| Basic Information | |
|---|---|
| Family ID | F079100 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GTHIKLENVNGRIEIHHAQDGRALSPVKDLSHRDKDDDDDSSI |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 84.48 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.828 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (13.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.172 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.172 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.31% Coil/Unstructured: 81.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF08241 | Methyltransf_11 | 58.62 |
| PF13520 | AA_permease_2 | 4.31 |
| PF00202 | Aminotran_3 | 2.59 |
| PF14559 | TPR_19 | 1.72 |
| PF09364 | XFP_N | 0.86 |
| PF02861 | Clp_N | 0.86 |
| PF03738 | GSP_synth | 0.86 |
| PF00441 | Acyl-CoA_dh_1 | 0.86 |
| PF07238 | PilZ | 0.86 |
| PF05139 | Erythro_esteras | 0.86 |
| PF13751 | DDE_Tnp_1_6 | 0.86 |
| PF03065 | Glyco_hydro_57 | 0.86 |
| PF13450 | NAD_binding_8 | 0.86 |
| PF10417 | 1-cysPrx_C | 0.86 |
| PF00561 | Abhydrolase_1 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG0754 | Glutathionylspermidine synthase, CHAP domain | Amino acid transport and metabolism [E] | 0.86 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.86 |
| COG2312 | Erythromycin esterase homolog | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.83 % |
| Unclassified | root | N/A | 5.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig84376 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300001084|JGI12648J13191_1018213 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300001100|JGI12703J13194_103709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300001593|JGI12635J15846_10333024 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100389369 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300004082|Ga0062384_100238088 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300004082|Ga0062384_100415869 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005436|Ga0070713_101499838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 654 | Open in IMG/M |
| 3300005439|Ga0070711_100347643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
| 3300005541|Ga0070733_10835562 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005568|Ga0066703_10703000 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005602|Ga0070762_10695309 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005607|Ga0070740_10436496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300006052|Ga0075029_100574537 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300006162|Ga0075030_100510738 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300006162|Ga0075030_101497964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 528 | Open in IMG/M |
| 3300006173|Ga0070716_100866999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 704 | Open in IMG/M |
| 3300006176|Ga0070765_101553771 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006237|Ga0097621_100787420 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300006755|Ga0079222_11129636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300009012|Ga0066710_104192072 | Not Available | 539 | Open in IMG/M |
