| Basic Information | |
|---|---|
| Family ID | F079075 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MLRSTLLKLSESKGFANWVTSNGTTRRMARRFVAGETLDE |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 18.97 % |
| % of genes near scaffold ends (potentially truncated) | 97.41 % |
| % of genes from short scaffolds (< 2000 bps) | 89.66 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.655 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.552 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.172 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.414 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 83.62 |
| PF12867 | DinB_2 | 5.17 |
| PF00070 | Pyr_redox | 2.59 |
| PF13738 | Pyr_redox_3 | 1.72 |
| PF00160 | Pro_isomerase | 1.72 |
| PF11716 | MDMPI_N | 0.86 |
| PF01555 | N6_N4_Mtase | 0.86 |
| PF01596 | Methyltransf_3 | 0.86 |
| PF06155 | GBBH-like_N | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 1.72 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.86 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.86 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.86 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.66 % |
| All Organisms | root | All Organisms | 35.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030962 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26340J50214_101178521 | 3300003368 | Bog Forest Soil | MLRATLLKLSESQRFAKWVTSNGTTRRMARRFVAGETLDEAIE |
| Ga0062384_1002280492 | 3300004082 | Bog Forest Soil | MLRATLLKLSESKGFANWVVSNSSTKRMAHRFVAGETLDEAVAA |
| Ga0066823_100526011 | 3300005163 | Soil | MVRSTLLKLSESKKFANWVTMNATTRRMSHRFVAGEELDEA |
| Ga0070711_1003260712 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRSTLLKLSESKSFARWVTTNRTTRKMSHRFVAGEALEE |
| Ga0070706_1018829921 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRSTLLKLSESKKFARWVTSNQTTRKMSHRFVAGEALEEAI |
| Ga0070697_1011003872 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRAILLKLSESPGFAHWVTSNPTTRRMARRFVAGETLDE |
| Ga0066661_106882612 | 3300005554 | Soil | MVRATLLKLSVSPGFAHWVTSNPSTRRMARRFVAGETLDE |
| Ga0066670_100180166 | 3300005560 | Soil | MLRSALLKLSANKKFGAWVTSNPAPRRMARRFVAGET |
| Ga0070763_103013011 | 3300005610 | Soil | MLRSILLKFSESESFAHWVTTNATTRRMSHRFVAGETLEEA |
| Ga0075030_1000524506 | 3300006162 | Watersheds | MIRSTLLKLSESKGFANWVISNGTTRRMARRFVAGET |
| Ga0070716_1015209642 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRAGLLKLSESKSLAHWVVSNGRTRRMAHRFVPGETLD |
