open in IMG/M |
3300031736|Ga0318501_10728599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300031747|Ga0318502_10024452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2975 | Open in IMG/M |
3300031748|Ga0318492_10023490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2708 | Open in IMG/M |
3300031765|Ga0318554_10491020 | Not Available | 695 | Open in IMG/M |
3300031770|Ga0318521_10360864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
3300031797|Ga0318550_10451494 | Not Available | 621 | Open in IMG/M |
3300031799|Ga0318565_10243333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 875 | Open in IMG/M |
3300031799|Ga0318565_10439815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
3300031846|Ga0318512_10187530 | Not Available | 1008 | Open in IMG/M |
3300031890|Ga0306925_11707306 | Not Available | 607 | Open in IMG/M |
3300031912|Ga0306921_11975008 | Not Available | 622 | Open in IMG/M |
3300031947|Ga0310909_10813215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
3300032013|Ga0310906_11092446 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300032042|Ga0318545_10175587 | Not Available | 765 | Open in IMG/M |
3300032059|Ga0318533_11026439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
3300032089|Ga0318525_10483220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
3300032160|Ga0311301_12438178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 588 | Open in IMG/M |
3300032805|Ga0335078_12214515 | Not Available | 579 | Open in IMG/M |
3300032897|Ga0335071_10314811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1519 | Open in IMG/M |
3300033158|Ga0335077_12230729 | Not Available | 502 | Open in IMG/M |
3300034124|Ga0370483_0293406 | Not Available | 560 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.07% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.62% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.03% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.59% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.86% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.86% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_02947930 | 2199352024 | Soil | VILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA |
Ga0062386_1018526541 | 3300004152 | Bog Forest Soil | DDHDQAARLADLAGARWGAIANPLDAAAALDQLLETRAIS* |
Ga0066823_101024421 | 3300005163 | Soil | GDHEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA* |
Ga0066673_108374931 | 3300005175 | Soil | GDHEQAAHLAGLAGARWAAIEHPLDAVAALDHLLETRITA* |
Ga0070683_1002527051 | 3300005329 | Corn Rhizosphere | ALPELVILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRVTA* |
Ga0070691_100587093 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | APDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA* |
Ga0070687_1002613033 | 3300005343 | Switchgrass Rhizosphere | VILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRVTA* |
Ga0070687_1004092412 | 3300005343 | Switchgrass Rhizosphere | ELVILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLENRVTA* |
Ga0008090_158483642 | 3300005363 | Tropical Rainforest Soil | ELVILAPAGDHEQAAHLAGLAGARWAAIEHPLDAAAALDHLLETRITA* |
Ga0070667_1005346003 | 3300005367 | Switchgrass Rhizosphere | ILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRVTA* |
Ga0070713_1000508915 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA* |
Ga0070711_1002004281 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DHEQAAHLAGLAGARWGAIEHPLEAAAALDHLLEARITA* |
Ga0070730_104201531 | 3300005537 | Surface Soil | PGDDHEQAAHLATLAGARWAVIDRPLDAATALDHLLQTRVTA* |
