| Basic Information | |
|---|---|
| Family ID | F079108 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.31 % |
| % of genes near scaffold ends (potentially truncated) | 93.10 % |
| % of genes from short scaffolds (< 2000 bps) | 92.24 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.966 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.828 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.414 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.931 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 42.24 |
| PF02899 | Phage_int_SAM_1 | 3.45 |
| PF06803 | DUF1232 | 3.45 |
| PF13397 | RbpA | 2.59 |
| PF13635 | DUF4143 | 1.72 |
| PF04138 | GtrA | 1.72 |
| PF00732 | GMC_oxred_N | 1.72 |
| PF13560 | HTH_31 | 0.86 |
| PF07885 | Ion_trans_2 | 0.86 |
| PF12762 | DDE_Tnp_IS1595 | 0.86 |
| PF00768 | Peptidase_S11 | 0.86 |
| PF06197 | DUF998 | 0.86 |
| PF00881 | Nitroreductase | 0.86 |
| PF08240 | ADH_N | 0.86 |
| PF07690 | MFS_1 | 0.86 |
| PF02254 | TrkA_N | 0.86 |
| PF00924 | MS_channel | 0.86 |
| PF00296 | Bac_luciferase | 0.86 |
| PF04978 | DUF664 | 0.86 |
| PF07045 | DUF1330 | 0.86 |
| PF01243 | Putative_PNPOx | 0.86 |
| PF00440 | TetR_N | 0.86 |
| PF00571 | CBS | 0.86 |
| PF12680 | SnoaL_2 | 0.86 |
| PF05239 | PRC | 0.86 |
| PF14226 | DIOX_N | 0.86 |
| PF00343 | Phosphorylase | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 3.45 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 3.45 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 3.45 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.72 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.86 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.86 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.86 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.97 % |
| Unclassified | root | N/A | 31.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02P3JYA | Not Available | 512 | Open in IMG/M |
| 3300000956|JGI10216J12902_120221067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 619 | Open in IMG/M |
| 3300003368|JGI26340J50214_10177890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300005178|Ga0066688_10513598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300005184|Ga0066671_10330879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300005328|Ga0070676_10672539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300005337|Ga0070682_100723414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 800 | Open in IMG/M |
| 3300005364|Ga0070673_101686832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia otitidiscaviarum | 599 | Open in IMG/M |
| 3300005434|Ga0070709_10607625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300005435|Ga0070714_101444509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300005436|Ga0070713_100165643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1976 | Open in IMG/M |
| 3300005439|Ga0070711_100672802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
| 3300005439|Ga0070711_100704304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
| 3300005455|Ga0070663_100138079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1858 | Open in IMG/M |
| 3300005455|Ga0070663_100814309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 801 | Open in IMG/M |
| 3300005458|Ga0070681_10780942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300005468|Ga0070707_101913135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 561 | Open in IMG/M |
| 3300005559|Ga0066700_10845438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300005610|Ga0070763_10594076 | Not Available | 641 | Open in IMG/M |