| Ga0079221_108690522 | 3300006804 | Agricultural Soil | MLRATLLKLSANEKFANWVTSNPTTRRMSRRFVAGETLD |
| Ga0099793_106432762 | 3300007258 | Vadose Zone Soil | MLRATLLKLSESARFAHWVTSNSTTHRMAQRFVPG |
| Ga0099794_106132071 | 3300007265 | Vadose Zone Soil | MLRSILLKLSESPSFSHWVTSNATTRRMARRFVAGETL |
| Ga0099830_112226352 | 3300009088 | Vadose Zone Soil | MLRSTLLKLSENTRFAHWVTSNPTTHRMARRFVAGETLEETI |
| Ga0099828_111019021 | 3300009089 | Vadose Zone Soil | MLRAILLKFAESPGFAHWVTSNEITRRMALRFVAGEALDEAI |
| Ga0099827_115042952 | 3300009090 | Vadose Zone Soil | MLRATLLKLSESKRLAHWVTSNSPTRRMSHRFVAGE |
| Ga0105242_108205992 | 3300009176 | Miscanthus Rhizosphere | MLRSTLLKLSESKGFAHWVTSNRTTRRMSHRFVAGEALDE |
| Ga0116214_12976461 | 3300009520 | Peatlands Soil | MIRSTLLKLSESKGFANWVTTNGTTRRMARRFVAG |
| Ga0116225_12806102 | 3300009524 | Peatlands Soil | MLRAILLKLSESKAIAHWVTSNSKTRRMALRFVAG |
| Ga0126380_109900931 | 3300010043 | Tropical Forest Soil | MLRSILLKLSESKGFAHWVTNNAMARRMSHRFVAGETLEE |
| Ga0126381_1025706292 | 3300010376 | Tropical Forest Soil | MLRSILLKLSESNGFAHWVTTNPSMRRMSHRFVAGETL |
| Ga0126360_10753552 | 3300010854 | Boreal Forest Soil | MVRSILLRLSESKGFANWVTTNSTTRRMSHRFVAGETLDEAL |
| Ga0150983_111458822 | 3300011120 | Forest Soil | MLRATLLRLSESARFAHWVTSNSTTRRMAHRFVPGETLDDAIAAA |
| Ga0150983_121540952 | 3300011120 | Forest Soil | MVRSTLLKLSESKSFANWVTSNGTTRRMARRFVAGE |
| Ga0137393_101007915 | 3300011271 | Vadose Zone Soil | LPRETLLVIRALLLKLSNSRRMARWVTSNGVSRRMARRFVAGEELD |
| Ga0137361_105441661 | 3300012362 | Vadose Zone Soil | MLRSTLLKLSESKGFANWVTSNGTTRRMARRFVAGETLD |
| Ga0137413_114773812 | 3300012924 | Vadose Zone Soil | MLRSTLLKLSENKGFADWVTTNGTTRRMARRFVAGETLDEA |
| Ga0137416_114727732 | 3300012927 | Vadose Zone Soil | MLRSSLLKLSENKGFANWVTTNGTTRRMARRFVAGETLDE |
| Ga0137416_115151901 | 3300012927 | Vadose Zone Soil | MLRAILLKLSESPGFAHWVTSNSTTRRMARRFVAGETLDEAIIAA |
| Ga0137410_112272422 | 3300012944 | Vadose Zone Soil | MLRSILLKFSESKSFARWVTTNATTRRMSHRFVAGETL |
| Ga0181533_11649361 | 3300014152 | Bog | MLRSILLKLSDSKGLAHWVTSNATTRRMSHRFVAGES |
| Ga0134078_105335292 | 3300014157 | Grasslands Soil | MLSENEKFGSWVISNGTTRRMARRFVAGETLEEAIAAARRCHEV |
| Ga0137405_10100991 | 3300015053 | Vadose Zone Soil | MLRSILLKLSESPGFARWVISNSSTRRMSRRFVAGETLDE |
| Ga0137405_10424742 | 3300015053 | Vadose Zone Soil | MLRSTLLKLSESKSFANWVTSNGTTRRMARRFVAGETLD |
| Ga0137420_10939191 | 3300015054 | Vadose Zone Soil | MLRSTLLKLSESKAFANWVTSNGTTRRMAGRFVAGETLDEA |
| Ga0137420_11434401 | 3300015054 | Vadose Zone Soil | MLRSILLKFSESKSFAHWVTTNATTRRMSHRFVAGESPAKLSKKR |
