Metagenome / Metatranscriptome Family F079090

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F079090
Family Type	Metagenome / Metatranscriptome
Number of Sequences	116
Average Sequence Length	38 residues
Representative Sequence	RKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY
Number of Associated Samples	98
Number of Associated Scaffolds	116

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.87 %
% of genes near scaffold ends (potentially truncated)	98.28 %
% of genes from short scaffolds (< 2000 bps)	73.28 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (74.138 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.483 % of family members)
Environment Ontology (ENVO)	Unclassified (20.690 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.552 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.29
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF13565	HTH_32	7.76
PF00072	Response_reg	1.72
PF01569	PAP2	1.72
PF07238	PilZ	1.72
PF02416	TatA_B_E	0.86
PF00296	Bac_luciferase	0.86
PF00441	Acyl-CoA_dh_1	0.86
PF07244	POTRA	0.86
PF07883	Cupin_2	0.86
PF14100	DUF6807	0.86
PF02518	HATPase_c	0.86
PF00069	Pkinase	0.86
PF13450	NAD_binding_8	0.86
PF02357	NusG	0.86
PF13751	DDE_Tnp_1_6	0.86
PF03352	Adenine_glyco	0.86
PF02321	OEP	0.86
PF13428	TPR_14	0.86
PF08808	RES	0.86
PF07690	MFS_1	0.86
PF04014	MazE_antitoxin	0.86
PF13669	Glyoxalase_4	0.86
PF05960	DUF885	0.86
PF09250	Prim-Pol	0.86
PF04545	Sigma70_r4	0.86
PF08447	PAS_3	0.86
PF00326	Peptidase_S9	0.86
PF00085	Thioredoxin	0.86
PF12833	HTH_18	0.86
PF01039	Carboxyl_trans	0.86
PF02482	Ribosomal_S30AE	0.86
PF04235	DUF418	0.86
PF00702	Hydrolase	0.86
PF13620	CarboxypepD_reg	0.86
PF00106	adh_short	0.86
PF13338	AbiEi_4	0.86
PF06210	DUF1003	0.86
PF00196	GerE	0.86
PF08544	GHMP_kinases_C	0.86
PF00775	Dioxygenase_C	0.86
PF13462	Thioredoxin_4	0.86
PF02384	N6_Mtase	0.86
PF00400	WD40	0.86
PF01019	G_glu_transpept	0.86
PF13103	TonB_2	0.86
PF13545	HTH_Crp_2	0.86
PF12796	Ank_2	0.86
PF00135	COesterase	0.86
PF13668	Ferritin_2	0.86
PF01609	DDE_Tnp_1	0.86
PF00463	ICL	0.86
PF03739	LptF_LptG	0.86
PF01717	Meth_synt_2	0.86
PF01558	POR	0.86
PF04389	Peptidase_M28	0.86
PF12146	Hydrolase_4	0.86
PF00589	Phage_integrase	0.86
PF02780	Transketolase_C	0.86
PF00005	ABC_tran	0.86
PF00180	Iso_dh	0.86
PF01715	IPPT	0.86
PF05726	Pirin_C	0.86
PF00677	Lum_binding	0.86

COG ID	Name	Functional Category	% Frequency in 116 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.45
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	1.72
COG4420	Uncharacterized membrane protein	Function unknown [S]	0.86
COG2272	Carboxylesterase type B	Lipid transport and metabolism [I]	0.86
COG2311	Uncharacterized membrane protein YeiB	Function unknown [S]	0.86
COG2818	3-methyladenine DNA glycosylase Tag	Replication, recombination and repair [L]	0.86
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.86
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.86
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.86
COG3485	Protocatechuate 3,4-dioxygenase beta subunit	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.86
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.86
COG4799	Acetyl-CoA carboxylase, carboxyltransferase component	Lipid transport and metabolism [I]	0.86
COG4805	Uncharacterized conserved protein, DUF885 family	Function unknown [S]	0.86
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.86
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.86
COG5654	Predicted toxin component of a toxin-antitoxin system, contains RES domain	Defense mechanisms [V]	0.86
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.86
COG2224	Isocitrate lyase	Energy production and conversion [C]	0.86
COG0250	Transcription termination/antitermination protein NusG	Transcription [K]	0.86
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.86
COG1826	Twin-arginine protein secretion pathway components TatA and TatB	Intracellular trafficking, secretion, and vesicular transport [U]	0.86
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	0.86
COG1544	Ribosome-associated translation inhibitor RaiA	Translation, ribosomal structure and biogenesis [J]	0.86
COG1014	Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit	Energy production and conversion [C]	0.86
COG0825	Acetyl-CoA carboxylase alpha subunit	Lipid transport and metabolism [I]	0.86
COG0795	Lipopolysaccharide export LptBFGC system, permease protein LptF	Cell wall/membrane/envelope biogenesis [M]	0.86
COG0777	Acetyl-CoA carboxylase beta subunit	Lipid transport and metabolism [I]	0.86
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	0.86
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.86
