NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079072

Metagenome / Metatranscriptome Family F079072

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079072
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 47 residues
Representative Sequence YADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA
Number of Associated Samples 102
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.28 %
% of genes from short scaffolds (< 2000 bps) 93.97 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.966 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.379 % of family members)
Environment Ontology (ENVO) Unclassified
(21.552 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.448 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.99%    β-sheet: 0.00%    Coil/Unstructured: 69.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF13683rve_3 3.45
PF00589Phage_integrase 2.59
PF01527HTH_Tnp_1 2.59
PF04149DUF397 1.72
PF00011HSP20 1.72
PF01548DEDD_Tnp_IS110 1.72
PF04545Sigma70_r4 1.72
PF00561Abhydrolase_1 0.86
PF11225DUF3024 0.86
PF10604Polyketide_cyc2 0.86
PF02899Phage_int_SAM_1 0.86
PF01244Peptidase_M19 0.86
PF02687FtsX 0.86
PF13751DDE_Tnp_1_6 0.86
PF13304AAA_21 0.86
PF00248Aldo_ket_red 0.86
PF01850PIN 0.86
PF00378ECH_1 0.86
PF00392GntR 0.86
PF04542Sigma70_r2 0.86
PF08751TrwC 0.86
PF00583Acetyltransf_1 0.86
PF02604PhdYeFM_antitox 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 1.72
COG3547TransposaseMobilome: prophages, transposons [X] 1.72
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.86
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.86
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.86
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.86
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.86
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.86
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.86
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.86
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.97 %
UnclassifiedrootN/A6.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459023|GZGNO2B02GQA3MAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala507Open in IMG/M
3300004635|Ga0062388_102024753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744596Open in IMG/M
3300005328|Ga0070676_10712059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia734Open in IMG/M
3300005332|Ga0066388_108694334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus rhodochrous505Open in IMG/M
3300005332|Ga0066388_108727945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744503Open in IMG/M
3300005336|Ga0070680_100829790All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300005434|Ga0070709_10364056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1071Open in IMG/M
3300005445|Ga0070708_101683255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala590Open in IMG/M
3300005450|Ga0066682_10536617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia740Open in IMG/M
3300005471|Ga0070698_100021552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales6749Open in IMG/M
3300005553|Ga0066695_10875937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala514Open in IMG/M
3300005712|Ga0070764_10479127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia745Open in IMG/M
3300006173|Ga0070716_101750523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis514Open in IMG/M
3300006175|Ga0070712_100046799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2991Open in IMG/M
3300006176|Ga0070765_101483085All Organisms → cellular organisms → Bacteria → Terrabacteria group638Open in IMG/M
3300006800|Ga0066660_11115951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala624Open in IMG/M
3300009012|Ga0066710_102426332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300009029|Ga0066793_10283041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala959Open in IMG/M
3300009520|Ga0116214_1357358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala566Open in IMG/M
3300009521|Ga0116222_1004939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6602Open in IMG/M
3300009522|Ga0116218_1141188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1094Open in IMG/M
