| Basic Information | |
|---|---|
| Family ID | F079072 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 47 residues |
| Representative Sequence | YADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 93.97 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.966 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.379 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.552 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 0.00% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13683 | rve_3 | 3.45 |
| PF00589 | Phage_integrase | 2.59 |
| PF01527 | HTH_Tnp_1 | 2.59 |
| PF04149 | DUF397 | 1.72 |
| PF00011 | HSP20 | 1.72 |
| PF01548 | DEDD_Tnp_IS110 | 1.72 |
| PF04545 | Sigma70_r4 | 1.72 |
| PF00561 | Abhydrolase_1 | 0.86 |
| PF11225 | DUF3024 | 0.86 |
| PF10604 | Polyketide_cyc2 | 0.86 |
| PF02899 | Phage_int_SAM_1 | 0.86 |
| PF01244 | Peptidase_M19 | 0.86 |
| PF02687 | FtsX | 0.86 |
| PF13751 | DDE_Tnp_1_6 | 0.86 |
| PF13304 | AAA_21 | 0.86 |
| PF00248 | Aldo_ket_red | 0.86 |
| PF01850 | PIN | 0.86 |
| PF00378 | ECH_1 | 0.86 |
| PF00392 | GntR | 0.86 |
| PF04542 | Sigma70_r2 | 0.86 |
| PF08751 | TrwC | 0.86 |
| PF00583 | Acetyltransf_1 | 0.86 |
| PF02604 | PhdYeFM_antitox | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.72 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.72 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.86 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.86 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.86 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.86 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.86 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.86 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.86 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.97 % |
| Unclassified | root | N/A | 6.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B02GQA3M | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 507 | Open in IMG/M |
| 3300004635|Ga0062388_102024753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744 | 596 | Open in IMG/M |
| 3300005328|Ga0070676_10712059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 734 | Open in IMG/M |
| 3300005332|Ga0066388_108694334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus rhodochrous | 505 | Open in IMG/M |
| 3300005332|Ga0066388_108727945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744 | 503 | Open in IMG/M |
| 3300005336|Ga0070680_100829790 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005434|Ga0070709_10364056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1071 | Open in IMG/M |
| 3300005445|Ga0070708_101683255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 590 | Open in IMG/M |
| 3300005450|Ga0066682_10536617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
| 3300005471|Ga0070698_100021552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 6749 | Open in IMG/M |
| 3300005553|Ga0066695_10875937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 514 | Open in IMG/M |
| 3300005712|Ga0070764_10479127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300006173|Ga0070716_101750523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 514 | Open in IMG/M |
| 3300006175|Ga0070712_100046799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2991 | Open in IMG/M |
| 3300006176|Ga0070765_101483085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
| 3300006800|Ga0066660_11115951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 624 | Open in IMG/M |
| 3300009012|Ga0066710_102426332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300009029|Ga0066793_10283041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 959 | Open in IMG/M |