Ga0070665_1006016892 | 3300005548 | Switchgrass Rhizosphere | LAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLENRVTA* |
Ga0068866_102403511 | 3300005718 | Miscanthus Rhizosphere | EQAAHLAGLAGARWAAIEHPLDAAAALDRLLENRVTA* |
Ga0068861_1006492871 | 3300005719 | Switchgrass Rhizosphere | HEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA* |
Ga0068863_1003093991 | 3300005841 | Switchgrass Rhizosphere | VILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRITA* |
Ga0066787_101490962 | 3300005950 | Soil | DDNEQAAQLADLAGARWAALANPLDAATTLDYLLETRVTA* |
Ga0070717_103459403 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QLAAQAGARWAAIEHPLDAAAILDRLLETRPATA* |
Ga0070717_103805591 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DHEQAAHLAGLAGARWGVIAHPLDAAAALDLLLETRSTA* |
Ga0070717_105228923 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AHLATLAGARWAVIDRPLDAAAALDRLLQTRVTA* |
Ga0070716_1005991621 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ALPELVILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRITA* |
Ga0070712_1003358853 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RALPELVILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA* |
Ga0070712_1015284622 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QAAHLATLAGARWAVIDRPLDAAAALDRLLQTRVTA* |
Ga0075434_1024241821 | 3300006871 | Populus Rhizosphere | EQAAHLAGLAGARWAAIEHPLDAAAALDRLLETQVTA* |
Ga0068865_1003256883 | 3300006881 | Miscanthus Rhizosphere | PDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLENRVTA* |
Ga0116214_11503342 | 3300009520 | Peatlands Soil | IILAPADDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPQAG* |
Ga0116220_100818871 | 3300009525 | Peatlands Soil | PADDHEQAAHLADLAGARWGVIAHPLDAAAVLDRLLEARSTA* |
Ga0116217_100478404 | 3300009700 | Peatlands Soil | LPELIILAPADDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPQAG* |
Ga0126374_105033571 | 3300009792 | Tropical Forest Soil | AAHLAGLAGVRWGAIEHPLDAAAALDQLLETRITA* |
Ga0116219_103732951 | 3300009824 | Peatlands Soil | DHEQAAHLADLAGARWGVIAHPLDAAAVLDRLLETRITA* |
Ga0126370_105116642 | 3300010358 | Tropical Forest Soil | DCEQAAHLAGLAGARWGAIEHPLDAAAALDRLLETRVTG* |
Ga0126377_108015983 | 3300010362 | Tropical Forest Soil | EQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA* |
Ga0134123_100370541 | 3300010403 | Terrestrial Soil | EQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRVTA* |
Ga0126361_111190205 | 3300010876 | Boreal Forest Soil | QLAGLSGARWSSIAHPLDAAAALDRLLEAQDVDP* |
Ga0137392_100725601 | 3300011269 | Vadose Zone Soil | AHLAGLAGARWAAIAHPLDAAAALDRLLEARATA* |
Ga0137382_111403772 | 3300012200 | Vadose Zone Soil | DHEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRATA* |
Ga0137399_105875681 | 3300012203 | Vadose Zone Soil | ELVILAPAGDHEQAAHLAGLAGARWAAIEHPLDAAAALDQLLETRITA* |
Ga0137372_111797181 | 3300012350 | Vadose Zone Soil | ADDHEQAARLAGLAGARWGAIEHPLDAAAALDHLLETRVTA* |
Ga0157283_102439451 | 3300012907 | Soil | AHLAGLAGARWAAIEHPLDAAAALDRLLETRVTNQSL* |
Ga0126369_131220201 | 3300012971 | Tropical Forest Soil | LAPAGDCEQAAHLAGLAGARWGPIEHPLDAAAALDHVLETRITA* |
Ga0157373_107478491 | 3300013100 | Corn Rhizosphere | ILAPDGDHEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRVTA* |
Ga0157371_104832012 | 3300013102 | Corn Rhizosphere | VILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLENRVTA* |
Ga0157372_112624841 | 3300013307 | Corn Rhizosphere | LAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRITA* |
Ga0182038_116898752 | 3300016445 | Soil | CEQAAHLAGLAGARWGAIEHPLDAAAALDHLLETRITA |