| Ga0182041_100326701 | 3300016294 | Soil | MIRSTLLHLSESKGFAHWVTSNGTTRRMSHRFVAGET |
| Ga0187808_104748211 | 3300017942 | Freshwater Sediment | MLRSILLKLSQSPRLARFVIHNATSRRMARRFVAG |
| Ga0187783_108141041 | 3300017970 | Tropical Peatland | MLRATLLKLSDSKGFAHWVTSNDATRRMSHRFVAGETLDEAIEASR |
| Ga0187822_103257212 | 3300017994 | Freshwater Sediment | MLRSTLLKLSDSKGFAHWVTSNGTTRRMSHRFVAGETLDEAIE |
| Ga0187810_101230281 | 3300018012 | Freshwater Sediment | MLRATLLKLSDSKGLAHWVTTNGTTRQMSHRFVAGETLDEAIQASRA |
| Ga0187874_101558812 | 3300018019 | Peatland | MLRTILLTLSDSKSLAHWVTSNPTTRRMALRFVAGETLDE |
| Ga0187765_106195611 | 3300018060 | Tropical Peatland | MLRTTLLKLSESKGLAHWVTTNSTTRRMSHRFVAGET |
| Ga0066655_102079062 | 3300018431 | Grasslands Soil | MLRATLLKLSESKRLAHWVTSNSTTRRMSHRFVAGE |
| Ga0137408_11369821 | 3300019789 | Vadose Zone Soil | MLRSTLLKLSESKGFANWVTSNGTTRRMARRFVAGETDAR |
| Ga0210401_102590423 | 3300020583 | Soil | MLRAILLKLSESPGFAHWVTSNPTTRRMARRFVAGETLDEAV |
| Ga0210401_107123471 | 3300020583 | Soil | MLRSTLLKLSESAGFAHWVTSNPTTRRMARRFVAGETL |
| Ga0210401_107425891 | 3300020583 | Soil | MLRSILLKFSESKSFAHWVTTNATTRRMSHRFVAGETLEEA |
| Ga0215015_106066952 | 3300021046 | Soil | MLRATLLKLSESARFAHWVTSNSTTRRMAQRFVEGETLDQAI |
| Ga0215015_107923181 | 3300021046 | Soil | MLRSILLKFSESKSFAHWVTTNATTRRMSHRFVAGETLEE |
| Ga0210400_100040061 | 3300021170 | Soil | MLRSILLKFSESKSFAHWVTTNATTRRMSHRFVAGESLEE |
| Ga0210396_102651993 | 3300021180 | Soil | MLRSILLKFSESKSFAHWVTTNATTRRMSHRFVAGETLEEALQVA |
| Ga0210387_103611351 | 3300021405 | Soil | MLRATLLKLSESPRFAKWVTSNGTTRRMARRFVAGETLDEAIE |
| Ga0210386_101275981 | 3300021406 | Soil | MLRSTLLKLSNSKGLAHWVTSNGTTRRMSHRFVAGETLDE |
| Ga0210391_103867512 | 3300021433 | Soil | MLRASLLKLSESKSFAHWVVCNERTRRMAHRFVPGETLDEAIAAA |
| Ga0210410_104846601 | 3300021479 | Soil | MLRASLLKLSESKSFAHWVVSNDRTRRMAHRFVPGETLD |
| Ga0126371_108703931 | 3300021560 | Tropical Forest Soil | MLRSTLLKLSESKSFARWVTSNRTTRRMSHRFVAGEELDEAI |
| Ga0126371_137435961 | 3300021560 | Tropical Forest Soil | MVRSTLLRLSESKSFARWVTSNRTTRKMSHRFVAGETLEEALSAALVCNDQ |
| Ga0242655_100793232 | 3300022532 | Soil | MLRSTLLKLSENKGFANWVTSNGTTRRMARRFVAG |
| Ga0242662_100862901 | 3300022533 | Soil | MLRSTLLKLAESQSFANWVTSNSTTRRMSRRFVAGDFKEGI |
| Ga0242662_102106922 | 3300022533 | Soil | MLRSTLLKLSESPGFANFVTSNAKTRQMARRFVAGETLDE |
| Ga0242654_100513492 | 3300022726 | Soil | MLRTTLLKLSQNQRFANWVTTNAKTRGMARRFVAGETL |