| 3300009520|Ga0116214_1357358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 566 | Open in IMG/M |
| 3300009521|Ga0116222_1004939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6602 | Open in IMG/M |
| 3300009522|Ga0116218_1141188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300009525|Ga0116220_10334267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 670 | Open in IMG/M |
| 3300009552|Ga0116138_1137783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 674 | Open in IMG/M |
| 3300009665|Ga0116135_1120479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
| 3300009698|Ga0116216_10277800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1022 | Open in IMG/M |
| 3300009759|Ga0116101_1168216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 545 | Open in IMG/M |
| 3300009792|Ga0126374_11360051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 576 | Open in IMG/M |
| 3300010048|Ga0126373_12677335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 556 | Open in IMG/M |
| 3300010048|Ga0126373_12850478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 539 | Open in IMG/M |
| 3300010333|Ga0134080_10639808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 522 | Open in IMG/M |
| 3300010358|Ga0126370_11888772 | Not Available | 580 | Open in IMG/M |
| 3300010360|Ga0126372_12147491 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010376|Ga0126381_101787716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 887 | Open in IMG/M |
| 3300010379|Ga0136449_101130655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 1242 | Open in IMG/M |
| 3300010379|Ga0136449_104218625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 533 | Open in IMG/M |
| 3300010379|Ga0136449_104345005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 523 | Open in IMG/M |
| 3300010398|Ga0126383_11197440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 849 | Open in IMG/M |
| 3300012200|Ga0137382_10010727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4868 | Open in IMG/M |
| 3300012201|Ga0137365_11274480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 522 | Open in IMG/M |
| 3300012206|Ga0137380_10251899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1591 | Open in IMG/M |
| 3300012209|Ga0137379_11496758 | Not Available | 576 | Open in IMG/M |
| 3300012362|Ga0137361_10538822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 1071 | Open in IMG/M |
| 3300012532|Ga0137373_10048744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3951 | Open in IMG/M |
| 3300012930|Ga0137407_10524734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 1107 | Open in IMG/M |
| 3300012944|Ga0137410_10823197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 781 | Open in IMG/M |
| 3300015371|Ga0132258_11812368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia takedensis | 1538 | Open in IMG/M |
| 3300016270|Ga0182036_11923573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 502 | Open in IMG/M |
| 3300016319|Ga0182033_10249467 | Not Available | 1441 | Open in IMG/M |
| 3300016341|Ga0182035_10999695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
| 3300016422|Ga0182039_10351874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1237 | Open in IMG/M |
| 3300016422|Ga0182039_10963625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300016445|Ga0182038_12020309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 522 | Open in IMG/M |
| 3300017821|Ga0187812_1221866 | Not Available | 603 | Open in IMG/M |
| 3300017942|Ga0187808_10367583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 654 | Open in IMG/M |
| 3300017946|Ga0187879_10616319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 603 | Open in IMG/M |
| 3300017955|Ga0187817_10338061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. OK19-0408 | 960 | Open in IMG/M |
