Basic Information | |
---|---|
Family ID | F079095 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 42 residues |
Representative Sequence | VPSTATYNAGEKLSMFVLAAAVLAAAIGSAFAAGWVIGRILL |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 59.48 % |
% of genes near scaffold ends (potentially truncated) | 33.62 % |
% of genes from short scaffolds (< 2000 bps) | 87.93 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (7.759 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.552 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.586 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF12773 | DZR | 28.45 |
PF00334 | NDK | 12.93 |
PF08245 | Mur_ligase_M | 6.90 |
PF08241 | Methyltransf_11 | 3.45 |
PF10458 | Val_tRNA-synt_C | 3.45 |
PF00072 | Response_reg | 0.86 |
PF07729 | FCD | 0.86 |
PF00291 | PALP | 0.86 |
PF08264 | Anticodon_1 | 0.86 |
PF13649 | Methyltransf_25 | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 12.93 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.86 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10066998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 913 | Open in IMG/M |
3300000955|JGI1027J12803_105312058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300001535|A3PFW1_10033380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
3300003324|soilH2_10283229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1054 | Open in IMG/M |
3300004156|Ga0062589_102264166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 558 | Open in IMG/M |
3300004157|Ga0062590_101634094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 653 | Open in IMG/M |
3300004480|Ga0062592_100653679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 905 | Open in IMG/M |
3300004633|Ga0066395_10303309 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300004643|Ga0062591_101040909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
3300004643|Ga0062591_102329300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 560 | Open in IMG/M |
3300005175|Ga0066673_10121532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1426 | Open in IMG/M |
3300005175|Ga0066673_10234824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
3300005177|Ga0066690_10101045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1852 | Open in IMG/M |
3300005178|Ga0066688_10812444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 584 | Open in IMG/M |
3300005332|Ga0066388_101838491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1079 | Open in IMG/M |
3300005332|Ga0066388_103536838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 798 | Open in IMG/M |
3300005337|Ga0070682_100040799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2857 | Open in IMG/M |
3300005337|Ga0070682_100800719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 765 | Open in IMG/M |
3300005339|Ga0070660_101396580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
3300005434|Ga0070709_10274977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1222 | Open in IMG/M |
3300005454|Ga0066687_10121678 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300005518|Ga0070699_101716686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300005526|Ga0073909_10676262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300005532|Ga0070739_10002873 | All Organisms → cellular organisms → Bacteria | 22207 | Open in IMG/M |
3300005539|Ga0068853_100921578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
3300005544|Ga0070686_101718270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 533 | Open in IMG/M |
3300005547|Ga0070693_101456434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300005568|Ga0066703_10129860 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300005614|Ga0068856_100081717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3206 | Open in IMG/M |
3300005615|Ga0070702_101383163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300005764|Ga0066903_101189432 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300005905|Ga0075269_10021821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