| 3300005615|Ga0070702_101373140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300005842|Ga0068858_100301984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1527 | Open in IMG/M |
| 3300006028|Ga0070717_10066786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2991 | Open in IMG/M |
| 3300006028|Ga0070717_12129717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300006173|Ga0070716_100692786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 777 | Open in IMG/M |
| 3300006175|Ga0070712_100445399 | Not Available | 1077 | Open in IMG/M |
| 3300006176|Ga0070765_101187705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 721 | Open in IMG/M |
| 3300006755|Ga0079222_10480047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 902 | Open in IMG/M |
| 3300006797|Ga0066659_11263136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300006804|Ga0079221_11320352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300006854|Ga0075425_101311830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 820 | Open in IMG/M |
| 3300006914|Ga0075436_100750894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300006954|Ga0079219_10045533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1853 | Open in IMG/M |
| 3300009174|Ga0105241_10202244 | Not Available | 1660 | Open in IMG/M |
| 3300009174|Ga0105241_12315292 | Not Available | 535 | Open in IMG/M |
| 3300009792|Ga0126374_10498434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 877 | Open in IMG/M |
| 3300010043|Ga0126380_10766840 | Not Available | 785 | Open in IMG/M |
| 3300010343|Ga0074044_10491622 | Not Available | 802 | Open in IMG/M |
| 3300010375|Ga0105239_12498443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 602 | Open in IMG/M |
| 3300010375|Ga0105239_12601470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 590 | Open in IMG/M |
| 3300010880|Ga0126350_12050296 | Not Available | 545 | Open in IMG/M |
| 3300011106|Ga0151489_1216666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1041 | Open in IMG/M |
| 3300012096|Ga0137389_11377236 | Not Available | 600 | Open in IMG/M |
| 3300012199|Ga0137383_10510702 | Not Available | 880 | Open in IMG/M |
| 3300012483|Ga0157337_1003378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 963 | Open in IMG/M |
| 3300012683|Ga0137398_10363311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 982 | Open in IMG/M |
| 3300013100|Ga0157373_10096143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2085 | Open in IMG/M |
| 3300013307|Ga0157372_12410963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 604 | Open in IMG/M |
| 3300014164|Ga0181532_10123646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1583 | Open in IMG/M |
| 3300015264|Ga0137403_11114283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia endophytica | 635 | Open in IMG/M |
| 3300016357|Ga0182032_11458221 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300017659|Ga0134083_10393230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300017821|Ga0187812_1031167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1824 | Open in IMG/M |
| 3300017821|Ga0187812_1102425 | Not Available | 935 | Open in IMG/M |
| 3300017926|Ga0187807_1138128 | Not Available | 776 | Open in IMG/M |
| 3300017933|Ga0187801_10007883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → unclassified Leifsonia → Leifsonia sp. Root112D2 | 3436 | Open in IMG/M |
| 3300017933|Ga0187801_10494489 | Not Available | 516 | Open in IMG/M |