COG0324	tRNA A37 N6-isopentenylltransferase MiaA	Translation, ribosomal structure and biogenesis [J]	0.86
COG0307	Riboflavin synthase alpha chain	Coenzyme transport and metabolism [H]	0.86

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	74.14 %
Unclassified	root	N/A	25.86 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	74.14 %
Unclassified	root	N/A	25.86 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	74.14 %
Unclassified	root	N/A	25.86 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	31.90 %
Unclassified	root	N/A	25.86 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	8.62 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.86 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	15.52 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	4.31 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.59 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.86 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.86 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.86 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.86 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	11.21 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.31 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	2.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.59 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.86 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.86 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.86 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.86 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	11.21 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.31 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.72 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.86 %
Afifellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Afifellaceae	0.86 %
unclassified Bryobacterales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales	0.86 %
Oscillatoriophycideae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	0.86 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.86 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.86 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.31 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	1.72 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.86 %
Candidatus Sulfotelmatobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter	0.86 %
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	0.86 %
Paludibaculum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum	0.86 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	0.86 %
Afifella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Afifellaceae → Afifella	0.86 %
Oscillatoriophycideae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	0.86 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.86 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.31 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.86 %
Paludibaculum fermentans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	0.86 %
unclassified Afifella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Afifellaceae → Afifella → unclassified Afifella	0.86 %
unclassified Candidatus Sulfopaludibacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter	0.86 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	0.86 %
Paraburkholderia mimosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia mimosarum	0.86 %
Paraburkholderia tuberum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia tuberum	0.86 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.86 %
Oscillatoriophycideae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	0.86 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.86 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4.31 %
Candidatus Sulfopaludibacter sp. SbA6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6	0.86 %
Afifella sp. H1R	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Afifellaceae → Afifella → unclassified Afifella → Afifella sp. H1R	0.86 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.86 %
Paludibaculum fermentans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	0.86 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	0.86 %
Paraburkholderia mimosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia mimosarum	0.86 %
Paraburkholderia tuberum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia tuberum	0.86 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.86 %
Oscillatoriophycideae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	0.86 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.86 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.86 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090015\|GPICI_9032169	All Organisms → cellular organisms → Bacteria	2421	Open in IMG/M