| 3300017955|Ga0187817_10708651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 642 | Open in IMG/M |
| 3300017955|Ga0187817_10852687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 582 | Open in IMG/M |
| 3300017974|Ga0187777_10300403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 1097 | Open in IMG/M |
| 3300018035|Ga0187875_10716327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 525 | Open in IMG/M |
| 3300018038|Ga0187855_10518271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 694 | Open in IMG/M |
| 3300018064|Ga0187773_10800553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 599 | Open in IMG/M |
| 3300018433|Ga0066667_10612447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 909 | Open in IMG/M |
| 3300018433|Ga0066667_11102086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola oryzae | 687 | Open in IMG/M |
| 3300020082|Ga0206353_11272311 | Not Available | 1232 | Open in IMG/M |
| 3300020581|Ga0210399_10792562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 774 | Open in IMG/M |
| 3300020582|Ga0210395_10138835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1810 | Open in IMG/M |
| 3300021404|Ga0210389_10483831 | Not Available | 974 | Open in IMG/M |
| 3300021478|Ga0210402_10941301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 790 | Open in IMG/M |
| 3300025910|Ga0207684_10654266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 895 | Open in IMG/M |
| 3300026959|Ga0207852_1006770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
| 3300027024|Ga0207819_1023805 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300027570|Ga0208043_1029417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 1704 | Open in IMG/M |
| 3300027703|Ga0207862_1115740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300027817|Ga0209112_10364465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 516 | Open in IMG/M |
| 3300027854|Ga0209517_10409785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 759 | Open in IMG/M |
| 3300027869|Ga0209579_10181345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1126 | Open in IMG/M |
| 3300028781|Ga0302223_10091825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
| 3300028808|Ga0302228_10388690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 620 | Open in IMG/M |
| 3300028879|Ga0302229_10440093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 578 | Open in IMG/M |
| 3300030494|Ga0310037_10163385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 1004 | Open in IMG/M |
| 3300030494|Ga0310037_10218898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 838 | Open in IMG/M |
| 3300030707|Ga0310038_10274928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 769 | Open in IMG/M |
| 3300031525|Ga0302326_11929737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 766 | Open in IMG/M |
| 3300031543|Ga0318516_10532142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 673 | Open in IMG/M |
| 3300031672|Ga0307373_10448709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora umbrina | 723 | Open in IMG/M |
| 3300031708|Ga0310686_112295644 | Not Available | 515 | Open in IMG/M |
| 3300031708|Ga0310686_119701747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 785 | Open in IMG/M |
| 3300031713|Ga0318496_10084754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1686 | Open in IMG/M |
| 3300031744|Ga0306918_11511834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 513 | Open in IMG/M |
| 3300031748|Ga0318492_10530731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 625 | Open in IMG/M |
| 3300031765|Ga0318554_10082384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 1795 | Open in IMG/M |