| 3300009552|Ga0116138_1163513 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009644|Ga0116121_1166812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300010359|Ga0126376_12107001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300010366|Ga0126379_13800040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300010376|Ga0126381_100241024 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300010379|Ga0136449_104545806 | Not Available | 509 | Open in IMG/M |
| 3300011120|Ga0150983_11621500 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300011120|Ga0150983_13982661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 602 | Open in IMG/M |
| 3300011269|Ga0137392_10471831 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300011271|Ga0137393_11718402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300014657|Ga0181522_10759738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300014658|Ga0181519_10177762 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300015374|Ga0132255_100005810 | All Organisms → cellular organisms → Bacteria | 13858 | Open in IMG/M |
| 3300015374|Ga0132255_103728611 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300017823|Ga0187818_10047460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1845 | Open in IMG/M |
| 3300017929|Ga0187849_1003818 | All Organisms → cellular organisms → Bacteria | 12922 | Open in IMG/M |
| 3300017936|Ga0187821_10103841 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300017955|Ga0187817_10220628 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300017955|Ga0187817_10843843 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300017959|Ga0187779_10939276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300017975|Ga0187782_10092095 | All Organisms → cellular organisms → Bacteria | 2227 | Open in IMG/M |
| 3300017975|Ga0187782_10165352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1650 | Open in IMG/M |
| 3300018034|Ga0187863_10544767 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300018468|Ga0066662_12470603 | Not Available | 547 | Open in IMG/M |
| 3300019241|Ga0187793_1421550 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300019275|Ga0187798_1871117 | Not Available | 554 | Open in IMG/M |
| 3300020579|Ga0210407_11170014 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300020581|Ga0210399_10009237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7704 | Open in IMG/M |
| 3300021168|Ga0210406_10576152 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300021180|Ga0210396_10010366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8766 | Open in IMG/M |
| 3300021181|Ga0210388_11471693 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021401|Ga0210393_10538308 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300021401|Ga0210393_11110797 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021405|Ga0210387_10108530 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
| 3300021407|Ga0210383_10267701 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300021420|Ga0210394_10467088 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300021433|Ga0210391_10741252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300021476|Ga0187846_10393735 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021477|Ga0210398_10597439 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300021478|Ga0210402_11025096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300021559|Ga0210409_10756424 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300021560|Ga0126371_10367553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
