NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079095

Metagenome / Metatranscriptome Family F079095

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079095
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 42 residues
Representative Sequence VPSTATYNAGEKLSMFVLAAAVLAAAIGSAFAAGWVIGRILL
Number of Associated Samples 101
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 59.48 %
% of genes near scaffold ends (potentially truncated) 33.62 %
% of genes from short scaffolds (< 2000 bps) 87.93 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(7.759 % of family members)
Environment Ontology (ENVO) Unclassified
(21.552 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.586 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.14%    β-sheet: 0.00%    Coil/Unstructured: 52.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF12773DZR 28.45
PF00334NDK 12.93
PF08245Mur_ligase_M 6.90
PF08241Methyltransf_11 3.45
PF10458Val_tRNA-synt_C 3.45
PF00072Response_reg 0.86
PF07729FCD 0.86
PF00291PALP 0.86
PF08264Anticodon_1 0.86
PF13649Methyltransf_25 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 12.93
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.86
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10066998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei913Open in IMG/M
3300000955|JGI1027J12803_105312058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300001535|A3PFW1_10033380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300003324|soilH2_10283229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1054Open in IMG/M
3300004156|Ga0062589_102264166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales558Open in IMG/M
3300004157|Ga0062590_101634094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales653Open in IMG/M
3300004480|Ga0062592_100653679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales905Open in IMG/M
3300004633|Ga0066395_10303309All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300004643|Ga0062591_101040909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300004643|Ga0062591_102329300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales560Open in IMG/M
3300005175|Ga0066673_10121532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1426Open in IMG/M
3300005175|Ga0066673_10234824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1058Open in IMG/M
3300005177|Ga0066690_10101045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1852Open in IMG/M
3300005178|Ga0066688_10812444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales584Open in IMG/M
3300005332|Ga0066388_101838491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1079Open in IMG/M
3300005332|Ga0066388_103536838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales798Open in IMG/M
3300005337|Ga0070682_100040799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2857Open in IMG/M
3300005337|Ga0070682_100800719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales765Open in IMG/M
3300005339|Ga0070660_101396580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300005434|Ga0070709_10274977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1222Open in IMG/M
3300005454|Ga0066687_10121678All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300005518|Ga0070699_101716686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300005526|Ga0073909_10676262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300005532|Ga0070739_10002873All Organisms → cellular organisms → Bacteria22207Open in IMG/M
3300005539|Ga0068853_100921578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300005544|Ga0070686_101718270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales533Open in IMG/M
3300005547|Ga0070693_101456434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300005568|Ga0066703_10129860All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300005614|Ga0068856_100081717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3206Open in IMG/M