| 3300017955|Ga0187817_10138387 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300017955|Ga0187817_10795620 | Not Available | 604 | Open in IMG/M |
| 3300017959|Ga0187779_10061748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2200 | Open in IMG/M |
| 3300017959|Ga0187779_10635299 | Not Available | 717 | Open in IMG/M |
| 3300017972|Ga0187781_10271867 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300017995|Ga0187816_10544154 | Not Available | 523 | Open in IMG/M |
| 3300018086|Ga0187769_10039953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3223 | Open in IMG/M |
| 3300018086|Ga0187769_10160289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1651 | Open in IMG/M |
| 3300018090|Ga0187770_10377566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1111 | Open in IMG/M |
| 3300020581|Ga0210399_10404229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1139 | Open in IMG/M |
| 3300020583|Ga0210401_10995275 | Not Available | 697 | Open in IMG/M |
| 3300021088|Ga0210404_10794292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 541 | Open in IMG/M |
| 3300021171|Ga0210405_10883552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300021374|Ga0213881_10484489 | Not Available | 560 | Open in IMG/M |
| 3300021403|Ga0210397_10827818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 715 | Open in IMG/M |
| 3300021475|Ga0210392_10745637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 730 | Open in IMG/M |
| 3300021478|Ga0210402_10478575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1156 | Open in IMG/M |
| 3300025898|Ga0207692_10022914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2881 | Open in IMG/M |
| 3300025898|Ga0207692_10777676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 625 | Open in IMG/M |
| 3300025903|Ga0207680_10861547 | Not Available | 649 | Open in IMG/M |
| 3300025905|Ga0207685_10283215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 814 | Open in IMG/M |
| 3300025906|Ga0207699_10008779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5003 | Open in IMG/M |
| 3300025906|Ga0207699_10996433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 619 | Open in IMG/M |
| 3300025912|Ga0207707_10547529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 983 | Open in IMG/M |
| 3300025913|Ga0207695_11613345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 529 | Open in IMG/M |
| 3300025913|Ga0207695_11624346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 527 | Open in IMG/M |
| 3300025929|Ga0207664_11270032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 655 | Open in IMG/M |
| 3300025931|Ga0207644_10166673 | Not Available | 1717 | Open in IMG/M |
| 3300026023|Ga0207677_10448292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1105 | Open in IMG/M |
| 3300026035|Ga0207703_11370776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 680 | Open in IMG/M |
| 3300026314|Ga0209268_1177667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 525 | Open in IMG/M |
| 3300026910|Ga0207840_1023618 | Not Available | 607 | Open in IMG/M |
| 3300027787|Ga0209074_10014503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2025 | Open in IMG/M |
| 3300027787|Ga0209074_10321050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 626 | Open in IMG/M |
| 3300027857|Ga0209166_10129294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
| 3300027857|Ga0209166_10390180 | Not Available | 724 | Open in IMG/M |
| 3300027884|Ga0209275_10089980 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300028828|Ga0307312_10524244 | Not Available | 782 | Open in IMG/M |