| 3300022557|Ga0212123_10043587 | All Organisms → cellular organisms → Bacteria | 4258 | Open in IMG/M |
| 3300022732|Ga0224569_102358 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300023056|Ga0233357_1037182 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025134|Ga0207416_1029731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2602 | Open in IMG/M |
| 3300025898|Ga0207692_10271854 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300025928|Ga0207700_10642682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300027334|Ga0209529_1055793 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027605|Ga0209329_1067071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300027676|Ga0209333_1016744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2106 | Open in IMG/M |
| 3300027706|Ga0209581_1261446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 528 | Open in IMG/M |
| 3300027767|Ga0209655_10099896 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300027853|Ga0209274_10074155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1648 | Open in IMG/M |
| 3300027853|Ga0209274_10628986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300027879|Ga0209169_10079115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
| 3300027884|Ga0209275_10225705 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300027884|Ga0209275_10657410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 603 | Open in IMG/M |
| 3300027895|Ga0209624_10055038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2551 | Open in IMG/M |
| 3300027895|Ga0209624_10354631 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300027911|Ga0209698_11256287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 543 | Open in IMG/M |
| 3300028747|Ga0302219_10404687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300028773|Ga0302234_10395456 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300028788|Ga0302189_10392449 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300028906|Ga0308309_10387776 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300028906|Ga0308309_11855757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300029951|Ga0311371_10025477 | All Organisms → cellular organisms → Bacteria | 10785 | Open in IMG/M |
| 3300029951|Ga0311371_12202487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300030007|Ga0311338_11102351 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300030007|Ga0311338_11150862 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300030007|Ga0311338_11443247 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300030043|Ga0302306_10428231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300030503|Ga0311370_11541908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300030503|Ga0311370_11643150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300030503|Ga0311370_11959305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300030524|Ga0311357_10541769 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300030524|Ga0311357_11710828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300030737|Ga0302310_10168007 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300030838|Ga0311335_11113278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 565 | Open in IMG/M |