| 3300031770|Ga0318521_10118686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 1476 | Open in IMG/M |
| 3300031805|Ga0318497_10351000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 824 | Open in IMG/M |
| 3300031821|Ga0318567_10781020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 541 | Open in IMG/M |
| 3300031845|Ga0318511_10556670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 533 | Open in IMG/M |
| 3300031890|Ga0306925_10440220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1394 | Open in IMG/M |
| 3300031894|Ga0318522_10255424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 664 | Open in IMG/M |
| 3300031897|Ga0318520_10718265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 625 | Open in IMG/M |
| 3300031910|Ga0306923_11198504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 812 | Open in IMG/M |
| 3300031942|Ga0310916_11396030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 574 | Open in IMG/M |
| 3300031945|Ga0310913_10529734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 836 | Open in IMG/M |
| 3300031947|Ga0310909_10986137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300032008|Ga0318562_10668475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 598 | Open in IMG/M |
| 3300032076|Ga0306924_11446813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 731 | Open in IMG/M |
| 3300032160|Ga0311301_10511669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1774 | Open in IMG/M |
| 3300032160|Ga0311301_11373253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 884 | Open in IMG/M |
| 3300032180|Ga0307471_102102139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
| 3300032805|Ga0335078_10086305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4561 | Open in IMG/M |
| 3300032805|Ga0335078_10831762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
| 3300032805|Ga0335078_12175322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 586 | Open in IMG/M |
| 3300032829|Ga0335070_10979167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 781 | Open in IMG/M |
| 3300032892|Ga0335081_10080829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4917 | Open in IMG/M |
| 3300032954|Ga0335083_10399775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1175 | Open in IMG/M |
| 3300032954|Ga0335083_10884915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 710 | Open in IMG/M |
| 3300033290|Ga0318519_10680625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 628 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_01822080 | 2170459023 | Grass Soil | YADLGAGFYTRRESPDARQDYLMRQLRKLNPGCVITITPAEAA |
| Ga0062388_1020247531 | 3300004635 | Bog Forest Soil | PYQDLGADFYTRRESPAQRQAYLLRQLEKLNPGCTVTIRPPEAA* |
| Ga0070676_107120592 | 3300005328 | Miscanthus Rhizosphere | TLLKIAYSVLKTGKPYADLGADFYTRRESPDARQGYLMRQLQKLNPGCVITIIPAEAA* |
| Ga0066388_1086943341 | 3300005332 | Tropical Forest Soil | YADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA* |
| Ga0066388_1087279451 | 3300005332 | Tropical Forest Soil | DLGADFYTRRESPEQRRAYLLRQLEKLSPGCTITITPAEAA* |
| Ga0070680_1008297901 | 3300005336 | Corn Rhizosphere | HTLLKIAYQVLKAGAPYADLGAGFYDTRESAQARQDYLVRQLQKLNPGCVITITPPEAA* |
| Ga0070709_103640561 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AARRTRGAKKRAITAIAHTLLKIACAVLKAGRPYCEPGAGFCSRRESAQARQDYLLRQLQRLNPGCVITTAPAETA* |
| Ga0070708_1016832551 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA* |
| Ga0066682_105366172 | 3300005450 | Soil | PYQDLGADFYTRRESPEQRQAYLLRQLQKLNPGCTITISPPEAA* |
| Ga0070698_1000215521 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PYQDLGADFYTRRESPEQRRAYLLRQLEKLSPGCVITITPAEAA* |
| Ga0066695_108759372 | 3300005553 | Soil | AIAHTLLKIAYAVLKSGKPYQEPGADFYTRRESAQAREEYLLRQLQKLNPGCVITITPAEAA* |