3300005615|Ga0070702_101383163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300005764|Ga0066903_101189432All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300005905|Ga0075269_10021821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300006028|Ga0070717_11632839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300006173|Ga0070716_100958294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300006800|Ga0066660_10920352All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300006804|Ga0079221_10353266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp.889Open in IMG/M
3300006806|Ga0079220_11759102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300006852|Ga0075433_11293155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300006854|Ga0075425_102964412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300009137|Ga0066709_101057486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1191Open in IMG/M
3300009137|Ga0066709_101542105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium955Open in IMG/M
3300009177|Ga0105248_10666232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1174Open in IMG/M
3300010043|Ga0126380_10573597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria883Open in IMG/M
3300010046|Ga0126384_11887986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300010152|Ga0126318_10483937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300010360|Ga0126372_10005723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6071Open in IMG/M
3300010361|Ga0126378_10611676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1204Open in IMG/M
3300010362|Ga0126377_12174005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales631Open in IMG/M
3300010364|Ga0134066_10398860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300010373|Ga0134128_10007989All Organisms → cellular organisms → Bacteria12739Open in IMG/M
3300010376|Ga0126381_101094002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1151Open in IMG/M
3300010376|Ga0126381_102131330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300010376|Ga0126381_102240659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300010396|Ga0134126_10250270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2096Open in IMG/M
3300012199|Ga0137383_10289653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1199Open in IMG/M
3300012199|Ga0137383_10721088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300012209|Ga0137379_11827388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300012211|Ga0137377_11311722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300012399|Ga0134061_1120630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300012911|Ga0157301_10335486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300012948|Ga0126375_11077673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300012955|Ga0164298_10848723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300012960|Ga0164301_11725976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300012972|Ga0134077_10396052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales596Open in IMG/M
3300012975|Ga0134110_10084697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1271Open in IMG/M
3300012988|Ga0164306_11965105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300012989|Ga0164305_11325969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300013763|Ga0120179_1055954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria896Open in IMG/M
3300013772|Ga0120158_10297491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales782Open in IMG/M
3300014497|Ga0182008_10395984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales741Open in IMG/M