Ga0187812_10067861 | 3300017821 | Freshwater Sediment | ADDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPQAG |
Ga0187812_10130421 | 3300017821 | Freshwater Sediment | ADDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPQVG |
Ga0187807_10899051 | 3300017926 | Freshwater Sediment | PELIILAPADDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPATA |
Ga0187808_102348752 | 3300017942 | Freshwater Sediment | DHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPATA |
Ga0187808_104816531 | 3300017942 | Freshwater Sediment | LPELIILAPADDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPATA |
Ga0187779_110216591 | 3300017959 | Tropical Peatland | AARLAGLAGARWGTISHPLEAASILDQLLSARLVPD |
Ga0187815_101207671 | 3300018001 | Freshwater Sediment | LAPADDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPATA |
Ga0187805_101780492 | 3300018007 | Freshwater Sediment | AGDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPATA |
Ga0187772_113005241 | 3300018085 | Tropical Peatland | IILAPADDHEQAAHLAGLAGARWGPVAQPLDAAAALDRLLEARVTA |
Ga0193747_10557582 | 3300019885 | Soil | APDGDHEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA |
Ga0210395_113604561 | 3300020582 | Soil | DGTAEVARGLPELIILAPADDHDQAVHLAALAGARWGTIQHPLDAAVLLDHLLDTAPWRG |
Ga0193699_103672121 | 3300021363 | Soil | GDHEQAAHLAGLAGARWAAIEHPLDAAAALDHLLETRVTA |
Ga0210393_103266781 | 3300021401 | Soil | LAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA |
Ga0210387_104742392 | 3300021405 | Soil | ELIILAPADDHDQAAQLAGLSGARWGPIAHPLDAAAVLDQLLEAPPAAQDVPT |
Ga0210390_101303141 | 3300021474 | Soil | LIILAPADDHEQAAHLADLAGARLGTIAHPLDAAAVLDRLLEARDTA |
Ga0187846_100591073 | 3300021476 | Biofilm | ASHLAELTGARWGVLAHPLDAAALLDRLLESRATAFTALGE |
Ga0210398_109412032 | 3300021477 | Soil | HEQAAHLADLAGARLGTIAHPLDAAAVLDRLLEARDTA |
Ga0210410_104603671 | 3300021479 | Soil | ILAPADDHDQAAQLAGLSGARWGPIAHPLDAAAVLDQLLEAPPAAQDVPT |
Ga0210409_107336682 | 3300021559 | Soil | HEQAAHLAGLAGARWAAIEHPLDAVAVLDHLLETRITA |
Ga0210409_116598911 | 3300021559 | Soil | TLETACRLPELIILAPADDHDQAAQLAGLSGARWGPIAHPLDMAAALDQLLEAQPAAQDVPT |
Ga0207692_100188555 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LVILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRVTA |
Ga0207692_107901202 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ELIILAPAGDHEQAAHLAGLAGARWAAIEHPLDAVAALDHLLETRITA |
Ga0207692_108284972 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RALDELIILAPGDDHEQAAHLAVLAGARWAVIDRPLDAAAALDRLLQTRVTA |
Ga0207680_105843832 | 3300025903 | Switchgrass Rhizosphere | DHEQAAHLAGLAGARWAAIEHPLDAVAALDHLLETRITA |
Ga0207693_100447673 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | APGDDHEQAAHLAALAGARWAAITHPLDAAAALDRLLQTRATA |
Ga0207646_108412171 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRITA |
Ga0207694_102186103 | 3300025924 | Corn Rhizosphere | ELVILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRITA |
Ga0207704_103803301 | 3300025938 | Miscanthus Rhizosphere | VILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRVTA |
Ga0207704_117704341 | 3300025938 | Miscanthus Rhizosphere | PDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLENRVTA |
Ga0207679_111000883 | 3300025945 | Corn Rhizosphere | DDHEQAAHLATLAGARWAVIDRPLDAAAALDRLLQTRVTA |
Ga0207640_104296203 | 3300025981 | Corn Rhizosphere | EQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRITA |
Ga0207702_117345891 | 3300026078 | Corn Rhizosphere | HEQAAHLAVLAGARWAVIDRPLDAAAALDHLLQTRVTA |
Ga0209655_101240361 | 3300027767 | Bog Forest Soil | ARRLPELIILAPADDHDQAAQLAGLSGARWGPIAHPLDAAAALDQLLEAQPAAQDVPT |