| 3300029701|Ga0222748_1049530 | Not Available | 717 | Open in IMG/M |
| 3300031723|Ga0318493_10062766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1792 | Open in IMG/M |
| 3300031724|Ga0318500_10666455 | Not Available | 529 | Open in IMG/M |
| 3300031747|Ga0318502_10207329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1135 | Open in IMG/M |
| 3300031748|Ga0318492_10407623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 715 | Open in IMG/M |
| 3300031751|Ga0318494_10489004 | Not Available | 717 | Open in IMG/M |
| 3300031765|Ga0318554_10177743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
| 3300031768|Ga0318509_10820392 | Not Available | 514 | Open in IMG/M |
| 3300031769|Ga0318526_10069765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1371 | Open in IMG/M |
| 3300031782|Ga0318552_10010708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3819 | Open in IMG/M |
| 3300031799|Ga0318565_10322862 | Not Available | 750 | Open in IMG/M |
| 3300031821|Ga0318567_10300533 | Not Available | 905 | Open in IMG/M |
| 3300031823|Ga0307478_10485712 | Not Available | 1028 | Open in IMG/M |
| 3300031846|Ga0318512_10277295 | Not Available | 831 | Open in IMG/M |
| 3300031912|Ga0306921_10700371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1164 | Open in IMG/M |
| 3300032008|Ga0318562_10527159 | Not Available | 684 | Open in IMG/M |
| 3300032010|Ga0318569_10227805 | Not Available | 865 | Open in IMG/M |
| 3300032063|Ga0318504_10184186 | Not Available | 971 | Open in IMG/M |
| 3300032205|Ga0307472_100487796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1058 | Open in IMG/M |
| 3300032770|Ga0335085_12575259 | Not Available | 503 | Open in IMG/M |
| 3300032783|Ga0335079_11169305 | Not Available | 775 | Open in IMG/M |
| 3300032896|Ga0335075_10404117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1451 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.59% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.86% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_03250430 | 2070309004 | Green-Waste Compost | VNVSLPERDAHRLDGQQQVISESLRRLTALAEHSS |
| JGI10216J12902_1202210671 | 3300000956 | Soil | SDIEIVWQLAEGGAGTSIHVQVSLPEREAHRLDGQRQAIGESLRRLAALAEAAA* |
| JGI26340J50214_101778901 | 3300003368 | Bog Forest Soil | FQLAESDAGTFIHMNVSAPEREAHRLDRQHQLIEQSLRRLTALAEAAS* |
| Ga0066688_105135982 | 3300005178 | Soil | GPGTAIHVQVSLPEQEAHRLDGQHQLIAESLRRLATLAESPT* |
| Ga0066671_103308791 | 3300005184 | Soil | IEIVWQLAEDGPGTAISVQVSLPEQEAHRLDGQHQIMEESLRRLAALAESPT* |
| Ga0070676_106725392 | 3300005328 | Miscanthus Rhizosphere | LAEAGTGTAIHVTVSLPEQEAHRLDGQHQLIEDSLHRLAALAETAA* |
| Ga0070682_1007234142 | 3300005337 | Corn Rhizosphere | CQVSDIELVWQLAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0070673_1016868321 | 3300005364 | Switchgrass Rhizosphere | WQLAEAGAGTAIHLNVTAPESQARRLDRQHQLIEQSLRRLTALAEAAS* |
| Ga0070709_106076252 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0070714_1014445092 | 3300005435 | Agricultural Soil | CGAGTSIHVQVSLPTREAHRLDGQHELIEESLRRLAALAEAAA* |
| Ga0070713_1001656431 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TAIHLNVTAPESQARRLDRQHQLIEQSLRRLTALAEAAS* |
| Ga0070711_1006728021 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | AEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0070711_1007043042 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SCQVSDIEIVWQLAEDGPGTAIHVQVSLPEQEAHRLDGQHQIMEESLRRLAALAESPT* |
| Ga0070663_1001380791 | 3300005455 | Corn Rhizosphere | GTAIQVTVSLPEREAHRLDGQRQAIGESLRRLAALAEAAS* |