2170459013\|GO6OHWN01DS4R0	Not Available	526	Open in IMG/M
2228664021\|ICCgaii200_c0931700	Not Available	1343	Open in IMG/M
3300001546\|JGI12659J15293_10007979	All Organisms → cellular organisms → Bacteria	3029	Open in IMG/M
3300004800\|Ga0058861_11637269	All Organisms → cellular organisms → Bacteria → Proteobacteria	725	Open in IMG/M
3300005329\|Ga0070683_100003793	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	12343	Open in IMG/M
3300005337\|Ga0070682_100265593	All Organisms → cellular organisms → Bacteria	1244	Open in IMG/M
3300005447\|Ga0066689_10044487	All Organisms → cellular organisms → Bacteria	2351	Open in IMG/M
3300005533\|Ga0070734_10381301	All Organisms → cellular organisms → Bacteria	804	Open in IMG/M
3300005563\|Ga0068855_100116559	All Organisms → cellular organisms → Bacteria	3061	Open in IMG/M
3300005577\|Ga0068857_100270527	All Organisms → cellular organisms → Bacteria → Proteobacteria	1561	Open in IMG/M
3300005586\|Ga0066691_10241498	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1059	Open in IMG/M
3300005598\|Ga0066706_10103444	All Organisms → cellular organisms → Bacteria	2071	Open in IMG/M
3300005598\|Ga0066706_11521640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia tuberum	503	Open in IMG/M
3300005764\|Ga0066903_109034345	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300005994\|Ga0066789_10100334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1243	Open in IMG/M
3300006028\|Ga0070717_11394454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia mimosarum	636	Open in IMG/M
3300006173\|Ga0070716_101112488	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	630	Open in IMG/M
3300006175\|Ga0070712_100045024	All Organisms → cellular organisms → Bacteria	3045	Open in IMG/M
3300006354\|Ga0075021_10696435	Not Available	652	Open in IMG/M
3300006796\|Ga0066665_10276165	All Organisms → cellular organisms → Bacteria	1340	Open in IMG/M
3300006871\|Ga0075434_101135906	All Organisms → cellular organisms → Bacteria	794	Open in IMG/M
3300006871\|Ga0075434_101629598	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300006893\|Ga0073928_10160135	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1805	Open in IMG/M
3300006893\|Ga0073928_10404629	All Organisms → cellular organisms → Bacteria	998	Open in IMG/M
3300007076\|Ga0075435_101125251	All Organisms → cellular organisms → Bacteria → Proteobacteria	686	Open in IMG/M
3300009090\|Ga0099827_10986804	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	730	Open in IMG/M
3300009545\|Ga0105237_10013439	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	8586	Open in IMG/M
3300009545\|Ga0105237_12625286	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6	514	Open in IMG/M
3300009632\|Ga0116102_1015682	All Organisms → cellular organisms → Bacteria → Proteobacteria	2692	Open in IMG/M
3300009635\|Ga0116117_1149834	Not Available	600	Open in IMG/M
3300009637\|Ga0116118_1140765	All Organisms → cellular organisms → Bacteria	785	Open in IMG/M
3300009643\|Ga0116110_1057683	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1381	Open in IMG/M
3300009792\|Ga0126374_10206061	Not Available	1249	Open in IMG/M
3300010046\|Ga0126384_10870414	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	812	Open in IMG/M
3300010046\|Ga0126384_11659059	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300010048\|Ga0126373_11092503	All Organisms → cellular organisms → Bacteria → Acidobacteria	864	Open in IMG/M
3300010339\|Ga0074046_10289162	All Organisms → cellular organisms → Bacteria → Acidobacteria	1009	Open in IMG/M
3300010341\|Ga0074045_10848085	Not Available	577	Open in IMG/M
3300010358\|Ga0126370_11487430	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	643	Open in IMG/M
3300010361\|Ga0126378_10112180	All Organisms → cellular organisms → Bacteria	2714	Open in IMG/M
3300010375\|Ga0105239_10228284	Not Available	2089	Open in IMG/M
3300010376\|Ga0126381_101408974	Not Available	1007	Open in IMG/M
3300010376\|Ga0126381_103548507	Not Available	612	Open in IMG/M
3300010379\|Ga0136449_101185690	All Organisms → cellular organisms → Bacteria → Acidobacteria	1204	Open in IMG/M
3300010396\|Ga0134126_10769763	All Organisms → cellular organisms → Bacteria → Proteobacteria	1090	Open in IMG/M
3300010876\|Ga0126361_10268094	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300012189\|Ga0137388_11063879	Not Available	745	Open in IMG/M
3300012349\|Ga0137387_10455308	All Organisms → cellular organisms → Bacteria → Acidobacteria	928	Open in IMG/M