| 3300031231|Ga0170824_100936336 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031234|Ga0302325_10129670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4595 | Open in IMG/M |
| 3300031234|Ga0302325_13068230 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031715|Ga0307476_10456017 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031718|Ga0307474_10485317 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031754|Ga0307475_10136245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1942 | Open in IMG/M |
| 3300031754|Ga0307475_10957473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300031823|Ga0307478_10053713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2996 | Open in IMG/M |
| 3300031941|Ga0310912_10867799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 695 | Open in IMG/M |
| 3300032160|Ga0311301_11990027 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300032898|Ga0335072_10194176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2417 | Open in IMG/M |
| 3300033134|Ga0335073_10801995 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300033158|Ga0335077_10524978 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300033829|Ga0334854_000072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 47481 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.72% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.86% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.86% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_01088940 | 2140918007 | Soil | LGTGGTHIKLENVNGRIEIRHAQDGRALSPVKDLSHRDKDDDDDSI |
| JGI12648J13191_10182132 | 3300001084 | Forest Soil | DLRGELGSGGPQIKLENVNGHIEIHHASDGRALSPAKDLNHGDDDDKI* |
| JGI12703J13194_1037092 | 3300001100 | Forest Soil | RLENVNGRIEIRHASDGRALSPAKDLNHRDHDGDEDESEI* |
| JGI12635J15846_103330241 | 3300001593 | Forest Soil | ELGSGGPQIKLENVNGHIEIHHASDGRALSPAKDLNHGDDDDKI* |
| JGIcombinedJ26739_1003893693 | 3300002245 | Forest Soil | LGTGGTRIRLQNVNGRVQIHHAQDGRAMSPAKDLGHRDKDDDTI* |
| Ga0062384_1002380881 | 3300004082 | Bog Forest Soil | GGPHIKLENVNGRIEIRHASDGRALSPVKDLSHRDKDDDEI* |
| Ga0062384_1004158692 | 3300004082 | Bog Forest Soil | PRIKLENVNGRIEIRHASDGRALSPVKDLSHRDKDDDEI* |
| Ga0070713_1014998381 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GSRIHLSDVNGRIEIRHAQDGRAMSPVKDRSHHDKDDDGSEI* |
| Ga0070711_1003476431 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | HIRLSDVNGRIDIHHAQDGHAMSPVKDLSRDSKKDDDDDSEI* |
| Ga0070733_108355621 | 3300005541 | Surface Soil | NVNGRIEIHHAQDGRALSPVKDMNHGDKDEDDDDSSI* |
| Ga0066703_107030001 | 3300005568 | Soil | SNVNGRIDIHHAQDGRAMSPVKDRNKHDKGDDDDTI* |
| Ga0070762_106953091 | 3300005602 | Soil | GTHIKLENVNGRIEIHHAQDGRALSPVKDLSHRDKDDDDDSSI* |
| Ga0070740_104364961 | 3300005607 | Surface Soil | NGGTHIRIENVNGHVEIHHAQDGHAMSPVKDRNHNDKDSDDDSEI* |
| Ga0075029_1005745372 | 3300006052 | Watersheds | RISNVNGRVEVRHAQDGRALSPVKDLSHHNKDDDDDSSI* |