3300015261|Ga0182006_1327005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300015265|Ga0182005_1288369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300016371|Ga0182034_10421132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1100Open in IMG/M
3300017959|Ga0187779_10725104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300017973|Ga0187780_10370156All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300018431|Ga0066655_11438376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300019888|Ga0193751_1002296All Organisms → cellular organisms → Bacteria11659Open in IMG/M
3300019888|Ga0193751_1032486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2425Open in IMG/M
3300020070|Ga0206356_10305556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1034Open in IMG/M
3300020082|Ga0206353_12057278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales737Open in IMG/M
3300021445|Ga0182009_10125346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300021445|Ga0182009_10206312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium959Open in IMG/M
3300022467|Ga0224712_10131657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300024186|Ga0247688_1007674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1502Open in IMG/M
3300024275|Ga0247674_1027058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300024331|Ga0247668_1112800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300025918|Ga0207662_10453202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales877Open in IMG/M
3300025921|Ga0207652_10239035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1637Open in IMG/M
3300025939|Ga0207665_10322857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1159Open in IMG/M
3300026095|Ga0207676_11636750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300026300|Ga0209027_1208218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales629Open in IMG/M
3300026343|Ga0209159_1256793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300027773|Ga0209810_1000715All Organisms → cellular organisms → Bacteria64448Open in IMG/M
3300028705|Ga0307276_10045091All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300031366|Ga0307506_10321376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300031446|Ga0170820_14413476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300031544|Ga0318534_10051263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2310Open in IMG/M
3300031938|Ga0308175_100351724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1523Open in IMG/M
3300031938|Ga0308175_103222452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300031954|Ga0306926_10422115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1645Open in IMG/M
3300031996|Ga0308176_11114627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300032067|Ga0318524_10120096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1314Open in IMG/M
3300032074|Ga0308173_11149823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300032074|Ga0308173_11189820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium712Open in IMG/M
3300032180|Ga0307471_101938552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300032770|Ga0335085_10273449All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300032770|Ga0335085_11122715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales841Open in IMG/M
3300032782|Ga0335082_10061782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3824Open in IMG/M
3300032782|Ga0335082_10166781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2118Open in IMG/M
3300032782|Ga0335082_10254412All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300032783|Ga0335079_10322503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1681Open in IMG/M
3300032829|Ga0335070_10221049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1874Open in IMG/M
3300032897|Ga0335071_10184473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2040Open in IMG/M