3300012351\|Ga0137386_11193324	Not Available	533	Open in IMG/M
3300012363\|Ga0137390_11535767	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	605	Open in IMG/M
3300014156\|Ga0181518_10018462	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	4902	Open in IMG/M
3300014156\|Ga0181518_10410563	Not Available	653	Open in IMG/M
3300014158\|Ga0181521_10132085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Afifellaceae → Afifella → unclassified Afifella → Afifella sp. H1R	1467	Open in IMG/M
3300014158\|Ga0181521_10550386	Not Available	546	Open in IMG/M
3300014162\|Ga0181538_10196173	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1135	Open in IMG/M
3300014489\|Ga0182018_10168004	Not Available	1244	Open in IMG/M
3300014495\|Ga0182015_10106278	All Organisms → cellular organisms → Bacteria → Acidobacteria	1943	Open in IMG/M
3300014501\|Ga0182024_10023930	All Organisms → cellular organisms → Bacteria	10896	Open in IMG/M
3300014501\|Ga0182024_11056364	All Organisms → cellular organisms → Bacteria	963	Open in IMG/M
3300014501\|Ga0182024_11174977	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	900	Open in IMG/M
3300014501\|Ga0182024_12690830	Not Available	532	Open in IMG/M
3300014502\|Ga0182021_11648324	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300016270\|Ga0182036_10077783	Not Available	2185	Open in IMG/M
3300016445\|Ga0182038_10685978	All Organisms → cellular organisms → Bacteria	891	Open in IMG/M
3300017822\|Ga0187802_10046852	All Organisms → cellular organisms → Bacteria	1573	Open in IMG/M
3300017822\|Ga0187802_10224624	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	724	Open in IMG/M
3300017933\|Ga0187801_10196533	Not Available	798	Open in IMG/M
3300017938\|Ga0187854_10039923	Not Available	2408	Open in IMG/M
3300017941\|Ga0187850_10148724	Not Available	1100	Open in IMG/M
3300017943\|Ga0187819_10353042	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	849	Open in IMG/M
3300017946\|Ga0187879_10054940	All Organisms → cellular organisms → Bacteria → Acidobacteria	2338	Open in IMG/M
3300018007\|Ga0187805_10012939	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3544	Open in IMG/M
3300018007\|Ga0187805_10021784	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2799	Open in IMG/M
3300018012\|Ga0187810_10085970	All Organisms → cellular organisms → Bacteria	1223	Open in IMG/M
3300018017\|Ga0187872_10118126	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1305	Open in IMG/M
3300018026\|Ga0187857_10006073	All Organisms → cellular organisms → Bacteria → Acidobacteria	8402	Open in IMG/M
3300018034\|Ga0187863_10025419	All Organisms → cellular organisms → Bacteria	3559	Open in IMG/M
3300018034\|Ga0187863_10123869	Not Available	1445	Open in IMG/M
3300020581\|Ga0210399_10347169	All Organisms → cellular organisms → Bacteria	1239	Open in IMG/M
3300021180\|Ga0210396_10005311	All Organisms → cellular organisms → Bacteria → Proteobacteria	12492	Open in IMG/M
3300021432\|Ga0210384_10383070	All Organisms → cellular organisms → Bacteria	1266	Open in IMG/M
3300021478\|Ga0210402_11339041	All Organisms → cellular organisms → Bacteria → Acidobacteria	643	Open in IMG/M
3300021560\|Ga0126371_10041549	All Organisms → cellular organisms → Bacteria → Acidobacteria	4358	Open in IMG/M
3300021560\|Ga0126371_10587651	All Organisms → cellular organisms → Bacteria → Acidobacteria	1262	Open in IMG/M
3300021560\|Ga0126371_11291982	Not Available	863	Open in IMG/M
3300024227\|Ga0228598_1070972	All Organisms → cellular organisms → Bacteria → Acidobacteria	696	Open in IMG/M
3300024271\|Ga0224564_1033857	Not Available	966	Open in IMG/M
3300025453\|Ga0208455_1016283	All Organisms → cellular organisms → Bacteria	1818	Open in IMG/M
3300025911\|Ga0207654_10004420	All Organisms → cellular organisms → Bacteria → Acidobacteria	7092	Open in IMG/M
3300025912\|Ga0207707_10888631	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	737	Open in IMG/M
3300025914\|Ga0207671_10388911	All Organisms → cellular organisms → Bacteria	1108	Open in IMG/M
3300025923\|Ga0207681_10480787	All Organisms → cellular organisms → Bacteria	1014	Open in IMG/M
3300025926\|Ga0207659_11493516	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	578	Open in IMG/M
3300026116\|Ga0207674_10003271	All Organisms → cellular organisms → Bacteria → Acidobacteria	19934	Open in IMG/M
3300026217\|Ga0209871_1057835	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300027545\|Ga0209008_1000733	All Organisms → cellular organisms → Bacteria	9263	Open in IMG/M
3300027545\|Ga0209008_1000814	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	8668	Open in IMG/M
3300027842\|Ga0209580_10350885	Not Available	735	Open in IMG/M