| Ga0070764_104791273 | 3300005712 | Soil | NKGAQKRAITAIAHTLLKIAYSVLKTGQPYADLGTDFYTRRESPDARQDYLMRQLQKLNPGCVIAITPAEAA* |
| Ga0070716_1017505231 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | NKGAQKRAITAIAHTLLKIAYSVLKTGTPYADLGAGFYTRRESPDARQDYLMRQLRKLNPGCVITITPAEAA* |
| Ga0070712_1000467991 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TDLGAGFYASRESPQARQDYLIRQLQKLNPGSVITITPAEAA* |
| Ga0070765_1014830851 | 3300006176 | Soil | LGADFYTRRESPAQRQAYLLRQLEKLNPGCTITIGPPEAA* |
| Ga0066660_111159512 | 3300006800 | Soil | YQEPGADFYTRRESAQAREEYLLRQLQKLNPGCVITITPAEAA* |
| Ga0066710_1024263322 | 3300009012 | Grasslands Soil | FYTRRESAQAREEYLLRQLQKLNPGCVITITPAEAA |
| Ga0066793_102830411 | 3300009029 | Prmafrost Soil | LLKIAYQLLKSGKPYEDLGADFYTSRESPAQRRAYLLRQLERLSPGCTITITPAEAA* |
| Ga0116214_13573582 | 3300009520 | Peatlands Soil | YTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA* |
| Ga0116222_10049399 | 3300009521 | Peatlands Soil | FYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA* |
| Ga0116218_11411881 | 3300009522 | Peatlands Soil | KPYEDLGADFYTKRESPDQRRAYLLRQLAKLSRGCAIIITPAEAA* |
| Ga0116220_103342672 | 3300009525 | Peatlands Soil | LKTGTPCTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA* |
| Ga0116138_11377831 | 3300009552 | Peatland | VLKTGKPYADLGADFYTCRESPDARQDYLMRQLRKLNPGYVITITPAETA* |
| Ga0116135_11204792 | 3300009665 | Peatland | AYQVLKSGTLYQDLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA* |
| Ga0116216_102778002 | 3300009698 | Peatlands Soil | DFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA* |
| Ga0116101_11682161 | 3300009759 | Peatland | VLKTGKPYADLGADFYTCRESPDARQDYLMRQLRKLNPGYVITITPTEAA* |
| Ga0126374_113600512 | 3300009792 | Tropical Forest Soil | LKTGKPYAGLGAGFYTRRESPGARQDYLMRQLQKLNPGRVITITPAEAA* |
| Ga0126373_126773351 | 3300010048 | Tropical Forest Soil | KIAYSVLKTGTPYADLGADFYTRRESPDARQGYLMRQLQKLNPGSVITITPAEAA* |
| Ga0126373_128504781 | 3300010048 | Tropical Forest Soil | KPYAGLGAGFYTRRESPGARQDYLMRQLQKLNPGRVITITPAEAA* |
| Ga0134080_106398082 | 3300010333 | Grasslands Soil | FYASRETPQARQNYLIRQLQKLNPGCVITVTPAEAA* |
| Ga0126370_118887721 | 3300010358 | Tropical Forest Soil | KIAYAILRTSKPYQEPGPDFYTRRESPRARQDYLLRQLQQLNPGCVITITPAEAA* |
| Ga0126372_121474912 | 3300010360 | Tropical Forest Soil | LKTGVPHHDLGADFYASRESPQARQDYLIRQLHKLNPGCIITITPPEAA* |
| Ga0126381_1017877162 | 3300010376 | Tropical Forest Soil | HTLLKIAYQVLKTGTPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITVIPAEAA* |
| Ga0136449_1011306552 | 3300010379 | Peatlands Soil | GQPYQDLGADFYTRRESPEQRRAHLLRQLEKLSSGCTITITPAEAA* |
| Ga0136449_1042186251 | 3300010379 | Peatlands Soil | GTPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPPEAA* |
| Ga0136449_1043450051 | 3300010379 | Peatlands Soil | DLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA* |
| Ga0126383_111974401 | 3300010398 | Tropical Forest Soil | GADFYTRRESPVQRRAYLLRQLEKLSPGCTITITPAEAA* |
| Ga0137382_100107277 | 3300012200 | Vadose Zone Soil | RTLLKIAYSVLKTGKPYADLGADFCTCRESPDARQDYLMRQLRKLNPGCVITITPAEAA* |
| Ga0137365_112744802 | 3300012201 | Vadose Zone Soil | GADFYTKRESPDQRRAYLLRQLEKLSPGCTITITPAEAA* |
| Ga0137380_102518991 | 3300012206 | Vadose Zone Soil | ARRESPEQRRAYLLRQLEKLSPGCVITITPAEAT* |
| Ga0137379_114967581 | 3300012209 | Vadose Zone Soil | IAYAVLKTGKPYQEPGADFYTRRESAQARQDYLLRQLQKLNPGSVITITPAEAA* |
| Ga0137361_105388221 | 3300012362 | Vadose Zone Soil | TGTPYADLGADFYTRRESPDARQDYLMRQLRKLNPGCVITITPAETA* |
| Ga0137373_100487441 | 3300012532 | Vadose Zone Soil | PYEDPGADFCTRRESPQQRQAYLMRQLQKLNPGCTITITPAEAA* |
| Ga0137407_105247342 | 3300012930 | Vadose Zone Soil | AYQVLKSGKPYEDLGADFYASRESPEQRRAYLLRQLEKLSPGCTITITLAEAA* |
| Ga0137410_108231973 | 3300012944 | Vadose Zone Soil | LGEDFYTKRESPQAKQDYLIRQLQKLNPGCTVTITPAEAA* |