3300006028|Ga0070717_11632839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
3300006173|Ga0070716_100958294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
3300006800|Ga0066660_10920352 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300006804|Ga0079221_10353266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. | 889 | Open in IMG/M |
3300006806|Ga0079220_11759102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300006852|Ga0075433_11293155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
3300006854|Ga0075425_102964412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300009137|Ga0066709_101057486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1191 | Open in IMG/M |
3300009137|Ga0066709_101542105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 955 | Open in IMG/M |
3300009177|Ga0105248_10666232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1174 | Open in IMG/M |
3300010043|Ga0126380_10573597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
3300010046|Ga0126384_11887986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300010152|Ga0126318_10483937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
3300010360|Ga0126372_10005723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6071 | Open in IMG/M |
3300010361|Ga0126378_10611676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
3300010362|Ga0126377_12174005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 631 | Open in IMG/M |
3300010364|Ga0134066_10398860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300010373|Ga0134128_10007989 | All Organisms → cellular organisms → Bacteria | 12739 | Open in IMG/M |
3300010376|Ga0126381_101094002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1151 | Open in IMG/M |
3300010376|Ga0126381_102131330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
3300010376|Ga0126381_102240659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
3300010396|Ga0134126_10250270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2096 | Open in IMG/M |
3300012199|Ga0137383_10289653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1199 | Open in IMG/M |
3300012199|Ga0137383_10721088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
3300012209|Ga0137379_11827388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300012211|Ga0137377_11311722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
3300012399|Ga0134061_1120630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
3300012911|Ga0157301_10335486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300012948|Ga0126375_11077673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
3300012955|Ga0164298_10848723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
3300012960|Ga0164301_11725976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300012972|Ga0134077_10396052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 596 | Open in IMG/M |
3300012975|Ga0134110_10084697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1271 | Open in IMG/M |
3300012988|Ga0164306_11965105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300012989|Ga0164305_11325969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300013763|Ga0120179_1055954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
3300013772|Ga0120158_10297491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 782 | Open in IMG/M |
3300014497|Ga0182008_10395984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 741 | Open in IMG/M |
3300015261|Ga0182006_1327005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300015265|Ga0182005_1288369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300016371|Ga0182034_10421132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1100 | Open in IMG/M |
3300017959|Ga0187779_10725104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
3300017973|Ga0187780_10370156 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300018431|Ga0066655_11438376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300019888|Ga0193751_1002296 | All Organisms → cellular organisms → Bacteria | 11659 | Open in IMG/M |
3300019888|Ga0193751_1032486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2425 | Open in IMG/M |
3300020070|Ga0206356_10305556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
3300020082|Ga0206353_12057278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 737 | Open in IMG/M |
3300021445|Ga0182009_10125346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1198 | Open in IMG/M |
3300021445|Ga0182009_10206312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 959 | Open in IMG/M |
3300022467|Ga0224712_10131657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
3300024186|Ga0247688_1007674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1502 | Open in IMG/M |
3300024275|Ga0247674_1027058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
3300024331|Ga0247668_1112800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300025918|Ga0207662_10453202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 877 | Open in IMG/M |
3300025921|Ga0207652_10239035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1637 | Open in IMG/M |
3300025939|Ga0207665_10322857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
3300026095|Ga0207676_11636750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
3300026300|Ga0209027_1208218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 629 | Open in IMG/M |
3300026343|Ga0209159_1256793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300027773|Ga0209810_1000715 | All Organisms → cellular organisms → Bacteria | 64448 | Open in IMG/M |
3300028705|Ga0307276_10045091 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300031366|Ga0307506_10321376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
3300031446|Ga0170820_14413476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
3300031544|Ga0318534_10051263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2310 | Open in IMG/M |
3300031938|Ga0308175_100351724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1523 | Open in IMG/M |
3300031938|Ga0308175_103222452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
3300031954|Ga0306926_10422115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1645 | Open in IMG/M |
3300031996|Ga0308176_11114627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
3300032067|Ga0318524_10120096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1314 | Open in IMG/M |
3300032074|Ga0308173_11149823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300032074|Ga0308173_11189820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
3300032180|Ga0307471_101938552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300032770|Ga0335085_10273449 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
3300032770|Ga0335085_11122715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 841 | Open in IMG/M |
3300032782|Ga0335082_10061782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3824 | Open in IMG/M |
3300032782|Ga0335082_10166781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2118 | Open in IMG/M |
3300032782|Ga0335082_10254412 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
3300032783|Ga0335079_10322503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1681 | Open in IMG/M |
3300032829|Ga0335070_10221049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1874 | Open in IMG/M |
3300032897|Ga0335071_10184473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2040 | Open in IMG/M |
3300032898|Ga0335072_11301740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300033803|Ga0314862_0186043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 515 | Open in IMG/M |
3300033805|Ga0314864_0175963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 553 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.31% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.59% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.59% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.72% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.86% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_100669982 | 3300000597 | Forest Soil | VPSVATYNAGEKLSMFVLAAAVLAGAIGSAFAAGWVIGRILL* |
JGI1027J12803_1053120582 | 3300000955 | Soil | VPSTATYNPPKDKAEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL* |
A3PFW1_100333803 | 3300001535 | Permafrost | VASTATHNPPENRHQKLSIFALAFIVLVGAVGTAFAAGWIIGRMLL* |
soilH2_102832292 | 3300003324 | Sugarcane Root And Bulk Soil | MATTATHRPGEKLSIFALAAFVLAGAIGSAFAAGFLIGRMLL* |
Ga0062589_1022641662 | 3300004156 | Soil | VPSTATYNTPESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL* |
Ga0062590_1016340942 | 3300004157 | Soil | VPPTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL* |
Ga0062592_1006536792 | 3300004480 | Soil | VPSTATYNTSESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL* |
Ga0066395_103033093 | 3300004633 | Tropical Forest Soil | VPSTATYNAGEKLSMFVLAAAVLAAAIGSAFAAGWVIGRILL* |
Ga0062591_1010409093 | 3300004643 | Soil | THNPPESRAEKLSMFVLAFGVLTGAIGSAFAAGWVIGRMLL* |
Ga0062591_1023293002 | 3300004643 | Soil | VPPTATTYNAGEKVSMFMLAALVLAAATGSAFAAGWVIGRMLL* |
Ga0066673_101215324 | 3300005175 | Soil | ATHSPPESRAQKLSMFAFAAIVLAAAIGSAFAAGWVIGRMLL* |
Ga0066673_102348241 | 3300005175 | Soil | VPSTATYNPPKDKAEKLSMFVLAFAVLAVAIGSAFAAGWVIGRILL* |
Ga0066690_101010454 | 3300005177 | Soil | YVASTATYNPPAGRYERLSMFALAATVLVGAIGSAFAAGWLIGRMLL* |
Ga0066688_108124442 | 3300005178 | Soil | VASTATHSPPESRTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL* |
Ga0066388_1018384912 | 3300005332 | Tropical Forest Soil | VPSAATYNAGEKLSMFVLAAAVLAGTIGSAFAAGWVIGRILL* |
Ga0066388_1035368382 | 3300005332 | Tropical Forest Soil | VPSAATYNAGEKLSMFVLAAAILAGAIGSAFAAGWVIGRILL* |
Ga0070682_1000407991 | 3300005337 | Corn Rhizosphere | VPPTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRM |
Ga0070682_1008007192 | 3300005337 | Corn Rhizosphere | VPSTATYNPPESRAEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL* |
Ga0070660_1013965802 | 3300005339 | Corn Rhizosphere | VLSTATYNVREKLSMFALAALILAAAIGSAFAPGRVIGRMPV* |
Ga0070709_102749772 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSTATYNVGEKLSMFAVAAIVLAAAIGSAFAAGWVIGRMLL* |
Ga0066687_101216784 | 3300005454 | Soil | VASTATYNPPAGRYERLSMFGLAATVLVGAIGSAFAAGWLIGRMLL* |
Ga0070699_1017166862 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VASTVTHNPGEKLAMFALAAFVLSLAVGTAFAAGWVIGRIVL* |
Ga0073909_106762621 | 3300005526 | Surface Soil | VPSTATYNPPESRAEKLSMLVLAFAVLAVAIGSAFAAGWVIGRMLL* |
Ga0070739_100028733 | 3300005532 | Surface Soil | VVFNPGEKLSIFTLAAVVLFGAIGSAFAAGWLIGRMLL* |
Ga0068853_1009215781 | 3300005539 | Corn Rhizosphere | TATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL* |
Ga0070686_1017182702 | 3300005544 | Switchgrass Rhizosphere | VPPTATTYNAGEKLSMFLLAALVLAAAIGSAFAAGWVIGRMLP* |
Ga0070693_1014564342 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VPPTTTYNAGEKLSMFLLAALVLAAAIGSAFAAGWVIGRMLP* |
Ga0066703_101298604 | 3300005568 | Soil | RTATYNPGEKLTMFALAAFVLSLAVGTAFAAGWVIGRIVL* |
Ga0068856_1000817173 | 3300005614 | Corn Rhizosphere | VLSTATYNVREKLSMFALAALILAAAIGSAFAPGRVIGRMPL* |
Ga0070702_1013831631 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PPTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL* |
Ga0066903_1011894323 | 3300005764 | Tropical Forest Soil | VPSAATYNAGEKLSMFVLAAAVLAGTIGSAFAAGWIIGR |
Ga0075269_100218213 | 3300005905 | Rice Paddy Soil | NATHSAGEVLSMFILATIVLAGAIGSAFAAGFVIGRILL* |
Ga0070717_116328391 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPSSATYNVGEKLSMIALAAIVLAAAIGSAFAAGWVIGR |
Ga0070716_1009582942 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNTATYNVGEKLSMIALAIFVLAAATGSAFAAGWVIGRMLL* |
Ga0066660_109203523 | 3300006800 | Soil | YNPPAGRYERLSMFGLAATVLVGAIGSAFAAGWLIGRMLL* |
Ga0079221_103532662 | 3300006804 | Agricultural Soil | VASSATHNPRAGRYEKLSMFLLAFVVLGGAIGSAFAAGFFIGRILL* |
Ga0079220_117591021 | 3300006806 | Agricultural Soil | TYNAGEKLSMFVLAALVLAAAIGSAFAAGWVIGRILL* |
Ga0075433_112931551 | 3300006852 | Populus Rhizosphere | VPSPATYNPPESRAEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL* |
Ga0075425_1029644122 | 3300006854 | Populus Rhizosphere | TATTYNAGEKLSMFVLAAAVLAAAIGSAFAAGWIIGRILL* |
Ga0066709_1010574862 | 3300009137 | Grasslands Soil | MTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL* |
Ga0066709_1015421051 | 3300009137 | Grasslands Soil | VPSTATYNPPKDKAEKLSMFVLAFAVLAVAIGSAFAACWVIGRILL* |
Ga0105248_106662321 | 3300009177 | Switchgrass Rhizosphere | TATYNTPESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL* |
Ga0126380_105735973 | 3300010043 | Tropical Forest Soil | LRISVPSTATYSPPISRQEKLSMFVLAAVVLVAVVGTAFAAGWLIGRILL* |
Ga0126384_118879861 | 3300010046 | Tropical Forest Soil | PATHKVGDKLTMFALAGIVLAAAIGSAFAAGWVIGRILL* |
Ga0126318_104839372 | 3300010152 | Soil | ATYNAGEKLSIFALAALVLAAAIGSAFAAGWVIGRILL* |
Ga0126372_100057236 | 3300010360 | Tropical Forest Soil | VPSAATYNAGEKLSMFVLAAAVLAGTIGSAFAAGWIIGRILL* |
Ga0126378_106116763 | 3300010361 | Tropical Forest Soil | MPGPATYKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL* |
Ga0126377_121740052 | 3300010362 | Tropical Forest Soil | VPSTATYNAGEKLSMFVLAAAVLASAIGSAFAAGWVIGRILL* |
Ga0134066_103988602 | 3300010364 | Grasslands Soil | VPSTATYNPPKDKADKLSMFVLAFAVLAVAIGSAFAAGWVIGRILL* |
Ga0134128_1000798911 | 3300010373 | Terrestrial Soil | VAKTSTYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIGRILL* |
Ga0126381_1010940021 | 3300010376 | Tropical Forest Soil | MPRPATYKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL* |
Ga0126381_1021313303 | 3300010376 | Tropical Forest Soil | VPSAATYNAGEKLSMFILAAAVLAGSIGSAFAAGWVIGRILL* |
Ga0126381_1022406591 | 3300010376 | Tropical Forest Soil | MPRPATDKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL* |
Ga0134126_102502702 | 3300010396 | Terrestrial Soil | VAKTSAYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIGRILL* |
Ga0137383_102896532 | 3300012199 | Vadose Zone Soil | VTHSRPESWYTKLSIFALATAVLASAIGSAFAAGWVIGRMLL* |
Ga0137383_107210882 | 3300012199 | Vadose Zone Soil | VARTATYNPGEKLTMFALAAFVLSLAVGTAFAAGWVIGRIVL* |
Ga0137379_118273881 | 3300012209 | Vadose Zone Soil | VASNATHNPPESRHEKLAMFALAALVLAGAIGTAFAAGWVIGRMVL* |
Ga0137377_113117221 | 3300012211 | Vadose Zone Soil | VASTATHNPPESRHEKLAMFALAALVLVGAIGTAFAAGWVIGRIVL* |
Ga0134061_11206302 | 3300012399 | Grasslands Soil | SGEKLSMFAFAALVLAAATGSAFAAGWVIGRMLL* |
Ga0157301_103354861 | 3300012911 | Soil | VPSTATYNPPESKAEKLSMFVLAFAVLAGAIGSAFAAGWVIGRILL* |
Ga0126375_110776732 | 3300012948 | Tropical Forest Soil | VPSAATYNAGEKLSMFVLAAAVLASAIGSAFAAGWVIGRILL* |
Ga0164298_108487232 | 3300012955 | Soil | VGEKLSMIALAIFVLAAATGSAFAAGCVIGRMLL* |
Ga0164301_117259762 | 3300012960 | Soil | VPSTATYNVGEKLSMFAVAAIVLAAAIGSAFAAGWVIGRMLL* |
Ga0134077_103960522 | 3300012972 | Grasslands Soil | VPSTATYNPPKDKAEKLSMFVLAFAVLAVAIGSAFAAGWVIGRMLL* |
Ga0134110_100846971 | 3300012975 | Grasslands Soil | TATHSPPESRTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL* |
Ga0164306_119651052 | 3300012988 | Soil | VPSFATYNAGEKLSMFILAAAVLAAAIGSAFAAGWIIGRILL* |
Ga0164305_113259691 | 3300012989 | Soil | TTTYNPPESRAEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL* |
Ga0120179_10559541 | 3300013763 | Permafrost | APCTFSRSSVASTATHNPPENRHQKLSIFALAFIVLVGAVGTAFAAGWIIGRMLL* |
Ga0120158_102974912 | 3300013772 | Permafrost | VASTATYNPPESWHEKLAIFALAALVLAGAVGSAFAAGWVIGRIVL* |
Ga0182008_103959842 | 3300014497 | Rhizosphere | VASNATYNHGEKLSMFVLAALVLVGSIGSAFAAGFVIGRILL* |
Ga0182006_13270052 | 3300015261 | Rhizosphere | VPPTATHSAGEKLSIFVLAALVLAAAIGSAFAAGWVIGRMLL* |
Ga0182005_12883692 | 3300015265 | Rhizosphere | VATTAIYNRPLGRYEKLSMWALAATVLVVAIGSAFAAGFVIGRILL* |
Ga0182034_104211322 | 3300016371 | Soil | MPRPATYKVGEKLSMFALAGIVLAAAIGSAFVAGWVIGRIFL |
Ga0187779_107251042 | 3300017959 | Tropical Peatland | MASAATYNHGEKPSMFLLAAVVLVGAVGSAFAAAWTIGRILS |
Ga0187780_103701562 | 3300017973 | Tropical Peatland | MASAATYNHGEKPSMFLLVSVVLVGAVGSAFAAAWTIGRILS |
Ga0066655_114383761 | 3300018431 | Grasslands Soil | PDPREKLSMFALAAFVLAGAIGSAFAAGWMIGRILL |
Ga0193751_10022968 | 3300019888 | Soil | VASTATYNPPESRHEKLAIFALAALVLAAAVGTAFAAGWVIGRIVL |
Ga0193751_10324862 | 3300019888 | Soil | VASTATDNPPGSRYQKLSIFALAFIVLVGAVGTAFAAGWIIGRMLL |
Ga0206356_103055563 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VPPTATTYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL |
Ga0206353_120572782 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VPPTATTYNAGEKLSMFLLAALVLAAAIGSAFAAGWVIGRMLL |
Ga0182009_101253463 | 3300021445 | Soil | VPPTATTYNAGEKVSMFMLAALVLAAATGSAFAAGWVIGRMLL |
Ga0182009_102063122 | 3300021445 | Soil | VPPTATTYNAGEKLSLFVLAALVLAAAIGSAFAAGWVIGRMLL |
Ga0224712_101316571 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | TYNAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL |
Ga0247688_10076742 | 3300024186 | Soil | VLSTATYNVREKLSMFALAALILAAAIGSAFAPGRVIGRMRV |
Ga0247674_10270581 | 3300024275 | Soil | VLSTATYNAGEKLSMFAVAAIVLAAAIGSAFAAGWVIGRMLL |
Ga0247668_11128002 | 3300024331 | Soil | NAGEKLSMFALAALVLAAVIGSAFAAGWVIGRMLL |
Ga0207662_104532022 | 3300025918 | Switchgrass Rhizosphere | VPSTATYNTPESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGRMLL |
Ga0207652_102390351 | 3300025921 | Corn Rhizosphere | VPPTTTYNAGEKLSMFLLAALVLAAAIGSAFAAGWVIGRMLP |
Ga0207665_103228573 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNTATYNVGEKLSMIALAIFVLAAATGSAFAAGWVIGRMLL |
Ga0207676_116367501 | 3300026095 | Switchgrass Rhizosphere | VPSTATYNTPESRTEKLSMFVLAFAVLAVAIGSAFTAGWVIGMALPFL |
Ga0209027_12082182 | 3300026300 | Grasslands Soil | VASTATHSPPESRTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL |
Ga0209159_12567931 | 3300026343 | Soil | THSPPESRTQKLSMFAMAAIVLAAAIGSAFAAGWIIGRILL |
Ga0209810_100071540 | 3300027773 | Surface Soil | VARTVVFNPGEKLSIFTLAAVVLFGAIGSAFAAGWLIGRMLL |
Ga0307276_100450913 | 3300028705 | Soil | TATYNAPEGKHERLSMFVLAFAVLAGAIGSAFAAGWVIGRMLL |
Ga0307506_103213762 | 3300031366 | Soil | VASRVIHSPGGKLSMFALAAVVLAAAIGSAFAAGWVIGRMLL |
Ga0170820_144134761 | 3300031446 | Forest Soil | NDPKEKLSMFVPAACVLAAVVGTAFARGFMIGKILL |
Ga0318534_100512632 | 3300031544 | Soil | MPRPATYKVGEKLSMFALAGIVLAAAIGSAFVAGWVIGRILL |
Ga0308175_1003517244 | 3300031938 | Soil | VPSSETYNSGEKLSMFAFAALVLAAATGSAFAAGWVIGRMLL |
Ga0308175_1032224522 | 3300031938 | Soil | VPPTATHSPGTDGHEKLSMFALAFVVLVAAIGSAFAAGWVIGRMLL |
Ga0306926_104221154 | 3300031954 | Soil | TSMPRPATYKVGEKLSMFALAGIVLAAAIGSAFVAGWVIGRILL |
Ga0308176_111146271 | 3300031996 | Soil | VAKTSTYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIGRILL |
Ga0318524_101200961 | 3300032067 | Soil | ATYKVGEKLSMFALAGIVLAAAIGSAFVAGWVIGRILL |
Ga0308173_111498232 | 3300032074 | Soil | WRSWSSEVAKTSTYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIGRILL |
Ga0308173_111898201 | 3300032074 | Soil | VAKTSTYNPGETLSMFMLAAVVLVGSIGSAFAAGFFIG |
Ga0307471_1019385522 | 3300032180 | Hardwood Forest Soil | VPNSATYKVGEKLSMFILAAAVLATAIGSAFGAGWIIGRILL |
Ga0335085_102734492 | 3300032770 | Soil | MTSSATHNPGGKLSIFALAMVVLLGAVGSAFAAGWVIGRMLL |
Ga0335085_111227152 | 3300032770 | Soil | VPNTATYNAGEKLSMIAMAIFVLAAATGSAFAAGWVIGRMLL |
Ga0335082_100617823 | 3300032782 | Soil | VARTATYNPSEKLSMFALAAFVFVAAIGSAFAAGWMIGRMLL |
Ga0335082_101667815 | 3300032782 | Soil | VPSTATYNVGDKLSMIALAVFVLAAATGSAFAAGWVIGRMLL |
Ga0335082_102544123 | 3300032782 | Soil | VPNTATYNVGEKLSMIAMAIFVLAAATGSAFAAGWVIGRMLL |
Ga0335079_103225032 | 3300032783 | Soil | MPRPATYKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL |
Ga0335070_102210493 | 3300032829 | Soil | VPNTATYNVGEKLSMIAMAIFVLAAATGSAFAAGWVI |
Ga0335071_101844731 | 3300032897 | Soil | VPNTATYNVGEKLSMIAMAIFVLAAATGSAFAAGWV |
Ga0335072_113017402 | 3300032898 | Soil | MPRPATHKVGEKLSMFALAGIVLAAAIGSAFAAGWVIGRILL |
Ga0314862_0186043_172_300 | 3300033803 | Peatland | VPNTATYNLSEKLSMIAFATLVLAAAIGSAFAAGCVIGRILL |
Ga0314864_0175963_194_322 | 3300033805 | Peatland | VPNTATYNLSEKLSMIAFATLVLAAAIGSAFAAGWVIGRILL |
⦗Top⦘ |