| Ga0075030_1005107381 | 3300006162 | Watersheds | DVNGRIEIRHAQDGHAMSPVKDQNHHDKDDDDSEI* |
| Ga0075030_1014979642 | 3300006162 | Watersheds | ELGSGGAHIRISNVNGRVEVRHAQDGRALSPVKDLSHHNKDDDDDSSI* |
| Ga0070716_1008669991 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HLSDVNGRIEIRHAQDGRAMSPVKDRSHHDKDDDGSEI* |
| Ga0070765_1015537712 | 3300006176 | Soil | GELGTGGPRIKLENVNGRIEIHHASDGRALSPVKDLGGRGDDEI* |
| Ga0097621_1007874202 | 3300006237 | Miscanthus Rhizosphere | GTRIKLSNVNGRIDVHHAQDGRAMSPVKDRSQHDKDEDDDTI* |
| Ga0079222_111296361 | 3300006755 | Agricultural Soil | GELGNGRVHIRLSDVNGRIEIHHAQDGHAMSPVKDLSRDSKDDDDSEI* |
| Ga0066710_1041920721 | 3300009012 | Grasslands Soil | VNGRIEIRHASDNRALSPVKDLNRGSDSDRNEDDDSEI |
| Ga0116138_11635131 | 3300009552 | Peatland | LGGGGMHIRLENVNGRIEVHHASDGRTLSPAKDLGQRDGDDDDDSKI* |
| Ga0116121_11668121 | 3300009644 | Peatland | LKLENVNGHIEIRHASDGRALSPAKDLSHRDKDDDDDSEI* |
| Ga0126376_121070012 | 3300010359 | Tropical Forest Soil | GNGGAHIKLSDVNGRVEIHHAQDGHSISPVKDRSRHDDDDDDSEI* |
| Ga0126379_138000402 | 3300010366 | Tropical Forest Soil | LGNGGTHIKLNNVNGRIEIRHAQDGRAMSPVKDRGHHDNDDDDSTI* |
| Ga0126381_1002410243 | 3300010376 | Tropical Forest Soil | GGTRIKVSSVNGRVAIHHAQDGRSLSPVKDRSHGGDDDSI* |
| Ga0136449_1045458061 | 3300010379 | Peatlands Soil | GHIEIRHASDGRALSPVKDLSQRHRDSDDDDDSEI* |
| Ga0150983_116215002 | 3300011120 | Forest Soil | VNGRIEIHHAQDGRAISPVKDLSHSDKDDDDDSI* |
| Ga0150983_139826611 | 3300011120 | Forest Soil | VNGRIEIRHASDGRALSPVKDLNHRDRDNDDEDDSEI* |
| Ga0137392_104718312 | 3300011269 | Vadose Zone Soil | GTRIELKNVNGRIEVRHAEDGRALSPVKDLSHQDRDKDDDDSEI* |
| Ga0137393_117184021 | 3300011271 | Vadose Zone Soil | IELKNVNGRIEVRHAEDGRALSPVKDLSHRDQDDDHDDSEI* |
| Ga0181517_100302611 | 3300014160 | Bog | NGRIEVHHASDGRTLSPAKDLGQRDGDDDDDSKI* |
| Ga0181522_107597381 | 3300014657 | Bog | RIELKNVNGRIEVHHATDGRTLSPVKDLSHRDGDDKDDSEI* |
| Ga0181519_101777621 | 3300014658 | Bog | NGRIEIHHAQDGRALSPAKDTGHHDKDDDDDSSI* |
| Ga0132255_1000058101 | 3300015374 | Arabidopsis Rhizosphere | LSNVNGHVEIHHAQDGHAMSPVKDRSGHDKDDDDESKI* |
| Ga0132255_1037286111 | 3300015374 | Arabidopsis Rhizosphere | KLSNVNGRIEVHHAQDGRAMSPVKDRSQHDKDDDDDTI* |
| Ga0187818_100474601 | 3300017823 | Freshwater Sediment | THIRLQNVNGRIDIHHAQDGHALSPVRDLSHGDGDDDTI |
| Ga0187849_100381813 | 3300017929 | Peatland | RIKLSNVNGRIEIRHASDGRVLSPAKDLGHRDKDDDDDREI |
| Ga0187821_101038412 | 3300017936 | Freshwater Sediment | THIKLENVNGRIEIHHAQDGHAMSPVKDRNHGSHDDDDDSDI |
| Ga0187817_102206281 | 3300017955 | Freshwater Sediment | IKLSNVNGRVEIHHAQDGRTMSPVKNRSQHDKDDDSEI |
| Ga0187817_108438432 | 3300017955 | Freshwater Sediment | GGTHIRLKNVNGRIDIHHAQDGHALSPVKDLSHGDGDDDTI |
| Ga0187779_109392761 | 3300017959 | Tropical Peatland | LGSGGARIHLSNVNGHIEIHHANDGRTMSPVKDLSREDRDDDDDSTI |
| Ga0187782_100920951 | 3300017975 | Tropical Peatland | LGNGGTRIKLENVNGRISIHHAQDGRTLSPVKDLSHHDRDEDDDSQI |
| Ga0187782_101653521 | 3300017975 | Tropical Peatland | RNVNGRVEIHHAQDGRAVSPVKDRNHHNDDDDSEI |
| Ga0187863_105447671 | 3300018034 | Peatland | IKLENVNGHIEIRHASDGRALSPVKDLSHRDGDDDDDSKI |
| Ga0066662_124706032 | 3300018468 | Grasslands Soil | GGGTRIKLSNVNGTIEIHHASDNRALSPVKDLNRNSDRDRDEDDDSEI |
| Ga0187793_14215502 | 3300019241 | Peatland | SNVNGHIEVHHAQDGRALSPVKDLNHRDHDDDDDSEI |