3300027882\|Ga0209590_10947423	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	540	Open in IMG/M
3300027895\|Ga0209624_10002640	All Organisms → cellular organisms → Bacteria	13144	Open in IMG/M
3300027895\|Ga0209624_10068155	Not Available	2294	Open in IMG/M
3300028573\|Ga0265334_10153887	Not Available	810	Open in IMG/M
3300028808\|Ga0302228_10498379	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300030524\|Ga0311357_10741750	All Organisms → cellular organisms → Bacteria	888	Open in IMG/M
3300031234\|Ga0302325_11071441	Not Available	1090	Open in IMG/M
3300031545\|Ga0318541_10284979	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	920	Open in IMG/M
3300031708\|Ga0310686_100523695	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	561	Open in IMG/M
3300031715\|Ga0307476_10582992	All Organisms → cellular organisms → Bacteria → Acidobacteria	829	Open in IMG/M
3300031730\|Ga0307516_11020726	Not Available	501	Open in IMG/M
3300031996\|Ga0308176_10347465	All Organisms → cellular organisms → Bacteria	1462	Open in IMG/M
3300032001\|Ga0306922_10011302	All Organisms → cellular organisms → Bacteria	8742	Open in IMG/M
3300032160\|Ga0311301_11899925	Not Available	702	Open in IMG/M
3300032782\|Ga0335082_10909627	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	743	Open in IMG/M
3300032892\|Ga0335081_10270986	Not Available	2273	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	85.34%
Host-Associated	Host-Associated	14.66%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	62.07%
Aquatic	Environmental → Aquatic	23.28%
Plants	Host-Associated → Plants	13.79%
Human	Host-Associated → Human	0.86%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.48%
Freshwater	Environmental → Aquatic → Freshwater	20.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere	10.34%
Peat	Environmental → Terrestrial → Peat	2.59%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.59%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.72%
Sediment	Environmental → Aquatic → Sediment	0.86%
Digestive System	Host-Associated → Human → Digestive System	0.86%
Roots	Host-Associated → Plants → Roots	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.07%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	20.69%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.21%
Loam	Environmental → Terrestrial → Soil → Loam	11.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.76%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.59%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.59%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.86%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.86%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.55%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	10.34%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.76%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	7.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.76%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.90%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	6.03%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.03%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.17%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	4.31%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.45%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.59%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.86%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.86%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.86%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.86%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.48%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	6.03%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	6.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.03%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.17%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	4.31%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	4.