3300009525|Ga0116220_10334267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala670Open in IMG/M
3300009552|Ga0116138_1137783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala674Open in IMG/M
3300009665|Ga0116135_1120479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia962Open in IMG/M
3300009698|Ga0116216_10277800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1022Open in IMG/M
3300009759|Ga0116101_1168216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala545Open in IMG/M
3300009792|Ga0126374_11360051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala576Open in IMG/M
3300010048|Ga0126373_12677335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala556Open in IMG/M
3300010048|Ga0126373_12850478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala539Open in IMG/M
3300010333|Ga0134080_10639808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae522Open in IMG/M
3300010358|Ga0126370_11888772Not Available580Open in IMG/M
3300010360|Ga0126372_12147491All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300010376|Ga0126381_101787716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia887Open in IMG/M
3300010379|Ga0136449_101130655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1242Open in IMG/M
3300010379|Ga0136449_104218625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala533Open in IMG/M
3300010379|Ga0136449_104345005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala523Open in IMG/M
3300010398|Ga0126383_11197440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales849Open in IMG/M
3300012200|Ga0137382_10010727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4868Open in IMG/M
3300012201|Ga0137365_11274480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala522Open in IMG/M
3300012206|Ga0137380_10251899All Organisms → cellular organisms → Bacteria → Terrabacteria group1591Open in IMG/M
3300012209|Ga0137379_11496758Not Available576Open in IMG/M
3300012362|Ga0137361_10538822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1071Open in IMG/M
3300012532|Ga0137373_10048744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3951Open in IMG/M
3300012930|Ga0137407_10524734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1107Open in IMG/M
3300012944|Ga0137410_10823197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala781Open in IMG/M
3300015371|Ga0132258_11812368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia takedensis1538Open in IMG/M
3300016270|Ga0182036_11923573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala502Open in IMG/M
3300016319|Ga0182033_10249467Not Available1441Open in IMG/M
3300016341|Ga0182035_10999695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia741Open in IMG/M
3300016422|Ga0182039_10351874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1237Open in IMG/M
3300016422|Ga0182039_10963625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300016445|Ga0182038_12020309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala522Open in IMG/M
3300017821|Ga0187812_1221866Not Available603Open in IMG/M
3300017942|Ga0187808_10367583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala654Open in IMG/M
3300017946|Ga0187879_10616319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala603Open in IMG/M
3300017955|Ga0187817_10338061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. OK19-0408960Open in IMG/M
3300017955|Ga0187817_10708651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala642Open in IMG/M
3300017955|Ga0187817_10852687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala582Open in IMG/M
3300017974|Ga0187777_10300403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1097Open in IMG/M
3300018035|Ga0187875_10716327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala525Open in IMG/M
3300018038|Ga0187855_10518271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala694Open in IMG/M
3300018064|Ga0187773_10800553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala599Open in IMG/M
3300018433|Ga0066667_10612447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia909Open in IMG/M
3300018433|Ga0066667_11102086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola oryzae687Open in IMG/M