| Ga0187798_18711172 | 3300019275 | Peatland | HIKLSDVNGRIEIHHAQDGRALSPVKDLGRREHDSDDEDDSEI |
| Ga0210407_111700141 | 3300020579 | Soil | HIKLADVNGRIEIRHAQDGRALSPVKDLGGRDKDDDDDSEI |
| Ga0210399_1000923710 | 3300020581 | Soil | KLANVNGRIEVHHAQDGRALSPVKDLSHSDKDDEDDDSSI |
| Ga0210406_105761523 | 3300021168 | Soil | ENVNGRIEIRHASDGRALSPVRDLSHRDKDDDDDSEI |
| Ga0210396_100103661 | 3300021180 | Soil | DLRGELGTGGPRIKLENVNGRIEIRHASDGRALSPVKDLSRRDDDDEI |
| Ga0210388_114716932 | 3300021181 | Soil | GAHISLKNVNGRIEIRHAQDGRAMSPVKDLGHRDDDDSI |
| Ga0210393_105383082 | 3300021401 | Soil | GEVGSGGARIKLENVNGQVVIHHAQDGHSMSPVKDLSQHDGDDDDDSEI |
| Ga0210393_111107972 | 3300021401 | Soil | GTGGAHIKLENVNGGIEIHHARDGKAISPVKDLSHHDHDDDDDSI |
| Ga0210387_101085304 | 3300021405 | Soil | GPRIKLEDVNGHIEIRHASDGRTLSPVKDLSHRDHDNDGDDDSEM |
| Ga0210383_102677013 | 3300021407 | Soil | LGSGGARIKLANVNGRIEIRHASDGRSLSPVKDLSHRDKDEDDDGEI |
| Ga0210394_104670882 | 3300021420 | Soil | RGELGTGGTHIELKNVNGRIQIHHAQDGRALSPAKDLNHHDGDGDSI |
| Ga0210391_107412521 | 3300021433 | Soil | LRGELGTGGPRINLENVNGRIEIHHASDGRALSPVKDLGGRGDDEI |
| Ga0187846_103937351 | 3300021476 | Biofilm | DVNGRIEIRHAQDGHAMSPVKDRNHSDKDDDDSEI |
| Ga0210398_105974391 | 3300021477 | Soil | LKNVNGRIAVHHASDGRTLSPVKDLSHRDGDDKDDSEI |
| Ga0210402_110250962 | 3300021478 | Soil | VNGRIEIRHAQDGRALSPVKDMSGSDKDDDDDSSI |
| Ga0210409_107564242 | 3300021559 | Soil | LRGELGTGGTRIKLEDVNGRIEIHHAQDGRALSPVKDLSHSDKDDDDDSI |
| Ga0126371_103675533 | 3300021560 | Tropical Forest Soil | HIDLRNVNGRVEIRHAQDGRAISPVKDRNHHNDDDDSEI |
| Ga0212123_100435874 | 3300022557 | Iron-Sulfur Acid Spring | DLSGELGSGGARIKLSDVNGRVEIHHAQDGHAISPVKDRSHRHDDDDDSEI |
| Ga0224569_1023583 | 3300022732 | Rhizosphere | ELGNGGPHIKLENVNGRIEIRHASDGRALSPAKDLSHGDKDNGDDSEI |
| Ga0222622_106533282 | 3300022756 | Groundwater Sediment | GPRIKLSNVNGTIEIRHASDNRTLSPVKDLNRGSDSDRDEDDDNEI |
| Ga0233357_10371821 | 3300023056 | Soil | GTRIKLGNVNGRIEIHHAQDGRAMSPVKDLSHRDKDDDDTI |
| Ga0207416_10297313 | 3300025134 | Iron-Sulfur Acid Spring | VARIKLSDVNGRVEIHHAQDGHAISPVKDRSHRHDDDDDSEI |
| Ga0207692_102718541 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LSNVNGRIDVHHAQDGRAMSPVKDRSQHDKDEDDDTI |
| Ga0207700_106426823 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RLSDVNGRIEIHHAQDGHAMSPVKDLSRDSKDDDDSEI |
| Ga0209529_10557931 | 3300027334 | Forest Soil | GPRIKLSSVNGRIEIRHASDGRALSPAKDLSHHEKDDEDDSEI |
| Ga0209329_10670711 | 3300027605 | Forest Soil | IRLENVNGRIEIRHASDGRALSPVKDLSHRDKDDDDDESEI |
| Ga0209333_10167443 | 3300027676 | Forest Soil | KNVNGRIAVHHASDGRTLSPVKDLSHRDGDDKDDSEI |
| Ga0209581_12614461 | 3300027706 | Surface Soil | GNGGTHIRIENVNGHVEIHHAQDGHAMSPVKDRNHNDKDSDDDSEI |
| Ga0209655_100998961 | 3300027767 | Bog Forest Soil | NVNGRIEIRHASDGRALSPVKDLGDRDKDDDDSEI |
| Ga0209274_100741551 | 3300027853 | Soil | GELGTGGAHIKLENVNGGIEIHHAQDGKAMSPVKDMSRRDHDGDDDTI |
| Ga0209274_106289862 | 3300027853 | Soil | VNGRIEIRHASDGRALSPAKDLGHRDKDDDDDSEI |
| Ga0209169_100791153 | 3300027879 | Soil | GGTQIKLDNVNGKIEIHHAQDGRSLSPVKDLGDRDEGDDSI |
| Ga0209275_102257052 | 3300027884 | Soil | TRIELKNVNGRIAVHHASDGRTLSPVKDLSHRDGDDKDDSEI |
| Ga0209275_106574102 | 3300027884 | Soil | GTHIKLENVNGRIEIHHAQDGRALSPVKDLSHRDKDDDDDSSI |