| Ga0132258_118123681 | 3300015371 | Arabidopsis Rhizosphere | AYQVLKTGTPCTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA* |
| Ga0182036_119235731 | 3300016270 | Soil | LLKIAYQVLKTGTPYTDLGADFYTSRESPQARQDYLIRQLQKLNPGSVITIIPAEAA |
| Ga0182033_102494671 | 3300016319 | Soil | TPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA |
| Ga0182035_109996951 | 3300016341 | Soil | KTGKPYADLGADFYTRRESPDARQDYLMRKPQKLNPGCVITITPAEAA |
| Ga0182039_103518742 | 3300016422 | Soil | EDLGADFYTKRESPDQRRAYLLRQLEKLSPGCTITITPAEAA |
| Ga0182039_109636252 | 3300016422 | Soil | GADFYTRRESAQARQDYLLRQLQKLNPGCVITITPQEAA |
| Ga0182038_120203091 | 3300016445 | Soil | ADFYTRRESPDARQHYLVRQLQKLNPGCVITITPAEAA |
| Ga0187812_12218661 | 3300017821 | Freshwater Sediment | YTDLGADFYASRETPQARQDYLIRQLQKLNPRCVITVTPAETA |
| Ga0187808_103675831 | 3300017942 | Freshwater Sediment | PYQEPGADFYTRRESPAQRQAFLERQLQKLHPGCTITITPAQAA |
| Ga0187879_106163191 | 3300017946 | Peatland | VLKTGKPYEDLGAGFYASRESPQARQDYLIRQLQKLNPGSTITITPQEAA |
| Ga0187817_103380612 | 3300017955 | Freshwater Sediment | GADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA |
| Ga0187817_107086511 | 3300017955 | Freshwater Sediment | VLKTGRPYTDLGADFYTSRESAQARQDYLIRQLQKLNPGSTITITPQEAA |
| Ga0187817_108526871 | 3300017955 | Freshwater Sediment | IAYSVLKTGTPYADLGADFYTRRESAQARQDYLLRQPKKLNPGCVITITPTEAA |
| Ga0187777_103004031 | 3300017974 | Tropical Peatland | DFYARRESPDARQDYLMRQLQKLNPGCVITITPAGAA |
| Ga0187875_107163271 | 3300018035 | Peatland | TLLKIAYSVLKTCQPYADLGADFYTRRESPDARQDYLMRQLRKLNPGCVITITPTEAA |
| Ga0187855_105182711 | 3300018038 | Peatland | LGADYYARRESPDQRRAYLLRQLEKLSPGCAITITPAEAA |
| Ga0187773_108005531 | 3300018064 | Tropical Peatland | HTLLKIAYQVLKTGTPYTDLGAGFYASRETPQARQDYLIRQLRKLNPGCVITITPAEAA |
| Ga0066667_106124471 | 3300018433 | Grasslands Soil | LLKIAYQVLKTGTPYTDLGAYFYASRETPQARQDYLIRQLQKLNPGCVITVIPAEAA |
| Ga0066667_111020861 | 3300018433 | Grasslands Soil | PYHEPGADFCTRRESAQAREDYLLRQLQKLRPGCVITITPAEAA |
| Ga0206353_112723112 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | FYTRRDSAQARQDYLLRQLQKLNPGCVVTITPAEAA |
| Ga0210399_107925621 | 3300020581 | Soil | TATPYTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA |
| Ga0210395_101388353 | 3300020582 | Soil | FYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA |
| Ga0210389_104838311 | 3300021404 | Soil | GAGYYASRESAQAKQDYLIRQLQQLNPGCAITITPREAA |
| Ga0210402_109413012 | 3300021478 | Soil | VLKTGKPYADLGADFYTRRESPDARQDYLMRQLHKLNPGCVITITPAETA |
| Ga0207684_106542661 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RAITAIARTLLKIAYSVLKTGRPYADLGVDFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA |
| Ga0207852_10067703 | 3300026959 | Tropical Forest Soil | LKTGKPYADLGADFYTRRESPDARQDYLMRQLRKLNPGCVITITPAEAA |
| Ga0207819_10238051 | 3300027024 | Tropical Forest Soil | KTGKPYADLGADFYTRRESPDARQDYLMRQLRKLNPGCVITITPAEAA |
| Ga0208043_10294171 | 3300027570 | Peatlands Soil | LGADFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0207862_11157402 | 3300027703 | Tropical Forest Soil | GKPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAQAA |
| Ga0209112_103644652 | 3300027817 | Forest Soil | TPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0209517_104097852 | 3300027854 | Peatlands Soil | KTGTPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0209579_101813451 | 3300027869 | Surface Soil | KTGTPYTDLGADFYASREAPQARQDYLIRQLQKLNPGCVITVIPAETA |
| Ga0302223_100918251 | 3300028781 | Palsa | YQVLKSGKPYEDLGADFYAKQESPEQRRAYLLRQLEKLGPGCTITVTPAEAA |
| Ga0302228_103886901 | 3300028808 | Palsa | KTGKPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCAITITPAEAA |
| Ga0302229_104400932 | 3300028879 | Palsa | ADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA |
| Ga0310037_101633853 | 3300030494 | Peatlands Soil | TDLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA |
| Ga0310037_102188982 | 3300030494 | Peatlands Soil | ADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA |
| Ga0310038_102749282 | 3300030707 | Peatlands Soil | ADFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0302326_119297371 | 3300031525 | Palsa | SVLKTGKPYADLGADFYTCRESPDARQDYLMRQLRKLNPGYVITITPAETA |
| Ga0318516_105321421 | 3300031543 | Soil | ADLGADFYTRRESPDARQAYLMRQLQKLNPGCIVTITSAETA |
| Ga0307373_104487092 | 3300031672 | Soil | DFCTKRESPEQRRAYLLRQLEKLSPGCTITITPAEAA |
| Ga0310686_1122956441 | 3300031708 | Soil | DFYTRRESAQARQDYLLRQLQKLNPGSVITITPAEAA |
| Ga0310686_1197017471 | 3300031708 | Soil | AYQVLKAGEPYTDLGADFYASRESAQARQDYLVRRLQTLNPGCVITIAPAETA |
| Ga0318496_100847544 | 3300031713 | Soil | TPYTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA |
| Ga0306918_115118341 | 3300031744 | Soil | LKTGKPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCAITITPAEAA |
| Ga0318492_105307311 | 3300031748 | Soil | PYADLGADFYTRRESPDARQAYLMRQLQKLNPGCIVTITSAETA |
| Ga0318554_100823844 | 3300031765 | Soil | YSVLKTGKPYADLGADFYTRRESPDARQHYLVRQLQKLNPGCVITITPAEAA |
| Ga0318521_101186861 | 3300031770 | Soil | YSVLKTGKPYADLGADFYTRRESPDARQDYLVRQLQKLNPGCVITITPAEAA |
| Ga0318497_103510002 | 3300031805 | Soil | PYTDLGADFYASRETPQARQDYLMRQLQKLNPGCVITITPAEAA |
| Ga0318567_107810201 | 3300031821 | Soil | LKIAYSVLKTGKPYADLGADFYTRRESPDARQHYLMRQLQNLNPGCVITITPAETA |
| Ga0318511_105566701 | 3300031845 | Soil | KIAYSVLKTGKPYADLGADFYTRRESPDARQAYLMRQLQKLNPGCIVTITSAETA |
| Ga0306925_104402202 | 3300031890 | Soil | DFYTKRESPDQRRAYLLRQLEKLSPGCTITITPAEAA |
| Ga0318522_102554242 | 3300031894 | Soil | VLKTGTPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA |
| Ga0318520_107182651 | 3300031897 | Soil | VLKTGTPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA |
| Ga0306923_111985042 | 3300031910 | Soil | DFSTCAPGSVLKTGEPYANLGADFYTRRESPDARQDYLMRKPKKLNPGCVITITPAEAA |
| Ga0310916_113960301 | 3300031942 | Soil | LGADFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA |
| Ga0310913_105297342 | 3300031945 | Soil | LLKIAYSVLKTGKPYADLGADFYTRRESPDARQDYLVRQLQKLNPGCVITITPAEAA |
| Ga0310909_109861371 | 3300031947 | Soil | IAHTLLKIACTVLKTGKPHAGLGAGFCTRRESPDARQGCLIRQLQKLNPGSVITIIPAEA |
| Ga0318562_106684751 | 3300032008 | Soil | ADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA |
| Ga0306924_114468132 | 3300032076 | Soil | TDLGADFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA |
| Ga0311301_105116691 | 3300032160 | Peatlands Soil | FYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA |
| Ga0311301_113732533 | 3300032160 | Peatlands Soil | IACSVLKTGTPYTDLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA |
| Ga0307471_1021021393 | 3300032180 | Hardwood Forest Soil | YRDLGPGFYTRRESPEQRQAYLLRQLQKLNPGATITITPPEAA |
| Ga0335078_100863051 | 3300032805 | Soil | VMPNASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0335078_108317621 | 3300032805 | Soil | LGADFYASRETTQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0335078_121753222 | 3300032805 | Soil | KIAYQVLKSGQPYQDLGADFYTRRESPEQRRAYLLRQLQKLSPGCTITITPAEVA |
| Ga0335070_109791672 | 3300032829 | Soil | DFYASRETTQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0335081_100808292 | 3300032892 | Soil | MPNASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0335083_103997752 | 3300032954 | Soil | LKTGKPYQDLGDDFYTRRENPGARQDYLMRQLQKLNPGCVITITPTEAT |
| Ga0335083_108849151 | 3300032954 | Soil | VLKTGTPYTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA |
| Ga0318519_106806251 | 3300033290 | Soil | LGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA |
| ⦗Top⦘ |