3300020082|Ga0206353_11272311Not Available1232Open in IMG/M
3300020581|Ga0210399_10792562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala774Open in IMG/M
3300020582|Ga0210395_10138835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1810Open in IMG/M
3300021404|Ga0210389_10483831Not Available974Open in IMG/M
3300021478|Ga0210402_10941301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala790Open in IMG/M
3300025910|Ga0207684_10654266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala895Open in IMG/M
3300026959|Ga0207852_1006770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1303Open in IMG/M
3300027024|Ga0207819_1023805All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300027570|Ga0208043_1029417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1704Open in IMG/M
3300027703|Ga0207862_1115740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300027817|Ga0209112_10364465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis516Open in IMG/M
3300027854|Ga0209517_10409785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala759Open in IMG/M
3300027869|Ga0209579_10181345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1126Open in IMG/M
3300028781|Ga0302223_10091825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300028808|Ga0302228_10388690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala620Open in IMG/M
3300028879|Ga0302229_10440093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala578Open in IMG/M
3300030494|Ga0310037_10163385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales1004Open in IMG/M
3300030494|Ga0310037_10218898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala838Open in IMG/M
3300030707|Ga0310038_10274928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala769Open in IMG/M
3300031525|Ga0302326_11929737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala766Open in IMG/M
3300031543|Ga0318516_10532142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala673Open in IMG/M
3300031672|Ga0307373_10448709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora umbrina723Open in IMG/M
3300031708|Ga0310686_112295644Not Available515Open in IMG/M
3300031708|Ga0310686_119701747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala785Open in IMG/M
3300031713|Ga0318496_10084754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1686Open in IMG/M
3300031744|Ga0306918_11511834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala513Open in IMG/M
3300031748|Ga0318492_10530731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala625Open in IMG/M
3300031765|Ga0318554_10082384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1795Open in IMG/M
3300031770|Ga0318521_10118686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1476Open in IMG/M
3300031805|Ga0318497_10351000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala824Open in IMG/M
3300031821|Ga0318567_10781020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala541Open in IMG/M
3300031845|Ga0318511_10556670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala533Open in IMG/M
3300031890|Ga0306925_10440220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1394Open in IMG/M
3300031894|Ga0318522_10255424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala664Open in IMG/M
3300031897|Ga0318520_10718265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala625Open in IMG/M
3300031910|Ga0306923_11198504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia812Open in IMG/M
3300031942|Ga0310916_11396030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala574Open in IMG/M
3300031945|Ga0310913_10529734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala836Open in IMG/M
3300031947|Ga0310909_10986137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300032008|Ga0318562_10668475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala598Open in IMG/M
3300032076|Ga0306924_11446813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala731Open in IMG/M
3300032160|Ga0311301_10511669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1774Open in IMG/M
3300032160|Ga0311301_11373253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia884Open in IMG/M