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.31%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.31%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.31%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	3.45%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.59%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.59%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.59%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.59%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.59%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.72%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.72%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.72%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.72%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	1.72%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	1.72%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.86%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.86%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.86%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.86%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.86%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.86%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.86%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.86%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.86%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.86%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.86%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090015	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
2170459013	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm	Environmental	Open in IMG/M
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300001546	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1	Environmental	Open in IMG/M
3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005994	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009632	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40	Environmental	Open in IMG/M
3300009635	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10	Environmental	Open in IMG/M
3300009637	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40	Environmental	Open in IMG/M
3300009643	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010876	Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300014156	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG	Environmental	Open in IMG/M
3300014158	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG	Environmental	Open in IMG/M
3300014162	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG	Environmental	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental	Open in IMG/M
3300017933	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1	Environmental	Open in IMG/M
3300017938	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150	Environmental	Open in IMG/M
3300017941	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017946	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10	Environmental	Open in IMG/M
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental	Open in IMG/M
3300018012	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5	Environmental	Open in IMG/M
3300018017	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40	Environmental	Open in IMG/M
3300018026	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100	Environmental	Open in IMG/M
3300018034	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Host-Associated	Open in IMG/M
3300024271	Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5	Environmental	Open in IMG/M
3300025453	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026217	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)	Environmental	Open in IMG/M
3300027545	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Host-Associated	Open in IMG/M
3300028808	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2	Environmental	Open in IMG/M
3300030524	II_Palsa_N3 coassembly	Environmental	Open in IMG/M
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPICI_00514270	2088090015	Soil	VADLSRKIRKYIRAYAKVAKPFRWSYSDPSRRIIANPMTGT
N57_07097640	2170459013	Grass Soil	RKIRNYIRAYIKVAKPFRWSYSDPRRRIIANPITGTAY
ICCgaii200_09317001	2228664021	Soil	RKYIRAHAKIAKPFRWSYSDPSRRIIANPMTGTTY
JGI12659J15293_100079791	3300001546	Forest Soil	RKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY*
Ga0058861_116372692	3300004800	Host-Associated	VADLSRKIRKYIRVYAKVAKPFRWSYSGPSRRIIANPMTGT
Ga0070683_1000037931	3300005329	Corn Rhizosphere	GRKLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY*
Ga0070682_1002655932	3300005337	Corn Rhizosphere	VADLSRKIRKYIRAHAKIAKPFRWSYSDPSRRIIANPMTGNTY*
Ga0066689_100444871	3300005447	Soil	ARKLRKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY*
Ga0070734_103813013	3300005533	Surface Soil	DLGNKLRKYIRAYSKSAKPFRWTYLTPLAESANTMAGTAY*
Ga0068855_1001165591	3300005563	Corn Rhizosphere	RKLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY*
Ga0068857_1002705271	3300005577	Corn Rhizosphere	LRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY*
Ga0066691_102414981	3300005586	Soil	KLRKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY*
Ga0066706_101034445	3300005598	Soil	RKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY*
Ga0066706_115216401	3300005598	Soil	KYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY*