| Ga0242654_103429591 | 3300022726 | Soil | MLRATLLKLSESKGFANFVTSNAKTRRMAHRFVAGET |
| Ga0137417_10585472 | 3300024330 | Vadose Zone Soil | MLRSSLLKLSENKAFANWVTSNGTTRRMARRFVAG |
| Ga0207692_107351372 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRSTLLKLSESKSFARWVTSNKTTRKMSHRFVAGEALAEAIA |
| Ga0207664_118335692 | 3300025929 | Agricultural Soil | MLRSTLLKLSNSKALAHWVTSNGTTRRMSHRFVAGETLDEA |
| Ga0257146_10419141 | 3300026374 | Soil | MVRSTLLKLSENKKFARWVTSNQTTRKMSHRFVAGEALEEA |
| Ga0179587_111966191 | 3300026557 | Vadose Zone Soil | MLRAILLKLSESPGFAHWVTSNSTTRRMARRFVAGETLDE |
| Ga0207802_10067942 | 3300026847 | Tropical Forest Soil | MLRSTLLKLSQSNGFAHWVTSNSVTRRMSHRFVAGETLDEVIAA |
| Ga0207855_10511912 | 3300027039 | Tropical Forest Soil | MLRSTLLKLSASPGFANWVTTNGSTRRMAMRFVAGETLNDAIAAA |
| Ga0207983_10314002 | 3300027310 | Soil | MVRSTLLKLSESKKFANWVTMNATTRRMSHRFVAGEELDEAL |
| Ga0208890_10788512 | 3300027523 | Soil | MLRSTLLKLSDSKGLAHWVTSNGTTRRMSHRFVAGETLN |
| Ga0208988_10376991 | 3300027633 | Forest Soil | MLRAILLKLSDSPGFAHWVTSNPTTRRMARRFVAGETLDEAIIA |
| Ga0208827_10771832 | 3300027641 | Peatlands Soil | MLRTILLKLSESKAIAHWVTSNSKTRRMALRFVAGET |
| Ga0209117_10594281 | 3300027645 | Forest Soil | MLRSSLLKLSESRRLAKWVISNGTTRRMAQRFVAGEMLDEAI |
| Ga0209388_10231871 | 3300027655 | Vadose Zone Soil | MLRSTLLKLSESKGFANWVTSNGTTRRMARRFVAGETLDE |
| Ga0209736_10339973 | 3300027660 | Forest Soil | MLRSTLLKLSESPGFAHWVTSNTATRRLARRFVAGE |
| Ga0209009_10036736 | 3300027667 | Forest Soil | MLRAALLKLSESKSFAHWVVSNDHTRRMAHRFVPGETLDEA |
| Ga0207826_10301431 | 3300027680 | Tropical Forest Soil | MLRSTLLKLSASPGFANWVTTNGSTRRMAMRFVAGETLNDA |
| Ga0207826_10457402 | 3300027680 | Tropical Forest Soil | MLRTTLLKLSENKGLAHWVTSNGTTRRMSHRFVAGE |
| Ga0209626_10849642 | 3300027684 | Forest Soil | MLRAGLLKLSESKSFANWVVSNERTRRMAHRFVPGETL |
| Ga0209655_101090501 | 3300027767 | Bog Forest Soil | MLRATLLKLSESPRFAKWVTSNGTTRRMARRFVAGETLDEA |
| Ga0209112_101420452 | 3300027817 | Forest Soil | MLRSILLKLSASPGFARWVVSNHSTRKMSRRFVAGETLDEAL |
| Ga0209180_105062752 | 3300027846 | Vadose Zone Soil | MLRATLLKLSESARFAHWVTSNSTTRGMAQRFVAG |
| Ga0209701_105230381 | 3300027862 | Vadose Zone Soil | MLRATLLKLSESPGFARWVTSNPTTRRMARRFVAG |
| Ga0209283_107384022 | 3300027875 | Vadose Zone Soil | MLRSTLLKLSESKSFANWVTSNGTTRRMARRFVAGETLDE |
| Ga0209275_104077091 | 3300027884 | Soil | MLRSILLKLSESPGFASWVISNHSTRGMSRRFVAGETLDE |
| Ga0209488_100208267 | 3300027903 | Vadose Zone Soil | MLRSTLLKLSESKGFANWVISNGTTRRMARRFVAGETLD |