Ga0209068_109694931 | 3300027894 | Watersheds | ELIILAPADDHEQAAHLAHLAGARWGTIAHPLDAAAVLDRLLEARSTA |
Ga0268264_102907671 | 3300028381 | Switchgrass Rhizosphere | DYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRITA |
Ga0302220_100148561 | 3300028742 | Palsa | DDCEQAAQLADLAGARWAVLANPLDAAATLDHLLETRATA |
Ga0302220_103514242 | 3300028742 | Palsa | IILAPADDNEQAAQLADLAGARWAALANPLDAATTLDHLLETRATA |
Ga0302221_103301722 | 3300028806 | Palsa | AAQLADLAGARWAALANPLDAAAALDHLLETRATA |
Ga0308309_117199432 | 3300028906 | Soil | LVILAPADDHEQAAHLGNLSGARWGTIASPLDAGTALDRLLEARPGRPRIADA |
Ga0311371_109549093 | 3300029951 | Palsa | DELIILAPADDNEQAAQLADLAGARWAALANPLDAATTLDYLLENRITA |
Ga0311338_108759201 | 3300030007 | Palsa | APADDCEQAAQLADLAGARWAVLANPLEAAATLDHLLETRATA |
Ga0311338_110999541 | 3300030007 | Palsa | ADDHDQAAQLADLAGARWAALANPLDAAATLDDLLETRATA |
Ga0302178_103794101 | 3300030013 | Palsa | LAPAGDHEQAAQLAEQAGARWAVLAHPLDAALALDRLLAAPVRR |
Ga0311354_110352612 | 3300030618 | Palsa | EQAAQLADLAGARWAALANPLDAATTLDHLLETRATA |
Ga0311354_116857711 | 3300030618 | Palsa | HDQAAQLADLAGARWAALANPLDAAATLDDLLETRATA |
Ga0302311_102369691 | 3300030739 | Palsa | AAQLADLAGARWAVLANPLDAAATLDHLLETRATA |
Ga0318571_102496502 | 3300031549 | Soil | APAGDCEQAAHLAGLAGARWGAIEHPLDAAAALDQLLETRVTA |
Ga0310686_1159704691 | 3300031708 | Soil | RSLQELIILAPADDHDQAAQLADLTGARWAALANPLEAATTLDYLLQTRITQ |
Ga0318496_100106214 | 3300031713 | Soil | ELIILAPADDHEQAAQLAGLAGARWGQIAHPLDAAAALDRLLETRSTA |
Ga0307476_110503151 | 3300031715 | Hardwood Forest Soil | AGDCEQAAYLAGLAGARWGAIEHPLDAAAALDQLLETRITA |
Ga0318501_107285991 | 3300031736 | Soil | DGTLETARALPELIILAPADDYEQAAQLAGLAGARWGQIAHPLDAAAALDRLLETRSTA |
Ga0318502_100244525 | 3300031747 | Soil | EQAAQLAGLSGARWAPLAHPLDAAATLDQLLEVPADQRLG |
Ga0318492_100234901 | 3300031748 | Soil | ARALPELIILAPADDYEQAAQLAGLAGARWGQIAHPLDAAAALDRLLETRSTA |
Ga0318554_104910202 | 3300031765 | Soil | IILAPADDHEQAAHLADLAGARWGPIEHPLDAAAALDRLLEARVTA |
Ga0318521_103608641 | 3300031770 | Soil | RALPELIILAPADDPEQAAQLAGLAGARWGQIAHPLDAAAALDRLLETRSTA |
Ga0318550_104514942 | 3300031797 | Soil | LAPAGDCEQAAHLAGLAGARWGAIEHPLDAAVALDHLLDTRITA |
Ga0318565_102433332 | 3300031799 | Soil | ALPELIILAPADDHAQAAQLASQAGARWAAIEHPLDAAAVLDRLLETRPATA |
Ga0318565_104398151 | 3300031799 | Soil | LVILAPAGDCEQAAHLAGLAGARWGAIEHPLDAAVALDHLLDTRITA |
Ga0318512_101875302 | 3300031846 | Soil | LAPADDHEQAAQLAGLAGARWGQIAHPLDAAAALDRLLETRITA |
Ga0306925_117073061 | 3300031890 | Soil | GDCEQAAHLAGLAGARWGAIEHPLDAAVALDHLLDTRITA |
Ga0306921_119750082 | 3300031912 | Soil | ILAPAGDCEQAAHLAGLAGARWGAIEHPLDAAVALDHLLDTRITA |
Ga0310909_108132151 | 3300031947 | Soil | ILAPAGDCEQAAHLAGLAGARWGPVEHPLDAAAALDHLLETRITA |
Ga0310906_110924461 | 3300032013 | Soil | YEQAAHLAGLAGARWAAIEHPLDAAAALDRLLESRITA |
Ga0318545_101755871 | 3300032042 | Soil | RALQELVILAPDGDYEQAAHLAGLAGARWAAIEHPLDAAAALDRLLETRITA |
Ga0318533_110264392 | 3300032059 | Soil | VILAPAGDCEQAAHLAGLAGARWGAIEHPLDAAAALDRLLETRITA |
Ga0318525_104832201 | 3300032089 | Soil | ELVILAPAGDCEQAAHLAGLAGARWGAIEHPLDAAVALDHLLDTRITA |
Ga0311301_124381781 | 3300032160 | Peatlands Soil | ELIILAPADDHEQAAHLADLVGARWGAIAHPLDAAAVLDRLLEARSTA |
Ga0335078_122145151 | 3300032805 | Soil | DDHEQAAHLAALAGARWAVIDRPLDAAAALDRLLQTRVTA |
Ga0335071_103148113 | 3300032897 | Soil | DHEQAAHLAAQAGARWGAIAHPLDAAAVLDRLLETRTTA |
Ga0335077_122307291 | 3300033158 | Soil | LAPDDDCEQAAHLAGLAGARWGPIARPLDAAATLDRLLEARVTA |
Ga0370483_0293406_1_111 | 3300034124 | Untreated Peat Soil | EQAAQLADSAGARWAALADPLEAAAALDYLLEARIT |
⦗Top⦘ |