3300032180|Ga0307471_102102139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria710Open in IMG/M
3300032805|Ga0335078_10086305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4561Open in IMG/M
3300032805|Ga0335078_10831762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1120Open in IMG/M
3300032805|Ga0335078_12175322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala586Open in IMG/M
3300032829|Ga0335070_10979167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala781Open in IMG/M
3300032892|Ga0335081_10080829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4917Open in IMG/M
3300032954|Ga0335083_10399775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1175Open in IMG/M
3300032954|Ga0335083_10884915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala710Open in IMG/M
3300033290|Ga0318519_10680625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala628Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.38%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil12.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.31%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.59%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.72%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.86%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.86%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.86%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.86%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA3_018220802170459023Grass SoilYADLGAGFYTRRESPDARQDYLMRQLRKLNPGCVITITPAEAA
Ga0062388_10202475313300004635Bog Forest SoilPYQDLGADFYTRRESPAQRQAYLLRQLEKLNPGCTVTIRPPEAA*
Ga0070676_1071205923300005328Miscanthus RhizosphereTLLKIAYSVLKTGKPYADLGADFYTRRESPDARQGYLMRQLQKLNPGCVITIIPAEAA*
Ga0066388_10869433413300005332Tropical Forest SoilYADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA*
Ga0066388_10872794513300005332Tropical Forest SoilDLGADFYTRRESPEQRRAYLLRQLEKLSPGCTITITPAEAA*
Ga0070680_10082979013300005336Corn RhizosphereHTLLKIAYQVLKAGAPYADLGAGFYDTRESAQARQDYLVRQLQKLNPGCVITITPPEAA*
Ga0070709_1036405613300005434Corn, Switchgrass And Miscanthus RhizosphereAARRTRGAKKRAITAIAHTLLKIACAVLKAGRPYCEPGAGFCSRRESAQARQDYLLRQLQRLNPGCVITTAPAETA*
Ga0070708_10168325513300005445Corn, Switchgrass And Miscanthus RhizosphereADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA*
Ga0066682_1053661723300005450SoilPYQDLGADFYTRRESPEQRQAYLLRQLQKLNPGCTITISPPEAA*
Ga0070698_10002155213300005471Corn, Switchgrass And Miscanthus RhizospherePYQDLGADFYTRRESPEQRRAYLLRQLEKLSPGCVITITPAEAA*
Ga0066695_1087593723300005553SoilAIAHTLLKIAYAVLKSGKPYQEPGADFYTRRESAQAREEYLLRQLQKLNPGCVITITPAEAA*
Ga0070764_1047912733300005712SoilNKGAQKRAITAIAHTLLKIAYSVLKTGQPYADLGTDFYTRRESPDARQDYLMRQLQKLNPGCVIAITPAEAA*
Ga0070716_10175052313300006173Corn, Switchgrass And Miscanthus RhizosphereNKGAQKRAITAIAHTLLKIAYSVLKTGTPYADLGAGFYTRRESPDARQDYLMRQLRKLNPGCVITITPAEAA*
Ga0070712_10004679913300006175Corn, Switchgrass And Miscanthus RhizosphereTDLGAGFYASRESPQARQDYLIRQLQKLNPGSVITITPAEAA*
Ga0070765_10148308513300006176SoilLGADFYTRRESPAQRQAYLLRQLEKLNPGCTITIGPPEAA*
Ga0066660_1111595123300006800SoilYQEPGADFYTRRESAQAREEYLLRQLQKLNPGCVITITPAEAA*
Ga0066710_10242633223300009012Grasslands SoilFYTRRESAQAREEYLLRQLQKLNPGCVITITPAEAA
Ga0066793_1028304113300009029Prmafrost SoilLLKIAYQLLKSGKPYEDLGADFYTSRESPAQRRAYLLRQLERLSPGCTITITPAEAA*
Ga0116214_135735823300009520Peatlands SoilYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA*
Ga0116222_100493993300009521Peatlands SoilFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA*
Ga0116218_114118813300009522Peatlands SoilKPYEDLGADFYTKRESPDQRRAYLLRQLAKLSRGCAIIITPAEAA*
Ga0116220_1033426723300009525Peatlands SoilLKTGTPCTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA*
Ga0116138_113778313300009552PeatlandVLKTGKPYADLGADFYTCRESPDARQDYLMRQLRKLNPGYVITITPAETA*
Ga0116135_112047923300009665PeatlandAYQVLKSGTLYQDLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA*
Ga0116216_1027780023300009698Peatlands SoilDFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA*
Ga0116101_116821613300009759PeatlandVLKTGKPYADLGADFYTCRESPDARQDYLMRQLRKLNPGYVITITPTEAA*
Ga0126374_1136005123300009792Tropical Forest SoilLKTGKPYAGLGAGFYTRRESPGARQDYLMRQLQKLNPGRVITITPAEAA*