| Ga0070663_1008143091 | 3300005455 | Corn Rhizosphere | EAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0070681_107809422 | 3300005458 | Corn Rhizosphere | SDIEIVWQLAEGGAGTAIHVHVSLPEHEAHRLDGQRQAIGESLRRLAALAEAAS* |
| Ga0070707_1019131353 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLGRLAALAEAAA* |
| Ga0066700_108454382 | 3300005559 | Soil | GPGTAIHVQVSLPEQEAHRLDGQHQIMEESLRRLAALAEAAA* |
| Ga0070763_105940761 | 3300005610 | Soil | IDVVWQLAEAGTGTSITVNVSLPAREAHRLDGQHQAIAESLRRLTALAEAAS* |
| Ga0070702_1013731402 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | QLAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0068858_1003019842 | 3300005842 | Switchgrass Rhizosphere | GTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEATA* |
| Ga0070717_100667861 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IHLNVTAPESQARRLDRQHQLIEQSLRRLTALAEAAS* |
| Ga0070717_121297172 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | CQVSDIELVWQLAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAETAA* |
| Ga0070716_1006927861 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0070712_1004453992 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LNVTAPESQARRLDRQHQLIEQSLRRLTALAEAAS* |
| Ga0070765_1011877051 | 3300006176 | Soil | EVVWQLAEAGPGTSINVNVSLPEREARRLDGQRQVISESLCRLTALAEAAS* |
| Ga0079222_104800472 | 3300006755 | Agricultural Soil | IELVWQLAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0066659_112631361 | 3300006797 | Soil | QLAECGAGTSIHVQVSLPTREAHRLDGQHELIEESLRRLAALAEAAA* |
| Ga0079221_113203521 | 3300006804 | Agricultural Soil | LGEAGAGTSINVNVILPEREAHRLDGQHQVISQSLRRLTALAEASS* |
| Ga0075425_1013118302 | 3300006854 | Populus Rhizosphere | GGPGTAIQVTVSLPEREAHRLDGQHQAIEESLRRLAALAEAAA* |
| Ga0075436_1007508942 | 3300006914 | Populus Rhizosphere | SCQVSDIDVVWQLAEGGPGTAIQVTVSLPEREAHRLDGQHQAIEESLRRLAALAEAAA* |
| Ga0079219_100455333 | 3300006954 | Agricultural Soil | VWQLAEGGPGTAIQVTVSLPEREAHRLDGQHQAIEESLRRLAALAEAAG* |
| Ga0105241_102022441 | 3300009174 | Corn Rhizosphere | CQVSDIDVVWQLAEGGPGTAIQVTVSLPEREAHRLDGQRQAIGESLRRLAALAEAAS* |
| Ga0105241_123152921 | 3300009174 | Corn Rhizosphere | IPESEARRLDGQRDVISSSLRRLAALAEAGSAPV* |
| Ga0126374_104984342 | 3300009792 | Tropical Forest Soil | GGQGTAIHVTVSLPEHEAHRLDGQHQAIEESLRRLTALAEAAA* |
| Ga0126380_107668401 | 3300010043 | Tropical Forest Soil | VNVTLPGREAHRLDGQHQVISESLRRLTALAEAAS* |
| Ga0074044_104916222 | 3300010343 | Bog Forest Soil | AEAGTGTSINLNVTLPERQAHRLDGQHQVIEESLRRLTTLAEAAS* |
| Ga0105239_124984432 | 3300010375 | Corn Rhizosphere | SCQVSDIELVWQLAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0105239_126014701 | 3300010375 | Corn Rhizosphere | TVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0126350_120502961 | 3300010880 | Boreal Forest Soil | NVSLPEREARRLDGQRQVISESLCRLTALAEAAS* |
| Ga0151489_12166661 | 3300011106 | Soil | WQLAEAGTGTVIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA* |
| Ga0137389_113772362 | 3300012096 | Vadose Zone Soil | VNVSLPEREAQRLDGQHHVIREALRRLAALAEAAS* |
| Ga0137383_105107021 | 3300012199 | Vadose Zone Soil | TAIHVQVSLPEQEAHRLDGQHQLIAESLRRLAALAESPT* |
| Ga0157337_10033782 | 3300012483 | Arabidopsis Rhizosphere | EDGPGTAIHVQVSLPEQEAHRLDGQHQLIGESLRRLAALAEAA* |
| Ga0137398_103633112 | 3300012683 | Vadose Zone Soil | AEDGPGTAIGVQVSLPEREAHRLDGQHQIMEESLRRLAALAEAAV* |
| Ga0157373_100961433 | 3300013100 | Corn Rhizosphere | LAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAT* |
| Ga0157372_124109631 | 3300013307 | Corn Rhizosphere | GTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAETAA* |