3300032898|Ga0335072_11301740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300033803|Ga0314862_0186043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales515Open in IMG/M
3300033805|Ga0314864_0175963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales553Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.45%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.59%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.59%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.72%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.72%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.86%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.86%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024275Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1006699823300000597Forest SoilVPSVATYNAGEKLSMFVLAAAVLAGAIGSAFAAGWVIGRILL*
JGI1027J12803_10531205823300000955SoilVPSTATYNPPKDKAEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL*
A3PFW1_1003338033300001535PermafrostVASTATHNPPENRHQKLSIFALAFIVLVGAVGTAFAAGWIIGRMLL*
soilH2_1028322923300003324Sugarcane Root And Bulk SoilMATTATHRPGEKLSIFALAAFVLAGAIGSAFAAGFLIGRMLL*
Ga0062589_10226416623300004156SoilVPSTATYNTPESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL*
Ga0062590_10163409423300004157SoilVPPTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL*
Ga0062592_10065367923300004480SoilVPSTATYNTSESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL*
Ga0066395_1030330933300004633Tropical Forest SoilVPSTATYNAGEKLSMFVLAAAVLAAAIGSAFAAGWVIGRILL*
Ga0062591_10104090933300004643SoilTHNPPESRAEKLSMFVLAFGVLTGAIGSAFAAGWVIGRMLL*
Ga0062591_10232930023300004643SoilVPPTATTYNAGEKVSMFMLAALVLAAATGSAFAAGWVIGRMLL*
Ga0066673_1012153243300005175SoilATHSPPESRAQKLSMFAFAAIVLAAAIGSAFAAGWVIGRMLL*
Ga0066673_1023482413300005175SoilVPSTATYNPPKDKAEKLSMFVLAFAVLAVAIGSAFAAGWVIGRILL*
Ga0066690_1010104543300005177SoilYVASTATYNPPAGRYERLSMFALAATVLVGAIGSAFAAGWLIGRMLL*
Ga0066688_1081244423300005178SoilVASTATHSPPESRTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL*
Ga0066388_10183849123300005332Tropical Forest SoilVPSAATYNAGEKLSMFVLAAAVLAGTIGSAFAAGWVIGRILL*
Ga0066388_10353683823300005332Tropical Forest SoilVPSAATYNAGEKLSMFVLAAAILAGAIGSAFAAGWVIGRILL*
Ga0070682_10004079913300005337Corn RhizosphereVPPTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRM
Ga0070682_10080071923300005337Corn RhizosphereVPSTATYNPPESRAEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL*
Ga0070660_10139658023300005339Corn RhizosphereVLSTATYNVREKLSMFALAALILAAAIGSAFAPGRVIGRMPV*
Ga0070709_1027497723300005434Corn, Switchgrass And Miscanthus RhizosphereVLSTATYNVGEKLSMFAVAAIVLAAAIGSAFAAGWVIGRMLL*
Ga0066687_1012167843300005454SoilVASTATYNPPAGRYERLSMFGLAATVLVGAIGSAFAAGWLIGRMLL*
Ga0070699_10171668623300005518Corn, Switchgrass And Miscanthus RhizosphereVASTVTHNPGEKLAMFALAAFVLSLAVGTAFAAGWVIGRIVL*
Ga0073909_1067626213300005526Surface SoilVPSTATYNPPESRAEKLSMLVLAFAVLAVAIGSAFAAGWVIGRMLL*
Ga0070739_1000287333300005532Surface SoilVVFNPGEKLSIFTLAAVVLFGAIGSAFAAGWLIGRMLL*
Ga0068853_10092157813300005539Corn RhizosphereTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL*
Ga0070686_10171827023300005544Switchgrass RhizosphereVPPTATTYNAGEKLSMFLLAALVLAAAIGSAFAAGWVIGRMLP*
Ga0070693_10145643423300005547Corn, Switchgrass And Miscanthus RhizosphereVPPTTTYNAGEKLSMFLLAALVLAAAIGSAFAAGWVIGRMLP*
Ga0066703_1012986043300005568SoilRTATYNPGEKLTMFALAAFVLSLAVGTAFAAGWVIGRIVL*
Ga0068856_10008171733300005614Corn RhizosphereVLSTATYNVREKLSMFALAALILAAAIGSAFAPGRVIGRMPL*
Ga0070702_10138316313300005615Corn, Switchgrass And Miscanthus RhizospherePPTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL*
Ga0066903_10118943233300005764Tropical Forest SoilVPSAATYNAGEKLSMFVLAAAVLAGTIGSAFAAGWIIGR
Ga0075269_1002182133300005905Rice Paddy SoilNATHSAGEVLSMFILATIVLAGAIGSAFAAGFVIGRILL*