| Ga0137415_1000909613 | 3300028536 | Vadose Zone Soil | MLRATLLKLSESRGFAHWVTSNPTTRRMARRFVPGETLDDAIIAA |
| Ga0137415_106007352 | 3300028536 | Vadose Zone Soil | MLRATLLKLSESPGFAHWVTSNPTTRRMARRFVPGETLDDAIIAA |
| Ga0302181_100794213 | 3300030056 | Palsa | MLRSTLLKFSESKGLANWVVSNSAANRMAHRFVAGETLDEAIA |
| Ga0302176_101368392 | 3300030057 | Palsa | MLRATLLKLSESKGFANWVVTNPSANRTAHRFVAGETLHEAIAAA |
| Ga0265770_10051603 | 3300030878 | Soil | MLRATLLKLSESPRFAKWVTSNGTTRRMARRFVAGETLD |
| Ga0138296_18001332 | 3300030923 | Soil | MLRSTLLKLSESKGFANWVTSNGTTRRMARRFVAGETL |
| Ga0138302_12804332 | 3300030937 | Soil | MLRATLLKLSESPAFAKWVTSNGTTRRMARRKKLSNQK |
| Ga0138297_16218751 | 3300030962 | Soil | MLRATLLKLSKSPRFAKWVTSNGTTRRMARRFVAGETLDEVVEAKRDG |
| Ga0170834_1030548292 | 3300031057 | Forest Soil | MVRSTLLKLSENKKFARWVTSNQTTRKMSHRFVAGEA |
| Ga0170834_1049627252 | 3300031057 | Forest Soil | MIRSTLLKLSESKSFARWVTSNNTTRRMSHRFVAGEALDEAV |
| Ga0170818_1070632681 | 3300031474 | Forest Soil | MFRSTLLKLSESKKFARWVTSNQTTRKMSHRFVAGEG |
| Ga0318541_100521394 | 3300031545 | Soil | MLRSTLLKLSESNGFAHWVTSNSVTRRMSHRFVADET |
| Ga0306917_108200081 | 3300031719 | Soil | MLRTTLLKLSESKGLANWVTTNGVTRRMSHRFVAGESLD |
| Ga0307469_121561192 | 3300031720 | Hardwood Forest Soil | MLRSTLLKLSESKGFANWVTSNGTTRRMARRFVAG |
| Ga0307468_1021851862 | 3300031740 | Hardwood Forest Soil | MVRSTLLRLSESKKFANWVTTNATTRRMSHRFVAGEE |
| Ga0306918_102786721 | 3300031744 | Soil | MLRSTLLKLSQSNGFAHWVTSNSITRRMSHRFVAGETLDEV |
| Ga0307477_108151052 | 3300031753 | Hardwood Forest Soil | MLRAILLKLSESPGFAHWVTSNPTTRRMARRFVAGETLD |
| Ga0318547_110573191 | 3300031781 | Soil | MLRSTLLKLSDSKGFAHWVTSNGATRRMSHRFVAGEALDE |
| Ga0318568_108427121 | 3300031819 | Soil | MVRSTLLKLSENKKFGSWITANGITRRMARRFVAGETL |
| Ga0318522_104122561 | 3300031894 | Soil | MLRSTLLKLSESNGFAHWVTSNSVTRRMSHRFVAGETLDE |
| Ga0318551_107715211 | 3300031896 | Soil | MVRSTLLKLSENKKFGSWITANGITRRMARRFVAG |
| Ga0310916_105307372 | 3300031942 | Soil | MLRSTLLKLSESEAFARWVTSNRTTRRMSHRFVAGEELEEAISA |
| Ga0307479_1001554810 | 3300031962 | Hardwood Forest Soil | MLRSTLLKLSESKGFANWVTSNGTTRRMARRFVAGEA |
| Ga0307479_106550961 | 3300031962 | Hardwood Forest Soil | MLRATLLKLSESARFAHWVTSNSTTRRMAQRFVPG |
| Ga0307479_109157761 | 3300031962 | Hardwood Forest Soil | MIRSTLLKLSESKSFATWVTSNGTTRRMARRFVAGETLDEA |
| Ga0307479_114345182 | 3300031962 | Hardwood Forest Soil | MLRSILLKLSESKGFANWVSSNGTTRRMARRFVAGETLDEA |
| Ga0318505_100162175 | 3300032060 | Soil | MVRSTLLKLSENKKFGSWITSNGITRRMARRFVAGETLE |
| ⦗Top⦘ |