| Basic Information | |
|---|---|
| Family ID | F079090 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 38 residues |
| Representative Sequence | RKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 73.28 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.138 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.483 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.552 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13565 | HTH_32 | 7.76 |
| PF00072 | Response_reg | 1.72 |
| PF01569 | PAP2 | 1.72 |
| PF07238 | PilZ | 1.72 |
| PF02416 | TatA_B_E | 0.86 |
| PF00296 | Bac_luciferase | 0.86 |
| PF00441 | Acyl-CoA_dh_1 | 0.86 |
| PF07244 | POTRA | 0.86 |
| PF07883 | Cupin_2 | 0.86 |
| PF14100 | DUF6807 | 0.86 |
| PF02518 | HATPase_c | 0.86 |
| PF00069 | Pkinase | 0.86 |
| PF13450 | NAD_binding_8 | 0.86 |
| PF02357 | NusG | 0.86 |
| PF13751 | DDE_Tnp_1_6 | 0.86 |
| PF03352 | Adenine_glyco | 0.86 |
| PF02321 | OEP | 0.86 |
| PF13428 | TPR_14 | 0.86 |
| PF08808 | RES | 0.86 |
| PF07690 | MFS_1 | 0.86 |
| PF04014 | MazE_antitoxin | 0.86 |
| PF13669 | Glyoxalase_4 | 0.86 |
| PF05960 | DUF885 | 0.86 |
| PF09250 | Prim-Pol | 0.86 |
| PF04545 | Sigma70_r4 | 0.86 |
| PF08447 | PAS_3 | 0.86 |
| PF00326 | Peptidase_S9 | 0.86 |
| PF00085 | Thioredoxin | 0.86 |
| PF12833 | HTH_18 | 0.86 |
| PF01039 | Carboxyl_trans | 0.86 |
| PF02482 | Ribosomal_S30AE | 0.86 |
| PF04235 | DUF418 | 0.86 |
| PF00702 | Hydrolase | 0.86 |
| PF13620 | CarboxypepD_reg | 0.86 |
| PF00106 | adh_short | 0.86 |
| PF13338 | AbiEi_4 | 0.86 |
| PF06210 | DUF1003 | 0.86 |
| PF00196 | GerE | 0.86 |
| PF08544 | GHMP_kinases_C | 0.86 |
| PF00775 | Dioxygenase_C | 0.86 |
| PF13462 | Thioredoxin_4 | 0.86 |
| PF02384 | N6_Mtase | 0.86 |
| PF00400 | WD40 | 0.86 |
| PF01019 | G_glu_transpept | 0.86 |
| PF13103 | TonB_2 | 0.86 |
| PF13545 | HTH_Crp_2 | 0.86 |
| PF12796 | Ank_2 | 0.86 |
| PF00135 | COesterase | 0.86 |
| PF13668 | Ferritin_2 | 0.86 |
| PF01609 | DDE_Tnp_1 | 0.86 |
| PF00463 | ICL | 0.86 |
| PF03739 | LptF_LptG | 0.86 |
| PF01717 | Meth_synt_2 | 0.86 |
| PF01558 | POR | 0.86 |
| PF04389 | Peptidase_M28 | 0.86 |
| PF12146 | Hydrolase_4 | 0.86 |
| PF00589 | Phage_integrase | 0.86 |
| PF02780 | Transketolase_C | 0.86 |
| PF00005 | ABC_tran | 0.86 |
| PF00180 | Iso_dh | 0.86 |
| PF01715 | IPPT | 0.86 |
| PF05726 | Pirin_C | 0.86 |
| PF00677 | Lum_binding | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.45 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.86 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.86 |
| COG2311 | Uncharacterized membrane protein YeiB | Function unknown [S] | 0.86 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.86 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.86 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.86 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.86 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.86 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.86 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.86 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.86 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.86 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.86 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.86 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.86 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.86 |
| COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.86 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.86 |
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.86 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.86 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.86 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG0307 | Riboflavin synthase alpha chain | Coenzyme transport and metabolism [H] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.14 % |
| Unclassified | root | N/A | 25.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_9032169 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
| 2170459013|GO6OHWN01DS4R0 | Not Available | 526 | Open in IMG/M |
| 2228664021|ICCgaii200_c0931700 | Not Available | 1343 | Open in IMG/M |
| 3300001546|JGI12659J15293_10007979 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
| 3300004800|Ga0058861_11637269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300005329|Ga0070683_100003793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 12343 | Open in IMG/M |
| 3300005337|Ga0070682_100265593 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300005447|Ga0066689_10044487 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
| 3300005533|Ga0070734_10381301 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005563|Ga0068855_100116559 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300005577|Ga0068857_100270527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1561 | Open in IMG/M |
| 3300005586|Ga0066691_10241498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1059 | Open in IMG/M |
| 3300005598|Ga0066706_10103444 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
| 3300005598|Ga0066706_11521640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia tuberum | 503 | Open in IMG/M |
| 3300005764|Ga0066903_109034345 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005994|Ga0066789_10100334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1243 | Open in IMG/M |
| 3300006028|Ga0070717_11394454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia mimosarum | 636 | Open in IMG/M |
| 3300006173|Ga0070716_101112488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 630 | Open in IMG/M |
| 3300006175|Ga0070712_100045024 | All Organisms → cellular organisms → Bacteria | 3045 | Open in IMG/M |
| 3300006354|Ga0075021_10696435 | Not Available | 652 | Open in IMG/M |
| 3300006796|Ga0066665_10276165 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300006871|Ga0075434_101135906 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300006871|Ga0075434_101629598 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006893|Ga0073928_10160135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1805 | Open in IMG/M |
| 3300006893|Ga0073928_10404629 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300007076|Ga0075435_101125251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300009090|Ga0099827_10986804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300009545|Ga0105237_10013439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8586 | Open in IMG/M |
| 3300009545|Ga0105237_12625286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 514 | Open in IMG/M |
| 3300009632|Ga0116102_1015682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2692 | Open in IMG/M |
| 3300009635|Ga0116117_1149834 | Not Available | 600 | Open in IMG/M |
| 3300009637|Ga0116118_1140765 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009643|Ga0116110_1057683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1381 | Open in IMG/M |
| 3300009792|Ga0126374_10206061 | Not Available | 1249 | Open in IMG/M |
| 3300010046|Ga0126384_10870414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300010046|Ga0126384_11659059 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010048|Ga0126373_11092503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300010339|Ga0074046_10289162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300010341|Ga0074045_10848085 | Not Available | 577 | Open in IMG/M |
| 3300010358|Ga0126370_11487430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae | 643 | Open in IMG/M |
| 3300010361|Ga0126378_10112180 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
| 3300010375|Ga0105239_10228284 | Not Available | 2089 | Open in IMG/M |
| 3300010376|Ga0126381_101408974 | Not Available | 1007 | Open in IMG/M |
| 3300010376|Ga0126381_103548507 | Not Available | 612 | Open in IMG/M |
| 3300010379|Ga0136449_101185690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300010396|Ga0134126_10769763 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300010876|Ga0126361_10268094 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012189|Ga0137388_11063879 | Not Available | 745 | Open in IMG/M |
| 3300012349|Ga0137387_10455308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300012351|Ga0137386_11193324 | Not Available | 533 | Open in IMG/M |
| 3300012363|Ga0137390_11535767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300014156|Ga0181518_10018462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 4902 | Open in IMG/M |
| 3300014156|Ga0181518_10410563 | Not Available | 653 | Open in IMG/M |
| 3300014158|Ga0181521_10132085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Afifellaceae → Afifella → unclassified Afifella → Afifella sp. H1R | 1467 | Open in IMG/M |
| 3300014158|Ga0181521_10550386 | Not Available | 546 | Open in IMG/M |
| 3300014162|Ga0181538_10196173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1135 | Open in IMG/M |
| 3300014489|Ga0182018_10168004 | Not Available | 1244 | Open in IMG/M |
| 3300014495|Ga0182015_10106278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1943 | Open in IMG/M |
| 3300014501|Ga0182024_10023930 | All Organisms → cellular organisms → Bacteria | 10896 | Open in IMG/M |
| 3300014501|Ga0182024_11056364 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300014501|Ga0182024_11174977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 900 | Open in IMG/M |
| 3300014501|Ga0182024_12690830 | Not Available | 532 | Open in IMG/M |
| 3300014502|Ga0182021_11648324 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300016270|Ga0182036_10077783 | Not Available | 2185 | Open in IMG/M |
| 3300016445|Ga0182038_10685978 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300017822|Ga0187802_10046852 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300017822|Ga0187802_10224624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 724 | Open in IMG/M |
| 3300017933|Ga0187801_10196533 | Not Available | 798 | Open in IMG/M |
| 3300017938|Ga0187854_10039923 | Not Available | 2408 | Open in IMG/M |
| 3300017941|Ga0187850_10148724 | Not Available | 1100 | Open in IMG/M |
| 3300017943|Ga0187819_10353042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 849 | Open in IMG/M |
| 3300017946|Ga0187879_10054940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2338 | Open in IMG/M |
| 3300018007|Ga0187805_10012939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3544 | Open in IMG/M |
| 3300018007|Ga0187805_10021784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2799 | Open in IMG/M |
| 3300018012|Ga0187810_10085970 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300018017|Ga0187872_10118126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1305 | Open in IMG/M |
| 3300018026|Ga0187857_10006073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8402 | Open in IMG/M |
| 3300018034|Ga0187863_10025419 | All Organisms → cellular organisms → Bacteria | 3559 | Open in IMG/M |
| 3300018034|Ga0187863_10123869 | Not Available | 1445 | Open in IMG/M |
| 3300020581|Ga0210399_10347169 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300021180|Ga0210396_10005311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12492 | Open in IMG/M |
| 3300021432|Ga0210384_10383070 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300021478|Ga0210402_11339041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300021560|Ga0126371_10041549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4358 | Open in IMG/M |
| 3300021560|Ga0126371_10587651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300021560|Ga0126371_11291982 | Not Available | 863 | Open in IMG/M |
| 3300024227|Ga0228598_1070972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300024271|Ga0224564_1033857 | Not Available | 966 | Open in IMG/M |
| 3300025453|Ga0208455_1016283 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300025911|Ga0207654_10004420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7092 | Open in IMG/M |
| 3300025912|Ga0207707_10888631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 737 | Open in IMG/M |
| 3300025914|Ga0207671_10388911 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300025923|Ga0207681_10480787 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300025926|Ga0207659_11493516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300026116|Ga0207674_10003271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 19934 | Open in IMG/M |
| 3300026217|Ga0209871_1057835 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027545|Ga0209008_1000733 | All Organisms → cellular organisms → Bacteria | 9263 | Open in IMG/M |
| 3300027545|Ga0209008_1000814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8668 | Open in IMG/M |
| 3300027842|Ga0209580_10350885 | Not Available | 735 | Open in IMG/M |
| 3300027882|Ga0209590_10947423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
| 3300027895|Ga0209624_10002640 | All Organisms → cellular organisms → Bacteria | 13144 | Open in IMG/M |
| 3300027895|Ga0209624_10068155 | Not Available | 2294 | Open in IMG/M |
| 3300028573|Ga0265334_10153887 | Not Available | 810 | Open in IMG/M |
| 3300028808|Ga0302228_10498379 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300030524|Ga0311357_10741750 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300031234|Ga0302325_11071441 | Not Available | 1090 | Open in IMG/M |
| 3300031545|Ga0318541_10284979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300031708|Ga0310686_100523695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 561 | Open in IMG/M |
| 3300031715|Ga0307476_10582992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300031730|Ga0307516_11020726 | Not Available | 501 | Open in IMG/M |
| 3300031996|Ga0308176_10347465 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300032001|Ga0306922_10011302 | All Organisms → cellular organisms → Bacteria | 8742 | Open in IMG/M |
| 3300032160|Ga0311301_11899925 | Not Available | 702 | Open in IMG/M |
| 3300032782|Ga0335082_10909627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 743 | Open in IMG/M |
| 3300032892|Ga0335081_10270986 | Not Available | 2273 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.17% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.31% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.59% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.72% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.86% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.86% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_00514270 | 2088090015 | Soil | VADLSRKIRKYIRAYAKVAKPFRWSYSDPSRRIIANPMTGT |
| N57_07097640 | 2170459013 | Grass Soil | RKIRNYIRAYIKVAKPFRWSYSDPRRRIIANPITGTAY |
| ICCgaii200_09317001 | 2228664021 | Soil | RKYIRAHAKIAKPFRWSYSDPSRRIIANPMTGTTY |
| JGI12659J15293_100079791 | 3300001546 | Forest Soil | RKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0058861_116372692 | 3300004800 | Host-Associated | VADLSRKIRKYIRVYAKVAKPFRWSYSGPSRRIIANPMTGT |
| Ga0070683_1000037931 | 3300005329 | Corn Rhizosphere | GRKLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY* |
| Ga0070682_1002655932 | 3300005337 | Corn Rhizosphere | VADLSRKIRKYIRAHAKIAKPFRWSYSDPSRRIIANPMTGNTY* |
| Ga0066689_100444871 | 3300005447 | Soil | ARKLRKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY* |
| Ga0070734_103813013 | 3300005533 | Surface Soil | DLGNKLRKYIRAYSKSAKPFRWTYLTPLAESANTMAGTAY* |
| Ga0068855_1001165591 | 3300005563 | Corn Rhizosphere | RKLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY* |
| Ga0068857_1002705271 | 3300005577 | Corn Rhizosphere | LRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY* |
| Ga0066691_102414981 | 3300005586 | Soil | KLRKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY* |
| Ga0066706_101034445 | 3300005598 | Soil | RKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0066706_115216401 | 3300005598 | Soil | KYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0066903_1090343451 | 3300005764 | Tropical Forest Soil | GNKLRKYIRAYSKSAKPFRWTYTDPSRRIIANKIAGTAY* |
| Ga0066789_101003342 | 3300005994 | Soil | LRKYIRAYSKSAKPFRWTYTDPTRRIRANKIAGTSY* |
| Ga0070717_113944541 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NKLRRYIRAYSKSAKPFRWTYTDPTRRIHANRITGTAY* |
| Ga0070716_1011124882 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RKYIRAYATSAKPFRWTYTDPRKRIRTYEITGTPY* |
| Ga0070712_1000450241 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ARKLRKYIRAYATSAKPFRWTYTDPRKRIRTYEITGTPY* |
| Ga0075021_106964352 | 3300006354 | Watersheds | RKLRRYIRLYAKSAKPFCWTYTDPSRRIRPNKIAGTAY* |
| Ga0066665_102761653 | 3300006796 | Soil | LARKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0075434_1011359062 | 3300006871 | Populus Rhizosphere | ALAGGGKLKLRKYIRAYSKSAQPFRWTYTDPTRRIRPNKIAGTAY* |
| Ga0075434_1016295981 | 3300006871 | Populus Rhizosphere | DLGKKLRKYIRAYSKSARPFRWTYTDAKRRITPNKIAGTAY* |
| Ga0073928_101601354 | 3300006893 | Iron-Sulfur Acid Spring | ARKLRKYIETYAKSAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0073928_104046291 | 3300006893 | Iron-Sulfur Acid Spring | LARKLRKYIETYAKSAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0075435_1011252512 | 3300007076 | Populus Rhizosphere | KYIEAYAKLAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0099827_109868041 | 3300009090 | Vadose Zone Soil | RKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY* |
| Ga0105237_100134391 | 3300009545 | Corn Rhizosphere | KLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY* |
| Ga0105237_126252861 | 3300009545 | Corn Rhizosphere | KIRKYIRAYAKVARPFRWSFSDPTRRIGNPIAGTAH* |
| Ga0116102_10156821 | 3300009632 | Peatland | LRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH* |
| Ga0116117_11498342 | 3300009635 | Peatland | ARKLRKYIEAYAKLAKPFRWTYTDPQKRIRVNEITGTAD* |
| Ga0116118_11407652 | 3300009637 | Peatland | ADLARKLRKYIRAYGKSAKPFRWNYTDAKRRIRPAGNDITGTVH* |
| Ga0116110_10576833 | 3300009643 | Peatland | ARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTSH* |
| Ga0126374_102060613 | 3300009792 | Tropical Forest Soil | ARKLRKYIRAYARSAKPFRWTYTDPMHLIRTYEITGTPH* |
| Ga0126384_108704141 | 3300010046 | Tropical Forest Soil | LRKYIETYAKSAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0126384_116590591 | 3300010046 | Tropical Forest Soil | KLRKYIRAYARFAKPFRWTYTVPKRRIRTYDITGTAH* |
| Ga0126373_110925031 | 3300010048 | Tropical Forest Soil | RKYIRAYTKSAKPFRWTYTDAKRRIRPFGNDITGTVH* |
| Ga0074046_102891622 | 3300010339 | Bog Forest Soil | LARKLRKYIAAYTQSARPFRWTYTDPQKRIRINEITGTAY* |
| Ga0074045_108480851 | 3300010341 | Bog Forest Soil | ARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEMTGTAH* |
| Ga0126370_114874301 | 3300010358 | Tropical Forest Soil | LRKYIEAYAKLAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0126378_101121804 | 3300010361 | Tropical Forest Soil | NKLRKYIRAYSKSAKPFRWTYTDPSRRIIANKIAGTAY* |
| Ga0105239_102282841 | 3300010375 | Corn Rhizosphere | KLRKYIRAYGKSAKPFRWTYTDASRRIQPVGNDITGTAH* |
| Ga0126381_1014089742 | 3300010376 | Tropical Forest Soil | RKLRKYIEAYAKLAKPLRWTYTDPRERIRINEITGTAY* |
| Ga0126381_1035485071 | 3300010376 | Tropical Forest Soil | LRKYIRAYAKSAKPFRWTYTDPKHRIRAYEITETAH* |
| Ga0136449_1011856901 | 3300010379 | Peatlands Soil | RKLRKYIEAYAKLAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0134126_107697631 | 3300010396 | Terrestrial Soil | GRKLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKITGTAY* |
| Ga0126361_102680942 | 3300010876 | Boreal Forest Soil | ARKLRKYIEAYAKLAKPFRWTYTDPQKRIRINEITGTAY* |
| Ga0137388_110638791 | 3300012189 | Vadose Zone Soil | KLRKYIRAYSKSAKPFRWTYTDPTRRIRPNKIAGTAY* |
| Ga0137387_104553081 | 3300012349 | Vadose Zone Soil | KYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY* |
| Ga0137386_111933242 | 3300012351 | Vadose Zone Soil | RKLRKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY* |
| Ga0137390_115357671 | 3300012363 | Vadose Zone Soil | LRKYIAAYARPARPLRWTYTDPRKRIHINEITGTAY* |
| Ga0181518_100184621 | 3300014156 | Bog | RKLRKYIRAYGKSAKPFRWNYTDAKRRIRPAGNDITGTVH* |
| Ga0181518_104105631 | 3300014156 | Bog | KLRKYIRAYGKSAKPFRWNYTDAKRRIRPAGNDITGTVH* |
| Ga0181521_101320853 | 3300014158 | Bog | GNKLRKYIRAYSKSAKPFRWTYTDPSRRIIPNKIAGTSY* |
| Ga0181521_105503861 | 3300014158 | Bog | KYIRAYGKSAKPFRWNYTDAKRRIRPAGNDITGTVH* |
| Ga0181538_101961731 | 3300014162 | Bog | LARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH* |
| Ga0182018_101680042 | 3300014489 | Palsa | ARKLHKYIGAYAKSARPFRWTYTDPQRRIRINEITGTAY* |
| Ga0182015_101062781 | 3300014495 | Palsa | KLHKYIGAYAKSARPFRWTYTDPQRRIRINEITGTAY* |
| Ga0182024_1002393018 | 3300014501 | Permafrost | GNKLRKYIRAYSKSAKPFRWTYTDPTRRIRANKIAGTSY* |
| Ga0182024_110563641 | 3300014501 | Permafrost | KLRKYIGAYAKSARPFRWTYTDPQRRIHINEITGTAY* |
| Ga0182024_111749771 | 3300014501 | Permafrost | KLRKYIRAYSKSAKPFRWTYTDPTRRIRANKIAGTSY* |
| Ga0182024_126908302 | 3300014501 | Permafrost | NKLRKYIRAYSKSAKPFRWTYTDPTRRIRANKIAGTSY* |
| Ga0182021_116483242 | 3300014502 | Fen | KYVRAYAKSARPIRWTYTGAKRRIRTKEAAGTGQ* |
| Ga0182036_100777834 | 3300016270 | Soil | LARKLRKYIQAYAKLAKPFRWTYTDPQKRIRINEINGTAY |
| Ga0182038_106859784 | 3300016445 | Soil | RKYIQAYAKLAKPFRWTYTDPQKRIRINEINGTAY |
| Ga0187802_100468521 | 3300017822 | Freshwater Sediment | LRKYIEAYTKSAKPFRWTYTDPHKRIRINEITGTAY |
| Ga0187802_102246242 | 3300017822 | Freshwater Sediment | RKYIEAYTKSAKPFRWTYTDPHKRIRINEITGTAY |
| Ga0187801_101965331 | 3300017933 | Freshwater Sediment | ARKLRKYIEAYTKSAKPFRWTYTDPHKRIRINEITGTAY |
| Ga0187854_100399234 | 3300017938 | Peatland | ARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH |
| Ga0187850_101487241 | 3300017941 | Peatland | LARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH |
| Ga0187819_103530422 | 3300017943 | Freshwater Sediment | RKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH |
| Ga0187879_100549404 | 3300017946 | Peatland | ARKLRKYIEAYAKLAKPFRWTYTDPQKRIRVNEITGTAD |
| Ga0187805_100129396 | 3300018007 | Freshwater Sediment | GNKLRKYIRAYSKSAKPFRWTYTDTTRRIRSNKIAGTAY |
| Ga0187805_100217841 | 3300018007 | Freshwater Sediment | RKLRKYIEAYTKSAKPFRWTYTDPHKRIRINEITGTAY |
| Ga0187810_100859701 | 3300018012 | Freshwater Sediment | LGNKLRKYIRAYAKSARPFRWTYSDPTRRIRANKIAGTAY |
| Ga0187872_101181263 | 3300018017 | Peatland | KLRKYIEAYAKLAKPFRWTYTDPQKRIRVNEITGTAD |
| Ga0187857_100060731 | 3300018026 | Peatland | RKLRKYIEAYAKLAKPFRWTYTDPQKRIRVNEITGTAD |
| Ga0187863_100254195 | 3300018034 | Peatland | LARKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY |
| Ga0187863_101238693 | 3300018034 | Peatland | ARKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY |
| Ga0210399_103471693 | 3300020581 | Soil | ARKLRKYIDAYGKLAKPFRWTYTDPQKRIRTNEITGTAY |
| Ga0210396_100053111 | 3300021180 | Soil | RKYIEAYARLAKPFRWTYTDPQKRIRINEITGTAY |
| Ga0210384_103830701 | 3300021432 | Soil | LGKKLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY |
| Ga0210402_113390411 | 3300021478 | Soil | LGNKLRKYIRAYSKSARPFRWTYTDATRRIRPNKIAGTAY |
| Ga0126371_100415496 | 3300021560 | Tropical Forest Soil | NKLRKYIRAYSKSAKPFRWTYTDPSRRIIANKIAGTAY |
| Ga0126371_105876513 | 3300021560 | Tropical Forest Soil | KLRKYIRAYTKSAKPFRWTYTDAKRRIRPFGNDITGTVH |
| Ga0126371_112919821 | 3300021560 | Tropical Forest Soil | LGNKLRKYIRAYSKSAKPFRWTYTDPSRRIIANKIAGTAY |
| Ga0228598_10709721 | 3300024227 | Rhizosphere | RKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY |
| Ga0224564_10338572 | 3300024271 | Soil | RKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY |
| Ga0208455_10162831 | 3300025453 | Peatland | LRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH |
| Ga0207654_1000442012 | 3300025911 | Corn Rhizosphere | RRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY |
| Ga0207707_108886312 | 3300025912 | Corn Rhizosphere | DLSRKIRKYIRAYAKVAKPFRWSYSDPSRRIIANPMTGTTY |
| Ga0207671_103889112 | 3300025914 | Corn Rhizosphere | KLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY |
| Ga0207652_116519642 | 3300025921 | Corn Rhizosphere | DLARKLRKYVQSYAKSAKPFRWTYTDPQRRIKVSQ |
| Ga0207681_104807871 | 3300025923 | Switchgrass Rhizosphere | LGNKLRKYIRAYSQSARPFRWTYTDPSRRIIPNKIAGTSY |
| Ga0207659_114935162 | 3300025926 | Miscanthus Rhizosphere | DLGNKLRKYIRAYSQSARPFRWTYTDPSRRIIPNKIAGTSY |
| Ga0207674_100032711 | 3300026116 | Corn Rhizosphere | KLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKITGTAY |
| Ga0209871_10578351 | 3300026217 | Permafrost Soil | LGNKLRKYIRAYSKSAKPFRWTYTDPRRRIRANKIAGTSY |
| Ga0209008_100073313 | 3300027545 | Forest Soil | ARKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAH |
| Ga0209008_10008141 | 3300027545 | Forest Soil | KLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAH |
| Ga0209580_103508852 | 3300027842 | Surface Soil | DLGTKLRKYIRAYSKSAKPFRWTYTDHSRRIRPNKIAGTAY |
| Ga0209590_109474231 | 3300027882 | Vadose Zone Soil | LARKLRKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY |
| Ga0209624_1000264015 | 3300027895 | Forest Soil | LRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTVY |
| Ga0209624_100681551 | 3300027895 | Forest Soil | LRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY |
| Ga0265334_101538871 | 3300028573 | Rhizosphere | LHKYIGAYAKSARPFRWTYTDPQRRIPINEFTGTAY |
| Ga0302228_104983791 | 3300028808 | Palsa | GVFTLVADLRNKVRKYIRAYSKSARPFRWTCTDPSRGIIPNKIAGTFY |
| Ga0311357_107417501 | 3300030524 | Palsa | VADLRNKVRKYIRAYSKSARPFRWTCTDPSRGIIPNKIAGTFY |
| Ga0302325_110714412 | 3300031234 | Palsa | RKLRKYIGANAKSARPFRWTYTDPQRRIRINEITGTAY |
| Ga0318541_102849793 | 3300031545 | Soil | KLRKYIQAYAKLAKPFRWTYTDPQKRIRINEINGTAY |
| Ga0310686_1005236951 | 3300031708 | Soil | KLRRYIRAYEKQARPFRWTYTNPQRRIHTNSITGTGH |
| Ga0307476_105829921 | 3300031715 | Hardwood Forest Soil | DLGNKLRKYIRAYSKSARPFRWTYTDPSRRIIPNKIAGTSY |
| Ga0307516_110207261 | 3300031730 | Ectomycorrhiza | LRKYIRNYSKSAKPFRWTYTDPSRRIVPNKIAGTSY |
| Ga0308176_103474652 | 3300031996 | Soil | IRKYIRAYAKVAKPFRWSYSDPSRRIIANPMTGTAY |
| Ga0306922_1001130214 | 3300032001 | Soil | ARKLRKYIQAYAKLAKPFRWTYTDPQKRIRINEINGTAY |
| Ga0311301_118999252 | 3300032160 | Peatlands Soil | LARKLHKYIGAYAKSARPFRWTYTDPQRRIHINEITGTAY |
| Ga0335082_109096272 | 3300032782 | Soil | DLGNQLRKYIRAYSKSAQPFRWTYTDLTRRIRANKIAGTAY |
| Ga0335081_102709866 | 3300032892 | Soil | LARKLRKYIEAYAKLARPFRWTYTDPQKRIRINEITGTAY |
| ⦗Top⦘ |