Ga0126373_1267733513300010048Tropical Forest SoilKIAYSVLKTGTPYADLGADFYTRRESPDARQGYLMRQLQKLNPGSVITITPAEAA*
Ga0126373_1285047813300010048Tropical Forest SoilKPYAGLGAGFYTRRESPGARQDYLMRQLQKLNPGRVITITPAEAA*
Ga0134080_1063980823300010333Grasslands SoilFYASRETPQARQNYLIRQLQKLNPGCVITVTPAEAA*
Ga0126370_1188877213300010358Tropical Forest SoilKIAYAILRTSKPYQEPGPDFYTRRESPRARQDYLLRQLQQLNPGCVITITPAEAA*
Ga0126372_1214749123300010360Tropical Forest SoilLKTGVPHHDLGADFYASRESPQARQDYLIRQLHKLNPGCIITITPPEAA*
Ga0126381_10178771623300010376Tropical Forest SoilHTLLKIAYQVLKTGTPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITVIPAEAA*
Ga0136449_10113065523300010379Peatlands SoilGQPYQDLGADFYTRRESPEQRRAHLLRQLEKLSSGCTITITPAEAA*
Ga0136449_10421862513300010379Peatlands SoilGTPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPPEAA*
Ga0136449_10434500513300010379Peatlands SoilDLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA*
Ga0126383_1119744013300010398Tropical Forest SoilGADFYTRRESPVQRRAYLLRQLEKLSPGCTITITPAEAA*
Ga0137382_1001072773300012200Vadose Zone SoilRTLLKIAYSVLKTGKPYADLGADFCTCRESPDARQDYLMRQLRKLNPGCVITITPAEAA*
Ga0137365_1127448023300012201Vadose Zone SoilGADFYTKRESPDQRRAYLLRQLEKLSPGCTITITPAEAA*
Ga0137380_1025189913300012206Vadose Zone SoilARRESPEQRRAYLLRQLEKLSPGCVITITPAEAT*
Ga0137379_1149675813300012209Vadose Zone SoilIAYAVLKTGKPYQEPGADFYTRRESAQARQDYLLRQLQKLNPGSVITITPAEAA*
Ga0137361_1053882213300012362Vadose Zone SoilTGTPYADLGADFYTRRESPDARQDYLMRQLRKLNPGCVITITPAETA*
Ga0137373_1004874413300012532Vadose Zone SoilPYEDPGADFCTRRESPQQRQAYLMRQLQKLNPGCTITITPAEAA*
Ga0137407_1052473423300012930Vadose Zone SoilAYQVLKSGKPYEDLGADFYASRESPEQRRAYLLRQLEKLSPGCTITITLAEAA*
Ga0137410_1082319733300012944Vadose Zone SoilLGEDFYTKRESPQAKQDYLIRQLQKLNPGCTVTITPAEAA*
Ga0132258_1181236813300015371Arabidopsis RhizosphereAYQVLKTGTPCTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA*
Ga0182036_1192357313300016270SoilLLKIAYQVLKTGTPYTDLGADFYTSRESPQARQDYLIRQLQKLNPGSVITIIPAEAA
Ga0182033_1024946713300016319SoilTPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA
Ga0182035_1099969513300016341SoilKTGKPYADLGADFYTRRESPDARQDYLMRKPQKLNPGCVITITPAEAA
Ga0182039_1035187423300016422SoilEDLGADFYTKRESPDQRRAYLLRQLEKLSPGCTITITPAEAA
Ga0182039_1096362523300016422SoilGADFYTRRESAQARQDYLLRQLQKLNPGCVITITPQEAA
Ga0182038_1202030913300016445SoilADFYTRRESPDARQHYLVRQLQKLNPGCVITITPAEAA
Ga0187812_122186613300017821Freshwater SedimentYTDLGADFYASRETPQARQDYLIRQLQKLNPRCVITVTPAETA
Ga0187808_1036758313300017942Freshwater SedimentPYQEPGADFYTRRESPAQRQAFLERQLQKLHPGCTITITPAQAA
Ga0187879_1061631913300017946PeatlandVLKTGKPYEDLGAGFYASRESPQARQDYLIRQLQKLNPGSTITITPQEAA
Ga0187817_1033806123300017955Freshwater SedimentGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA
Ga0187817_1070865113300017955Freshwater SedimentVLKTGRPYTDLGADFYTSRESAQARQDYLIRQLQKLNPGSTITITPQEAA
Ga0187817_1085268713300017955Freshwater SedimentIAYSVLKTGTPYADLGADFYTRRESAQARQDYLLRQPKKLNPGCVITITPTEAA
Ga0187777_1030040313300017974Tropical PeatlandDFYARRESPDARQDYLMRQLQKLNPGCVITITPAGAA
Ga0187875_1071632713300018035PeatlandTLLKIAYSVLKTCQPYADLGADFYTRRESPDARQDYLMRQLRKLNPGCVITITPTEAA
Ga0187855_1051827113300018038PeatlandLGADYYARRESPDQRRAYLLRQLEKLSPGCAITITPAEAA
Ga0187773_1080055313300018064Tropical PeatlandHTLLKIAYQVLKTGTPYTDLGAGFYASRETPQARQDYLIRQLRKLNPGCVITITPAEAA
Ga0066667_1061244713300018433Grasslands SoilLLKIAYQVLKTGTPYTDLGAYFYASRETPQARQDYLIRQLQKLNPGCVITVIPAEAA
Ga0066667_1110208613300018433Grasslands SoilPYHEPGADFCTRRESAQAREDYLLRQLQKLRPGCVITITPAEAA
Ga0206353_1127231123300020082Corn, Switchgrass And Miscanthus RhizosphereFYTRRDSAQARQDYLLRQLQKLNPGCVVTITPAEAA
Ga0210399_1079256213300020581SoilTATPYTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA
Ga0210395_1013883533300020582SoilFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA
Ga0210389_1048383113300021404SoilGAGYYASRESAQAKQDYLIRQLQQLNPGCAITITPREAA
Ga0210402_1094130123300021478SoilVLKTGKPYADLGADFYTRRESPDARQDYLMRQLHKLNPGCVITITPAETA
Ga0207684_1065426613300025910Corn, Switchgrass And Miscanthus RhizosphereRAITAIARTLLKIAYSVLKTGRPYADLGVDFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA
Ga0207852_100677033300026959Tropical Forest SoilLKTGKPYADLGADFYTRRESPDARQDYLMRQLRKLNPGCVITITPAEAA
Ga0207819_102380513300027024Tropical Forest SoilKTGKPYADLGADFYTRRESPDARQDYLMRQLRKLNPGCVITITPAEAA
Ga0208043_102941713300027570Peatlands SoilLGADFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0207862_111574023300027703Tropical Forest SoilGKPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAQAA
Ga0209112_1036446523300027817Forest SoilTPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0209517_1040978523300027854Peatlands SoilKTGTPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0209579_1018134513300027869Surface SoilKTGTPYTDLGADFYASREAPQARQDYLIRQLQKLNPGCVITVIPAETA
Ga0302223_1009182513300028781PalsaYQVLKSGKPYEDLGADFYAKQESPEQRRAYLLRQLEKLGPGCTITVTPAEAA
Ga0302228_1038869013300028808PalsaKTGKPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCAITITPAEAA
Ga0302229_1044009323300028879PalsaADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA
Ga0310037_1016338533300030494Peatlands SoilTDLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA
Ga0310037_1021889823300030494Peatlands SoilADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA
Ga0310038_1027492823300030707Peatlands SoilADFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0302326_1192973713300031525PalsaSVLKTGKPYADLGADFYTCRESPDARQDYLMRQLRKLNPGYVITITPAETA
Ga0318516_1053214213300031543SoilADLGADFYTRRESPDARQAYLMRQLQKLNPGCIVTITSAETA
Ga0307373_1044870923300031672SoilDFCTKRESPEQRRAYLLRQLEKLSPGCTITITPAEAA
Ga0310686_11229564413300031708SoilDFYTRRESAQARQDYLLRQLQKLNPGSVITITPAEAA
Ga0310686_11970174713300031708SoilAYQVLKAGEPYTDLGADFYASRESAQARQDYLVRRLQTLNPGCVITIAPAETA
Ga0318496_1008475443300031713SoilTPYTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA
Ga0306918_1151183413300031744SoilLKTGKPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCAITITPAEAA
Ga0318492_1053073113300031748SoilPYADLGADFYTRRESPDARQAYLMRQLQKLNPGCIVTITSAETA
Ga0318554_1008238443300031765SoilYSVLKTGKPYADLGADFYTRRESPDARQHYLVRQLQKLNPGCVITITPAEAA
Ga0318521_1011868613300031770SoilYSVLKTGKPYADLGADFYTRRESPDARQDYLVRQLQKLNPGCVITITPAEAA
Ga0318497_1035100023300031805SoilPYTDLGADFYASRETPQARQDYLMRQLQKLNPGCVITITPAEAA
Ga0318567_1078102013300031821SoilLKIAYSVLKTGKPYADLGADFYTRRESPDARQHYLMRQLQNLNPGCVITITPAETA
Ga0318511_1055667013300031845SoilKIAYSVLKTGKPYADLGADFYTRRESPDARQAYLMRQLQKLNPGCIVTITSAETA
Ga0306925_1044022023300031890SoilDFYTKRESPDQRRAYLLRQLEKLSPGCTITITPAEAA
Ga0318522_1025542423300031894SoilVLKTGTPYTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA
Ga0318520_1071826513300031897SoilVLKTGTPYADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA
Ga0306923_1119850423300031910SoilDFSTCAPGSVLKTGEPYANLGADFYTRRESPDARQDYLMRKPKKLNPGCVITITPAEAA
Ga0310916_1139603013300031942SoilLGADFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA
Ga0310913_1052973423300031945SoilLLKIAYSVLKTGKPYADLGADFYTRRESPDARQDYLVRQLQKLNPGCVITITPAEAA
Ga0310909_1098613713300031947SoilIAHTLLKIACTVLKTGKPHAGLGAGFCTRRESPDARQGCLIRQLQKLNPGSVITIIPAEA
Ga0318562_1066847513300032008SoilADLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA
Ga0306924_1144681323300032076SoilTDLGADFYASRETPQARQDYLIRQLQKLNPGCVITITPAEAA
Ga0311301_1051166913300032160Peatlands SoilFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA
Ga0311301_1137325333300032160Peatlands SoilIACSVLKTGTPYTDLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPTEAA
Ga0307471_10210213933300032180Hardwood Forest SoilYRDLGPGFYTRRESPEQRQAYLLRQLQKLNPGATITITPPEAA
Ga0335078_1008630513300032805SoilVMPNASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0335078_1083176213300032805SoilLGADFYASRETTQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0335078_1217532223300032805SoilKIAYQVLKSGQPYQDLGADFYTRRESPEQRRAYLLRQLQKLSPGCTITITPAEVA
Ga0335070_1097916723300032829SoilDFYASRETTQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0335081_1008082923300032892SoilMPNASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0335083_1039977523300032954SoilLKTGKPYQDLGDDFYTRRENPGARQDYLMRQLQKLNPGCVITITPTEAT
Ga0335083_1088491513300032954SoilVLKTGTPYTDLGAGFYASRETPQARQDYLIRQLQKLNPGCVITVTPAEAA
Ga0318519_1068062513300033290SoilLGADFYTRRESPDARQDYLMRQLQKLNPGCVITITPAEAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.