Ga0070717_1163283913300006028Corn, Switchgrass And Miscanthus RhizosphereVPSSATYNVGEKLSMIALAAIVLAAAIGSAFAAGWVIGR
Ga0070716_10095829423300006173Corn, Switchgrass And Miscanthus RhizosphereVQNTATYNVGEKLSMIALAIFVLAAATGSAFAAGWVIGRMLL*
Ga0066660_1092035233300006800SoilYNPPAGRYERLSMFGLAATVLVGAIGSAFAAGWLIGRMLL*
Ga0079221_1035326623300006804Agricultural SoilVASSATHNPRAGRYEKLSMFLLAFVVLGGAIGSAFAAGFFIGRILL*
Ga0079220_1175910213300006806Agricultural SoilTYNAGEKLSMFVLAALVLAAAIGSAFAAGWVIGRILL*
Ga0075433_1129315513300006852Populus RhizosphereVPSPATYNPPESRAEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL*
Ga0075425_10296441223300006854Populus RhizosphereTATTYNAGEKLSMFVLAAAVLAAAIGSAFAAGWIIGRILL*
Ga0066709_10105748623300009137Grasslands SoilMTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL*
Ga0066709_10154210513300009137Grasslands SoilVPSTATYNPPKDKAEKLSMFVLAFAVLAVAIGSAFAACWVIGRILL*
Ga0105248_1066623213300009177Switchgrass RhizosphereTATYNTPESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL*
Ga0126380_1057359733300010043Tropical Forest SoilLRISVPSTATYSPPISRQEKLSMFVLAAVVLVAVVGTAFAAGWLIGRILL*
Ga0126384_1188798613300010046Tropical Forest SoilPATHKVGDKLTMFALAGIVLAAAIGSAFAAGWVIGRILL*
Ga0126318_1048393723300010152SoilATYNAGEKLSIFALAALVLAAAIGSAFAAGWVIGRILL*
Ga0126372_1000572363300010360Tropical Forest SoilVPSAATYNAGEKLSMFVLAAAVLAGTIGSAFAAGWIIGRILL*
Ga0126378_1061167633300010361Tropical Forest SoilMPGPATYKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL*
Ga0126377_1217400523300010362Tropical Forest SoilVPSTATYNAGEKLSMFVLAAAVLASAIGSAFAAGWVIGRILL*
Ga0134066_1039886023300010364Grasslands SoilVPSTATYNPPKDKADKLSMFVLAFAVLAVAIGSAFAAGWVIGRILL*
Ga0134128_10007989113300010373Terrestrial SoilVAKTSTYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIGRILL*
Ga0126381_10109400213300010376Tropical Forest SoilMPRPATYKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL*
Ga0126381_10213133033300010376Tropical Forest SoilVPSAATYNAGEKLSMFILAAAVLAGSIGSAFAAGWVIGRILL*
Ga0126381_10224065913300010376Tropical Forest SoilMPRPATDKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL*
Ga0134126_1025027023300010396Terrestrial SoilVAKTSAYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIGRILL*
Ga0137383_1028965323300012199Vadose Zone SoilVTHSRPESWYTKLSIFALATAVLASAIGSAFAAGWVIGRMLL*
Ga0137383_1072108823300012199Vadose Zone SoilVARTATYNPGEKLTMFALAAFVLSLAVGTAFAAGWVIGRIVL*
Ga0137379_1182738813300012209Vadose Zone SoilVASNATHNPPESRHEKLAMFALAALVLAGAIGTAFAAGWVIGRMVL*
Ga0137377_1131172213300012211Vadose Zone SoilVASTATHNPPESRHEKLAMFALAALVLVGAIGTAFAAGWVIGRIVL*
Ga0134061_112063023300012399Grasslands SoilSGEKLSMFAFAALVLAAATGSAFAAGWVIGRMLL*
Ga0157301_1033548613300012911SoilVPSTATYNPPESKAEKLSMFVLAFAVLAGAIGSAFAAGWVIGRILL*
Ga0126375_1107767323300012948Tropical Forest SoilVPSAATYNAGEKLSMFVLAAAVLASAIGSAFAAGWVIGRILL*
Ga0164298_1084872323300012955SoilVGEKLSMIALAIFVLAAATGSAFAAGCVIGRMLL*
Ga0164301_1172597623300012960SoilVPSTATYNVGEKLSMFAVAAIVLAAAIGSAFAAGWVIGRMLL*
Ga0134077_1039605223300012972Grasslands SoilVPSTATYNPPKDKAEKLSMFVLAFAVLAVAIGSAFAAGWVIGRMLL*
Ga0134110_1008469713300012975Grasslands SoilTATHSPPESRTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL*
Ga0164306_1196510523300012988SoilVPSFATYNAGEKLSMFILAAAVLAAAIGSAFAAGWIIGRILL*
Ga0164305_1132596913300012989SoilTTTYNPPESRAEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL*
Ga0120179_105595413300013763PermafrostAPCTFSRSSVASTATHNPPENRHQKLSIFALAFIVLVGAVGTAFAAGWIIGRMLL*
Ga0120158_1029749123300013772PermafrostVASTATYNPPESWHEKLAIFALAALVLAGAVGSAFAAGWVIGRIVL*
Ga0182008_1039598423300014497RhizosphereVASNATYNHGEKLSMFVLAALVLVGSIGSAFAAGFVIGRILL*
Ga0182006_132700523300015261RhizosphereVPPTATHSAGEKLSIFVLAALVLAAAIGSAFAAGWVIGRMLL*
Ga0182005_128836923300015265RhizosphereVATTAIYNRPLGRYEKLSMWALAATVLVVAIGSAFAAGFVIGRILL*
Ga0182034_1042113223300016371SoilMPRPATYKVGEKLSMFALAGIVLAAAIGSAFVAGWVIGRIFL
Ga0187779_1072510423300017959Tropical PeatlandMASAATYNHGEKPSMFLLAAVVLVGAVGSAFAAAWTIGRILS
Ga0187780_1037015623300017973Tropical PeatlandMASAATYNHGEKPSMFLLVSVVLVGAVGSAFAAAWTIGRILS
Ga0066655_1143837613300018431Grasslands SoilPDPREKLSMFALAAFVLAGAIGSAFAAGWMIGRILL
Ga0193751_100229683300019888SoilVASTATYNPPESRHEKLAIFALAALVLAAAVGTAFAAGWVIGRIVL
Ga0193751_103248623300019888SoilVASTATDNPPGSRYQKLSIFALAFIVLVGAVGTAFAAGWIIGRMLL
Ga0206356_1030555633300020070Corn, Switchgrass And Miscanthus RhizosphereVPPTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL
Ga0206353_1205727823300020082Corn, Switchgrass And Miscanthus RhizosphereVPPTATTYNAGEKLSMFLLAALVLAAAIGSAFAAGWVIGRMLL
Ga0182009_1012534633300021445SoilVPPTATTYNAGEKVSMFMLAALVLAAATGSAFAAGWVIGRMLL
Ga0182009_1020631223300021445SoilVPPTATTYNAGEKLSLFVLAALVLAAAIGSAFAAGWVIGRMLL
Ga0224712_1013165713300022467Corn, Switchgrass And Miscanthus RhizosphereTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL
Ga0247688_100767423300024186SoilVLSTATYNVREKLSMFALAALILAAAIGSAFAPGRVIGRMRV
Ga0247674_102705813300024275SoilVLSTATYNAGEKLSMFAVAAIVLAAAIGSAFAAGWVIGRMLL
Ga0247668_111280023300024331SoilNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL
Ga0207662_1045320223300025918Switchgrass RhizosphereVPSTATYNTPESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL
Ga0207652_1023903513300025921Corn RhizosphereVPPTTTYNAGEKLSMFLLAALVLAAAIGSAFAAGWVIGRMLP
Ga0207665_1032285733300025939Corn, Switchgrass And Miscanthus RhizosphereVQNTATYNVGEKLSMIALAIFVLAAATGSAFAAGWVIGRMLL
Ga0207676_1163675013300026095Switchgrass RhizosphereVPSTATYNTPESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGMALPFL
Ga0209027_120821823300026300Grasslands SoilVASTATHSPPESRTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL
Ga0209159_125679313300026343SoilTHSPPESRTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL
Ga0209810_1000715403300027773Surface SoilVARTVVFNPGEKLSIFTLAAVVLFGAIGSAFAAGWLIGRMLL
Ga0307276_1004509133300028705SoilTATYNAPEGKHERLSMFVLAFAVLAGAIGSAFAAGWVIGRMLL
Ga0307506_1032137623300031366SoilVASRVIHSPGGKLSMFALAAVVLAAAIGSAFAAGWVIGRMLL
Ga0170820_1441347613300031446Forest SoilNDPKEKLSMFVPAACVLAAVVGTAFARGFMIGKILL
Ga0318534_1005126323300031544SoilMPRPATYKVGEKLSMFALAGIVLAAAIGSAFVAGWVIGRILL
Ga0308175_10035172443300031938SoilVPSSETYNSGEKLSMFAFAALVLAAATGSAFAAGWVIGRMLL
Ga0308175_10322245223300031938SoilVPPTATHSPGTDGHEKLSMFALAFVVLVAAIGSAFAAGWVIGRMLL
Ga0306926_1042211543300031954SoilTSMPRPATYKVGEKLSMFALAGIVLAAAIGSAFVAGWVIGRILL
Ga0308176_1111462713300031996SoilVAKTSTYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIGRILL
Ga0318524_1012009613300032067SoilATYKVGEKLSMFALAGIVLAAAIGSAFVAGWVIGRILL
Ga0308173_1114982323300032074SoilWRSWSSEVAKTSTYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIGRILL
Ga0308173_1118982013300032074SoilVAKTSTYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIG
Ga0307471_10193855223300032180Hardwood Forest SoilVPNSATYKVGEKLSMFILAAAVLATAIGSAFGAGWIIGRILL
Ga0335085_1027344923300032770SoilMTSSATHNPGGKLSIFALAMVVLLGAVGSAFAAGWVIGRMLL
Ga0335085_1112271523300032770SoilVPNTATYNAGEKLSMIAMAIFVLAAATGSAFAAGWVIGRMLL
Ga0335082_1006178233300032782SoilVARTATYNPSEKLSMFALAAFVFVAAIGSAFAAGWMIGRMLL
Ga0335082_1016678153300032782SoilVPSTATYNVGDKLSMIALAVFVLAAATGSAFAAGWVIGRMLL
Ga0335082_1025441233300032782SoilVPNTATYNVGEKLSMIAMAIFVLAAATGSAFAAGWVIGRMLL
Ga0335079_1032250323300032783SoilMPRPATYKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL
Ga0335070_1022104933300032829SoilVPNTATYNVGEKLSMIAMAIFVLAAATGSAFAAGWVI
Ga0335071_1018447313300032897SoilVPNTATYNVGEKLSMIAMAIFVLAAATGSAFAAGWV
Ga0335072_1130174023300032898SoilMPRPATHKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL
Ga0314862_0186043_172_3003300033803PeatlandVPNTATYNLSEKLSMIAFATLVLAAAIGSAFAAGCVIGRILL
Ga0314864_0175963_194_3223300033805PeatlandVPNTATYNLSEKLSMIAFATLVLAAAIGSAFAAGWVIGRILL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.