| Ga0209624_100550381 | 3300027895 | Forest Soil | PRIKLETVNGRIEIRHASDGRALSPVKDLSGRDKDGDDEI |
| Ga0209624_103546312 | 3300027895 | Forest Soil | GGPRIKLENVNGRIEIRHASDGRALSPVKDLSRRDDDDEI |
| Ga0209698_112562871 | 3300027911 | Watersheds | SGGAHIRISNVNGRVEVRHAQDGRALSPVKDLSHHNKDDDDDSSI |
| Ga0302219_104046872 | 3300028747 | Palsa | KLENVNGRINIRHAQDGRTMSPVKDRSHRDKDDDDDSEI |
| Ga0302234_103954562 | 3300028773 | Palsa | LNNVNGRIEINHAQDGRALIPVKDLSHRDKDDDDDSI |
| Ga0302189_103924491 | 3300028788 | Bog | GELGSGGPRIKLENVNGRIEIRHASDGRALSPAKDLNHRDKDDEDESEI |
| Ga0308309_103877762 | 3300028906 | Soil | RGELGNGGPHIKLENVNGRIEIRHASDGRALSPAKDLSHGDKDDDDDSEI |
| Ga0308309_118557571 | 3300028906 | Soil | KLESVNGHIEIHHASDGRTLSPVKDLNHRNGDDDDI |
| Ga0311371_1002547710 | 3300029951 | Palsa | ENVNGRIEIRHASDGRALSPAKDLSHRDKDDDGSEI |
| Ga0311371_122024871 | 3300029951 | Palsa | LEDVNGRIQIRHASDGRALSPVKDLSHRDKDDDDDSKI |
| Ga0311338_111023511 | 3300030007 | Palsa | GPRVKLENVNGRINIRHASDGRALSPAKDLSHGDKDDDDDSKI |
| Ga0311338_111508622 | 3300030007 | Palsa | RIKLANVNGHINIHHASDGRALSPVKDLSGRDDDDDSKI |
| Ga0311338_114432472 | 3300030007 | Palsa | VKLENVNGRIDIRHASDGRALSPAKDLSHNDKDDDDDSKI |
| Ga0302306_104282311 | 3300030043 | Palsa | IKLNNVNGRIEINHAQDGRALSPVKDLSHRDKDDDDDSI |
| Ga0311370_115419082 | 3300030503 | Palsa | ARIKLEDVNGRIDIRHASDGRALSPVKDLSHGNDADDI |
| Ga0311370_116431502 | 3300030503 | Palsa | GGPHIKLENVNGHISIHHAPDGRALSPAKDLNHGDDDDKI |
| Ga0311370_119593051 | 3300030503 | Palsa | RLENVNGRIDVRHAQDGRALSPVKDLSHRDKDDDDDSEI |
| Ga0311357_105417691 | 3300030524 | Palsa | GPHIKLENVNGRIEIRHASDGRALSPAKDLSHRDKDDDGSEI |
| Ga0311357_117108282 | 3300030524 | Palsa | GGGARIKLEDVNGRIDIRHASDGRALSPVKDLSHGNDADDI |
| Ga0302310_101680073 | 3300030737 | Palsa | ELGSGGPHIKLENVNGHISIHHAPDGRALSPAKDLNHGDDDDKI |
| Ga0311335_111132782 | 3300030838 | Fen | TRIKLNNVNGRIEILHAGDGRALSPAKDNGNHDDDDTI |
| Ga0170824_1009363362 | 3300031231 | Forest Soil | GSGGTHIKLADVNGRIEIRHAQDGRALSPVKDLGGRDKDDDDDSEI |
| Ga0302325_101296701 | 3300031234 | Palsa | LENVNGRIDVRHAQDGRALSPVKDLSHRDKDDDDDSEI |
| Ga0302325_130682302 | 3300031234 | Palsa | ELGNGGPRVKLENVNGRINIRHASDGRALSPAKDLSHGDKDDDDDSKI |
| Ga0307476_104560172 | 3300031715 | Hardwood Forest Soil | SGGPRIKLENVNGHIEIHHASDGRALSPVKDLSHRDRDDDDEI |
| Ga0307474_104853172 | 3300031718 | Hardwood Forest Soil | ARIRLENVNGRIEIRHASDGRALSPAKDLNHRDHDGDEDESEI |
| Ga0307475_101362451 | 3300031754 | Hardwood Forest Soil | KLANVNGHIEIHHASDGRTLSPVRDLSHRDKDGDDDESEI |
| Ga0307475_109574731 | 3300031754 | Hardwood Forest Soil | ANVNGGIEIHHAQDGRALSPVKDMNHNDKDDDDDSSI |
| Ga0307478_100537134 | 3300031823 | Hardwood Forest Soil | GPRIKLENVNGHIEIHHASDGRALSPVKDLSHRDKDDDDEI |
| Ga0310912_108677992 | 3300031941 | Soil | GKGGTRIHLSDVNGRIEIRHAQDGHAISPVKDRNHSDKDDDDSSI |
| Ga0311301_119900272 | 3300032160 | Peatlands Soil | NVNGRIEIHHAQDGRALSPVKDLNHHDRDDDDDSEI |
| Ga0335072_101941763 | 3300032898 | Soil | GKGGTRIKLSDVNGRVSIHHAQDGHAMSPVKDRGDRDDDDSEI |
| Ga0335073_108019952 | 3300033134 | Soil | AHIHLSDVNGRIDIHHAQDGRAMSPVKDRGGDGKDDDEI |
| Ga0335077_105249783 | 3300033158 | Soil | RIKISNVNGHIEIRHASDGHAMSPVKDRDKDDDDSEI |
| Ga0334854_000072_47329_47481 | 3300033829 | Soil | RGELGNGGPRIKLENVNGRVKIRHASDGRALSPAKDLSRGDKDDDDDSEI |
| ⦗Top⦘ |