Ga0066903_1090343451	3300005764	Tropical Forest Soil	GNKLRKYIRAYSKSAKPFRWTYTDPSRRIIANKIAGTAY*
Ga0066789_101003342	3300005994	Soil	LRKYIRAYSKSAKPFRWTYTDPTRRIRANKIAGTSY*
Ga0070717_113944541	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	NKLRRYIRAYSKSAKPFRWTYTDPTRRIHANRITGTAY*
Ga0070716_1011124882	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	RKYIRAYATSAKPFRWTYTDPRKRIRTYEITGTPY*
Ga0070712_1000450241	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	ARKLRKYIRAYATSAKPFRWTYTDPRKRIRTYEITGTPY*
Ga0075021_106964352	3300006354	Watersheds	RKLRRYIRLYAKSAKPFCWTYTDPSRRIRPNKIAGTAY*
Ga0066665_102761653	3300006796	Soil	LARKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY*
Ga0075434_1011359062	3300006871	Populus Rhizosphere	ALAGGGKLKLRKYIRAYSKSAQPFRWTYTDPTRRIRPNKIAGTAY*
Ga0075434_1016295981	3300006871	Populus Rhizosphere	DLGKKLRKYIRAYSKSARPFRWTYTDAKRRITPNKIAGTAY*
Ga0073928_101601354	3300006893	Iron-Sulfur Acid Spring	ARKLRKYIETYAKSAKPFRWTYTDPQKRIRINEITGTAY*
Ga0073928_104046291	3300006893	Iron-Sulfur Acid Spring	LARKLRKYIETYAKSAKPFRWTYTDPQKRIRINEITGTAY*
Ga0075435_1011252512	3300007076	Populus Rhizosphere	KYIEAYAKLAKPFRWTYTDPQKRIRINEITGTAY*
Ga0099827_109868041	3300009090	Vadose Zone Soil	RKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY*
Ga0105237_100134391	3300009545	Corn Rhizosphere	KLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY*
Ga0105237_126252861	3300009545	Corn Rhizosphere	KIRKYIRAYAKVARPFRWSFSDPTRRIGNPIAGTAH*
Ga0116102_10156821	3300009632	Peatland	LRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH*
Ga0116117_11498342	3300009635	Peatland	ARKLRKYIEAYAKLAKPFRWTYTDPQKRIRVNEITGTAD*
Ga0116118_11407652	3300009637	Peatland	ADLARKLRKYIRAYGKSAKPFRWNYTDAKRRIRPAGNDITGTVH*
Ga0116110_10576833	3300009643	Peatland	ARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTSH*
Ga0126374_102060613	3300009792	Tropical Forest Soil	ARKLRKYIRAYARSAKPFRWTYTDPMHLIRTYEITGTPH*
Ga0126384_108704141	3300010046	Tropical Forest Soil	LRKYIETYAKSAKPFRWTYTDPQKRIRINEITGTAY*
Ga0126384_116590591	3300010046	Tropical Forest Soil	KLRKYIRAYARFAKPFRWTYTVPKRRIRTYDITGTAH*
Ga0126373_110925031	3300010048	Tropical Forest Soil	RKYIRAYTKSAKPFRWTYTDAKRRIRPFGNDITGTVH*
Ga0074046_102891622	3300010339	Bog Forest Soil	LARKLRKYIAAYTQSARPFRWTYTDPQKRIRINEITGTAY*
Ga0074045_108480851	3300010341	Bog Forest Soil	ARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEMTGTAH*
Ga0126370_114874301	3300010358	Tropical Forest Soil	LRKYIEAYAKLAKPFRWTYTDPQKRIRINEITGTAY*
Ga0126378_101121804	3300010361	Tropical Forest Soil	NKLRKYIRAYSKSAKPFRWTYTDPSRRIIANKIAGTAY*
Ga0105239_102282841	3300010375	Corn Rhizosphere	KLRKYIRAYGKSAKPFRWTYTDASRRIQPVGNDITGTAH*
Ga0126381_1014089742	3300010376	Tropical Forest Soil	RKLRKYIEAYAKLAKPLRWTYTDPRERIRINEITGTAY*
Ga0126381_1035485071	3300010376	Tropical Forest Soil	LRKYIRAYAKSAKPFRWTYTDPKHRIRAYEITETAH*
Ga0136449_1011856901	3300010379	Peatlands Soil	RKLRKYIEAYAKLAKPFRWTYTDPQKRIRINEITGTAY*
Ga0134126_107697631	3300010396	Terrestrial Soil	GRKLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKITGTAY*
Ga0126361_102680942	3300010876	Boreal Forest Soil	ARKLRKYIEAYAKLAKPFRWTYTDPQKRIRINEITGTAY*
Ga0137388_110638791	3300012189	Vadose Zone Soil	KLRKYIRAYSKSAKPFRWTYTDPTRRIRPNKIAGTAY*
Ga0137387_104553081	3300012349	Vadose Zone Soil	KYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY*
Ga0137386_111933242	3300012351	Vadose Zone Soil	RKLRKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY*
Ga0137390_115357671	3300012363	Vadose Zone Soil	LRKYIAAYARPARPLRWTYTDPRKRIHINEITGTAY*
Ga0181518_100184621	3300014156	Bog	RKLRKYIRAYGKSAKPFRWNYTDAKRRIRPAGNDITGTVH*
Ga0181518_104105631	3300014156	Bog	KLRKYIRAYGKSAKPFRWNYTDAKRRIRPAGNDITGTVH*
Ga0181521_101320853	3300014158	Bog	GNKLRKYIRAYSKSAKPFRWTYTDPSRRIIPNKIAGTSY*
Ga0181521_105503861	3300014158	Bog	KYIRAYGKSAKPFRWNYTDAKRRIRPAGNDITGTVH*
Ga0181538_101961731	3300014162	Bog	LARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH*
Ga0182018_101680042	3300014489	Palsa	ARKLHKYIGAYAKSARPFRWTYTDPQRRIRINEITGTAY*
Ga0182015_101062781	3300014495	Palsa	KLHKYIGAYAKSARPFRWTYTDPQRRIRINEITGTAY*
Ga0182024_1002393018	3300014501	Permafrost	GNKLRKYIRAYSKSAKPFRWTYTDPTRRIRANKIAGTSY*
Ga0182024_110563641	3300014501	Permafrost	KLRKYIGAYAKSARPFRWTYTDPQRRIHINEITGTAY*
Ga0182024_111749771	3300014501	Permafrost	KLRKYIRAYSKSAKPFRWTYTDPTRRIRANKIAGTSY*
Ga0182024_126908302	3300014501	Permafrost	NKLRKYIRAYSKSAKPFRWTYTDPTRRIRANKIAGTSY*
Ga0182021_116483242	3300014502	Fen	KYVRAYAKSARPIRWTYTGAKRRIRTKEAAGTGQ*
Ga0182036_100777834	3300016270	Soil	LARKLRKYIQAYAKLAKPFRWTYTDPQKRIRINEINGTAY
Ga0182038_106859784	3300016445	Soil	RKYIQAYAKLAKPFRWTYTDPQKRIRINEINGTAY