| Ga0181532_101236461 | 3300014164 | Bog | IISCQVFAIDMVWQLAEIGAGTSIHVNVTAPESQAHRLDGQHQLIEESLRRLSALAEAAS |
| Ga0137403_111142832 | 3300015264 | Vadose Zone Soil | MPQKLRVDQVNDRVTVSCQVSDIDVVWQLAERGPGTAIQVTVSLPEQEAHRLDGQHQVIEASLRRLSALAETAA* |
| Ga0182032_114582212 | 3300016357 | Soil | WQLAEAGDGTSIHVAASLPESEAHRLDGQHQVIEESLRRLTALAEAAS |
| Ga0134083_103932302 | 3300017659 | Grasslands Soil | VWQLAESGAGTSIHVQVSLPEHEAHRLDGQRQLIGESLRRLAALAEAAA |
| Ga0187812_10311671 | 3300017821 | Freshwater Sediment | LAEAGTGTSINVNVSLPEREAHRLDGQQNVISESLRRVTALAEHSS |
| Ga0187812_11024251 | 3300017821 | Freshwater Sediment | LAEAGTGTSINVNVSLPEREAHRLDGQQNVISESLRRLTALAEHSS |
| Ga0187807_11381282 | 3300017926 | Freshwater Sediment | VIISCQVFAIEMVWQLAEAGAGTSIHVNVTGPESAAHRLDGQHQLIEESLRRLTALAEAA |
| Ga0187801_100078831 | 3300017933 | Freshwater Sediment | AEAGTGTSIHVNVSLPQHEARRLDGQQQVIQESLRRLTTLAEAAS |
| Ga0187801_104944891 | 3300017933 | Freshwater Sediment | INVNVSLPEREAHRLDGQQNVISESLRRLTALAEHSS |
| Ga0187817_101383871 | 3300017955 | Freshwater Sediment | IVWQLAEAGAGTSINVNVSVPEREARRLDDQHRVISESLRRLTALAEAAS |
| Ga0187817_107956201 | 3300017955 | Freshwater Sediment | LAEAGMGTSINVNVSLPEHEAHRLDGQHQAIQESLRRLTALAEAAS |
| Ga0187779_100617481 | 3300017959 | Tropical Peatland | TGTSIHVNVSLPQREAHRLDGQQQVISESLRRLTALAEAAT |
| Ga0187779_106352992 | 3300017959 | Tropical Peatland | AEAGTGTSIHVNVRLPQREAHRLDGQHQVISESLRRLTALAEAAS |
| Ga0187781_102718671 | 3300017972 | Tropical Peatland | TSIHLNVTLPESEAHRLGRQHRLIEESLRRLTALAEAAS |
| Ga0187816_105441542 | 3300017995 | Freshwater Sediment | WQLAEIDAGTSIHVNLSLPEREAHLLDYQHEVIEESLRRLTALAEAAS |
| Ga0187769_100399534 | 3300018086 | Tropical Peatland | VVWQLAETGAGTSIHVNVPAPEPEAHLIDRQHRLIEESLRRLAALAEAAS |
| Ga0187769_101602894 | 3300018086 | Tropical Peatland | WQLAESGGGTFIRVNVSLPQREAHRLDGQQQVIQESLRRLTALAEAAS |
| Ga0187770_103775662 | 3300018090 | Tropical Peatland | VWQLAETGAGTSIHVNVTAPESEAHLLDRQHRLIEESLRRLAALAEAAS |
| Ga0210399_104042291 | 3300020581 | Soil | SDIEIVWQLAEDGPGTAIHVQVSLPVQEAHRLDGQHQAIAESLRRLAALAEAPP |
| Ga0210401_109952752 | 3300020583 | Soil | QVSDIDVVWQLAEAGTGTSITVNVSLPAREAHRLDGQHQAIAESLHRLTALAEAAS |
| Ga0210404_107942922 | 3300021088 | Soil | AEDGPGTAISVQVSLPEQEAHRLDGQHQIMEESLRRLAALAESPT |
| Ga0210405_108835522 | 3300021171 | Soil | VSVSLPEQEAHRLDRQRQVIGESLRRLTALAEAPP |
| Ga0213881_104844891 | 3300021374 | Exposed Rock | IQVKVSLPDREAHRLDGQHQVMEESLSHLTALAEAGS |
| Ga0210397_108278182 | 3300021403 | Soil | LAEDGPGTAIHVQVSLPEREARRLDGQHQLIEESLRRLATLAESPT |
| Ga0210392_107456371 | 3300021475 | Soil | GGTSIHVTVSLPEPEAHRLDRQRQVIGESLRRLTTLAEAAS |
| Ga0210402_104785752 | 3300021478 | Soil | GGTSIHVSVSLPEQEAHRLDRQRQVIGESLRRLTALAEAPP |
| Ga0207692_100229144 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AGTAIHLNVTAPESQARRLDRQHQLIEQSLRRLTALAEAAS |
| Ga0207692_107776761 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IQVTVSLPEREARRLDGQHRIMQESLRRLTALAEAA |
| Ga0207680_108615472 | 3300025903 | Switchgrass Rhizosphere | GGPGTAIQVTVSLPEREAHRLDGQRQAIGESLRRLAALAEAAAS |
| Ga0207685_102832152 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | NVNVILPEREAHRLDGQHQVISESLRRLTALAEAAS |
| Ga0207699_100087791 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | HLNVTAPESQARRLDRQHQLIEQSLRRLTALAEAAS |
| Ga0207699_109964331 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | CTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA |
| Ga0207707_105475291 | 3300025912 | Corn Rhizosphere | AGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAT |
| Ga0207695_116133451 | 3300025913 | Corn Rhizosphere | ELVWQLAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA |
| Ga0207695_116243462 | 3300025913 | Corn Rhizosphere | EAGTGTAIHVTVSLPEQEAHRLDGQHQLIEDSLHRLAALAETAA |
| Ga0207664_112700323 | 3300025929 | Agricultural Soil | LAEAGAGTSIHVTISLPEREAHRLDGQRRVIEESLHRLAALAEAAS |
| Ga0207644_101666733 | 3300025931 | Switchgrass Rhizosphere | TAIQVTVSLPEREAHRLDGQRQAIGESLRRLAALAEAAAS |
| Ga0207677_104482922 | 3300026023 | Miscanthus Rhizosphere | TGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA |
| Ga0207703_113707761 | 3300026035 | Switchgrass Rhizosphere | EAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEATA |
| Ga0209268_11776672 | 3300026314 | Soil | GTAIGVQVSLPEQEAHRLDGQQQVMQESLRRLAALAEAAA |
| Ga0207840_10236181 | 3300026910 | Tropical Forest Soil | SIHVNVRLPQREAHRLDGQQQVIQESLRRLTALAEAAS |
| Ga0209074_100145033 | 3300027787 | Agricultural Soil | VVWQLAEGGPGTAIQVIVSLPEREAHRLDGQHQAIEESLRRLAALAEAAA |
| Ga0209074_103210501 | 3300027787 | Agricultural Soil | IGVQVSLPEHEAHRLDGQRQAIGESLRRLAALAESAA |
| Ga0209166_101292943 | 3300027857 | Surface Soil | QLAEAGPGTSINVNVSLPEREARRLDGQRQVISESLCRLTALAEAAS |
| Ga0209166_103901801 | 3300027857 | Surface Soil | LAEAGMGTSINVNVSLPEREAHRFDGQHQAIEESLRRLTALAEAAS |
| Ga0209275_100899803 | 3300027884 | Soil | DQANERVTVSCQVSDIEFTWQLAELGAGTSIHVTASLPESEAHRLDGRHQVIEESLRRLAALAEAAA |
| Ga0307312_105242441 | 3300028828 | Soil | AIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAS |
| Ga0222748_10495301 | 3300029701 | Soil | IVWQLAEAGTSTSINLNVTLPERQAHRLDGQHQVIEESLRRLTTLAEAAS |
| Ga0318493_100627661 | 3300031723 | Soil | WQLAESGTGTSIQVNVSLPEREAHRLDGQHQVIEESLRRLSALAEAAS |
| Ga0318500_106664551 | 3300031724 | Soil | QVSYIDVVWQLAEAGTGTSIQVNVSLPQREAHRLDGQQQVISESLRRLTALAEAAS |
| Ga0318502_102073291 | 3300031747 | Soil | VIISCQVFAIEMVWQLAEAGAGTSIHLNVTAPESEAPRLDRQHQLIEESLRRLTALAEAA |
| Ga0318492_104076231 | 3300031748 | Soil | TGTSIHVNVSLPQHEAHRLDGQQQVISESLRRLTALAEAAS |
| Ga0318494_104890042 | 3300031751 | Soil | VIISCQVFAIEMVWQLAEAGAGTSIHVSFTAPESEAHKVDSQHQLFEESLRRLTALAEAA |
| Ga0318554_101777433 | 3300031765 | Soil | VNVSLPEREAHRLDGQHQVIEESLRRLSALAEAAS |
| Ga0318509_108203922 | 3300031768 | Soil | QANERVTVSCQVSDIEIVWQLAEAGTGTSIHVNVSLPEHEAHRLDGQQQVISESLRRLTALAEHSS |
| Ga0318526_100697652 | 3300031769 | Soil | VTVSPPEREAHRLDGRHQVIEESLRRLAALAEAAA |
| Ga0318552_100107083 | 3300031782 | Soil | GTGTSIQVNVSLPQREAHRLDGQQQVISESLRRLTALAEAAS |
| Ga0318565_103228621 | 3300031799 | Soil | QVNVSLPEREAHRLDGQHQVIEESLRRLSALAEAAS |
| Ga0318567_103005331 | 3300031821 | Soil | HVSFTAPESEAHRVDGQHKLFEESLRRLTALAEAAS |
| Ga0307478_104857122 | 3300031823 | Hardwood Forest Soil | ITVNVSLPAREAHRLDGQHQAITESLHRLTALAEAAS |
| Ga0318512_102772951 | 3300031846 | Soil | VSAIEMVWQLAEAGAGTSIHVSFTAPESEAHRVDGQHKLFEESLRRLTALAEAAS |
| Ga0306921_107003711 | 3300031912 | Soil | HVNVSLPQHEAHRLDGQQQVISESLRRLTALAEAAS |
| Ga0318562_105271591 | 3300032008 | Soil | PQTLRVDQADGRVIMSCQVFAIDVVWQLAEAGAGTAIHVNVTLPESEAHRLDGQHQLIEESPRRLTALAEAAS |
| Ga0318569_102278051 | 3300032010 | Soil | IQVNVSLPQREAHRLDGQQQVISESLRRLTALAEAAS |
| Ga0318504_101841861 | 3300032063 | Soil | VSDIDVVWQLAEAGTGTSIHVNVSLPQHEAHRLDGQQQVISESLRRLTALAEAAS |
| Ga0307472_1004877962 | 3300032205 | Hardwood Forest Soil | LAEAGTGTAIHVTVSLPEREARRLDGQHQLIEESLHRLAALAEAAA |
| Ga0335085_125752591 | 3300032770 | Soil | AGAGTSIHVNVTGPESRAHRLDDLHQLIGESLRRLTALAEAAS |
| Ga0335079_111693052 | 3300032783 | Soil | LAESGTGTAIQVTVSLPDREAHRLDDQHQIIEESLRHLTALAEAAS |
| Ga0335075_104041172 | 3300032896 | Soil | GTAIHVHVSLPEREAHRLDGQHQAIEESLRRLTALAEAAA |
| ⦗Top⦘ |