Ga0187802_100468521	3300017822	Freshwater Sediment	LRKYIEAYTKSAKPFRWTYTDPHKRIRINEITGTAY
Ga0187802_102246242	3300017822	Freshwater Sediment	RKYIEAYTKSAKPFRWTYTDPHKRIRINEITGTAY
Ga0187801_101965331	3300017933	Freshwater Sediment	ARKLRKYIEAYTKSAKPFRWTYTDPHKRIRINEITGTAY
Ga0187854_100399234	3300017938	Peatland	ARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH
Ga0187850_101487241	3300017941	Peatland	LARKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH
Ga0187819_103530422	3300017943	Freshwater Sediment	RKLRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH
Ga0187879_100549404	3300017946	Peatland	ARKLRKYIEAYAKLAKPFRWTYTDPQKRIRVNEITGTAD
Ga0187805_100129396	3300018007	Freshwater Sediment	GNKLRKYIRAYSKSAKPFRWTYTDTTRRIRSNKIAGTAY
Ga0187805_100217841	3300018007	Freshwater Sediment	RKLRKYIEAYTKSAKPFRWTYTDPHKRIRINEITGTAY
Ga0187810_100859701	3300018012	Freshwater Sediment	LGNKLRKYIRAYAKSARPFRWTYSDPTRRIRANKIAGTAY
Ga0187872_101181263	3300018017	Peatland	KLRKYIEAYAKLAKPFRWTYTDPQKRIRVNEITGTAD
Ga0187857_100060731	3300018026	Peatland	RKLRKYIEAYAKLAKPFRWTYTDPQKRIRVNEITGTAD
Ga0187863_100254195	3300018034	Peatland	LARKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY
Ga0187863_101238693	3300018034	Peatland	ARKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY
Ga0210399_103471693	3300020581	Soil	ARKLRKYIDAYGKLAKPFRWTYTDPQKRIRTNEITGTAY
Ga0210396_100053111	3300021180	Soil	RKYIEAYARLAKPFRWTYTDPQKRIRINEITGTAY
Ga0210384_103830701	3300021432	Soil	LGKKLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY
Ga0210402_113390411	3300021478	Soil	LGNKLRKYIRAYSKSARPFRWTYTDATRRIRPNKIAGTAY
Ga0126371_100415496	3300021560	Tropical Forest Soil	NKLRKYIRAYSKSAKPFRWTYTDPSRRIIANKIAGTAY
Ga0126371_105876513	3300021560	Tropical Forest Soil	KLRKYIRAYTKSAKPFRWTYTDAKRRIRPFGNDITGTVH
Ga0126371_112919821	3300021560	Tropical Forest Soil	LGNKLRKYIRAYSKSAKPFRWTYTDPSRRIIANKIAGTAY
Ga0228598_10709721	3300024227	Rhizosphere	RKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY
Ga0224564_10338572	3300024271	Soil	RKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY
Ga0208455_10162831	3300025453	Peatland	LRKYIRAYAKSARPFRWTYTDPRRRIRTYEITGTAH
Ga0207654_1000442012	3300025911	Corn Rhizosphere	RRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY
Ga0207707_108886312	3300025912	Corn Rhizosphere	DLSRKIRKYIRAYAKVAKPFRWSYSDPSRRIIANPMTGTTY
Ga0207671_103889112	3300025914	Corn Rhizosphere	KLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKIAGTAY
Ga0207652_116519642	3300025921	Corn Rhizosphere	DLARKLRKYVQSYAKSAKPFRWTYTDPQRRIKVSQ
Ga0207681_104807871	3300025923	Switchgrass Rhizosphere	LGNKLRKYIRAYSQSARPFRWTYTDPSRRIIPNKIAGTSY
Ga0207659_114935162	3300025926	Miscanthus Rhizosphere	DLGNKLRKYIRAYSQSARPFRWTYTDPSRRIIPNKIAGTSY
Ga0207674_100032711	3300026116	Corn Rhizosphere	KLRRYIRLYSKSAKPFCWTYTDPTRRIRPNKITGTAY
Ga0209871_10578351	3300026217	Permafrost Soil	LGNKLRKYIRAYSKSAKPFRWTYTDPRRRIRANKIAGTSY
Ga0209008_100073313	3300027545	Forest Soil	ARKLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAH
Ga0209008_10008141	3300027545	Forest Soil	KLRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAH
Ga0209580_103508852	3300027842	Surface Soil	DLGTKLRKYIRAYSKSAKPFRWTYTDHSRRIRPNKIAGTAY
Ga0209590_109474231	3300027882	Vadose Zone Soil	LARKLRKYIRAYAQAARPFRWTYTDPRRRIRTYEITGTAY
Ga0209624_1000264015	3300027895	Forest Soil	LRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTVY
Ga0209624_100681551	3300027895	Forest Soil	LRKYIEAYAKSAKPFRWTYTDPQKRIRINEITGTAY
Ga0265334_101538871	3300028573	Rhizosphere	LHKYIGAYAKSARPFRWTYTDPQRRIPINEFTGTAY
Ga0302228_104983791	3300028808	Palsa	GVFTLVADLRNKVRKYIRAYSKSARPFRWTCTDPSRGIIPNKIAGTFY
Ga0311357_107417501	3300030524	Palsa	VADLRNKVRKYIRAYSKSARPFRWTCTDPSRGIIPNKIAGTFY
Ga0302325_110714412	3300031234	Palsa	RKLRKYIGANAKSARPFRWTYTDPQRRIRINEITGTAY
Ga0318541_102849793	3300031545	Soil	KLRKYIQAYAKLAKPFRWTYTDPQKRIRINEINGTAY
Ga0310686_1005236951	3300031708	Soil	KLRRYIRAYEKQARPFRWTYTNPQRRIHTNSITGTGH
Ga0307476_105829921	3300031715	Hardwood Forest Soil	DLGNKLRKYIRAYSKSARPFRWTYTDPSRRIIPNKIAGTSY
Ga0307516_110207261	3300031730	Ectomycorrhiza	LRKYIRNYSKSAKPFRWTYTDPSRRIVPNKIAGTSY
Ga0308176_103474652	3300031996	Soil	IRKYIRAYAKVAKPFRWSYSDPSRRIIANPMTGTAY
Ga0306922_1001130214	3300032001	Soil	ARKLRKYIQAYAKLAKPFRWTYTDPQKRIRINEINGTAY
Ga0311301_118999252	3300032160	Peatlands Soil	LARKLHKYIGAYAKSARPFRWTYTDPQRRIHINEITGTAY
Ga0335082_109096272	3300032782	Soil	DLGNQLRKYIRAYSKSAQPFRWTYTDLTRRIRANKIAGTAY
Ga0335081_102709866	3300032892	Soil	LARKLRKYIEAYAKLARPFRWTYTDPQKRIRINEITGTAY

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F079090

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences