| Basic Information | |
|---|---|
| Family ID | F079056 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ALSVLEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.63 % |
| % of genes near scaffold ends (potentially truncated) | 91.38 % |
| % of genes from short scaffolds (< 2000 bps) | 85.34 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.759 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (16.379 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.862 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.276 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00155 | Aminotran_1_2 | 35.34 |
| PF13442 | Cytochrome_CBB3 | 6.03 |
| PF01558 | POR | 3.45 |
| PF00582 | Usp | 2.59 |
| PF07228 | SpoIIE | 1.72 |
| PF01638 | HxlR | 1.72 |
| PF03590 | AsnA | 1.72 |
| PF13618 | Gluconate_2-dh3 | 0.86 |
| PF17147 | PFOR_II | 0.86 |
| PF00672 | HAMP | 0.86 |
| PF03916 | NrfD | 0.86 |
| PF06339 | Ectoine_synth | 0.86 |
| PF01571 | GCV_T | 0.86 |
| PF00005 | ABC_tran | 0.86 |
| PF04264 | YceI | 0.86 |
| PF11154 | DUF2934 | 0.86 |
| PF13247 | Fer4_11 | 0.86 |
| PF13349 | DUF4097 | 0.86 |
| PF16355 | DUF4982 | 0.86 |
| PF04055 | Radical_SAM | 0.86 |
| PF06441 | EHN | 0.86 |
| PF00294 | PfkB | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 3.45 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.72 |
| COG2502 | Asparagine synthetase A | Amino acid transport and metabolism [E] | 1.72 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.86 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.76 % |
| Unclassified | root | N/A | 17.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_103817357 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300004474|Ga0068968_1007663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4164 | Open in IMG/M |
| 3300004477|Ga0068971_1478929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 568 | Open in IMG/M |
| 3300004617|Ga0068955_1317449 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300004970|Ga0072320_1297647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 510 | Open in IMG/M |
| 3300005445|Ga0070708_101413815 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005541|Ga0070733_10407169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 906 | Open in IMG/M |
| 3300005542|Ga0070732_10173525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1286 | Open in IMG/M |
| 3300006028|Ga0070717_10418539 | Not Available | 1205 | Open in IMG/M |
| 3300006086|Ga0075019_10543519 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006102|Ga0075015_100221009 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300006174|Ga0075014_100586364 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006804|Ga0079221_10499649 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300009093|Ga0105240_12604846 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009521|Ga0116222_1557809 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009545|Ga0105237_10285678 | Not Available | 1652 | Open in IMG/M |
| 3300009552|Ga0116138_1215303 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009624|Ga0116105_1018661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1448 | Open in IMG/M |
| 3300009624|Ga0116105_1116308 | Not Available | 683 | Open in IMG/M |
| 3300009641|Ga0116120_1030504 | Not Available | 1916 | Open in IMG/M |
| 3300009641|Ga0116120_1140935 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300009700|Ga0116217_10413968 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300009760|Ga0116131_1025294 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300010339|Ga0074046_10000663 | All Organisms → cellular organisms → Bacteria | 31505 | Open in IMG/M |
| 3300010339|Ga0074046_10153694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1466 | Open in IMG/M |
| 3300010379|Ga0136449_103241899 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010386|Ga0136806_1022739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3041 | Open in IMG/M |
| 3300011026|Ga0138566_126235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300011062|Ga0138582_1020812 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300011071|Ga0138595_1021521 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300011073|Ga0138584_1119519 | Not Available | 536 | Open in IMG/M |
| 3300011074|Ga0138559_1005503 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300011083|Ga0138560_1071281 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300011084|Ga0138562_1057502 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300011090|Ga0138579_1048489 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300011271|Ga0137393_10989218 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012354|Ga0137366_10020675 | All Organisms → cellular organisms → Bacteria | 5133 | Open in IMG/M |
| 3300012957|Ga0164303_10544991 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012957|Ga0164303_10731058 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300014155|Ga0181524_10470036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 538 | Open in IMG/M |
| 3300014159|Ga0181530_10147021 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300014159|Ga0181530_10407237 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300014161|Ga0181529_10367294 | Not Available | 785 | Open in IMG/M |
| 3300014164|Ga0181532_10350272 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300014199|Ga0181535_10361858 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300014493|Ga0182016_10143453 | Not Available | 1617 | Open in IMG/M |
| 3300014501|Ga0182024_12235464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
| 3300014638|Ga0181536_10183613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
| 3300014839|Ga0182027_11435094 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300017822|Ga0187802_10031445 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300017822|Ga0187802_10100783 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300017934|Ga0187803_10357505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 588 | Open in IMG/M |
| 3300017936|Ga0187821_10056248 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300017955|Ga0187817_10138251 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300017961|Ga0187778_10162957 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300017961|Ga0187778_10182009 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300017970|Ga0187783_10577798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 813 | Open in IMG/M |
| 3300017975|Ga0187782_11471539 | Not Available | 536 | Open in IMG/M |
| 3300017995|Ga0187816_10058951 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300017995|Ga0187816_10085185 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300017995|Ga0187816_10227610 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300017998|Ga0187870_1228650 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300018001|Ga0187815_10383618 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300018005|Ga0187878_1018234 | Not Available | 3792 | Open in IMG/M |
| 3300018005|Ga0187878_1200725 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300018009|Ga0187884_10411108 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300018013|Ga0187873_1219360 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300018017|Ga0187872_10140057 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300018018|Ga0187886_1318926 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018025|Ga0187885_10013620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5046 | Open in IMG/M |
| 3300018026|Ga0187857_10019744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3811 | Open in IMG/M |
| 3300018030|Ga0187869_10359476 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300018034|Ga0187863_10453777 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300018038|Ga0187855_10011516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5946 | Open in IMG/M |
| 3300018040|Ga0187862_10715649 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300018085|Ga0187772_11183079 | Not Available | 563 | Open in IMG/M |
| 3300018085|Ga0187772_11369982 | Not Available | 525 | Open in IMG/M |
| 3300018086|Ga0187769_10182024 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300018090|Ga0187770_10129999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1905 | Open in IMG/M |
| 3300019284|Ga0187797_1072070 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300019284|Ga0187797_1406173 | Not Available | 682 | Open in IMG/M |
| 3300019785|Ga0182022_1083834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300019787|Ga0182031_1274457 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300021168|Ga0210406_10000181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 98201 | Open in IMG/M |
| 3300021170|Ga0210400_11247474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300021171|Ga0210405_11272896 | Not Available | 541 | Open in IMG/M |
| 3300021178|Ga0210408_10710360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 791 | Open in IMG/M |
| 3300021433|Ga0210391_10415826 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300025412|Ga0208194_1001245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5313 | Open in IMG/M |
| 3300025507|Ga0208188_1093535 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300025576|Ga0208820_1019649 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300025898|Ga0207692_10979604 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026041|Ga0207639_11013599 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300027698|Ga0209446_1194308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300027812|Ga0209656_10262830 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300027824|Ga0209040_10286514 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300027905|Ga0209415_10526090 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300027905|Ga0209415_10555853 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300027905|Ga0209415_11016049 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300027910|Ga0209583_10131901 | Not Available | 1001 | Open in IMG/M |
| 3300028069|Ga0255358_1026098 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300028873|Ga0302197_10024601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3893 | Open in IMG/M |
| 3300029915|Ga0311358_10334554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1262 | Open in IMG/M |
| 3300030114|Ga0311333_12040423 | Not Available | 501 | Open in IMG/M |
| 3300030494|Ga0310037_10291535 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300030507|Ga0302192_10429710 | Not Available | 538 | Open in IMG/M |
| 3300030879|Ga0265765_1019353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 814 | Open in IMG/M |
| 3300031672|Ga0307373_10677145 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031962|Ga0307479_11982185 | Not Available | 531 | Open in IMG/M |
| 3300032205|Ga0307472_101419786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 674 | Open in IMG/M |
| 3300032805|Ga0335078_11926549 | Not Available | 636 | Open in IMG/M |
| 3300032895|Ga0335074_11466188 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300033004|Ga0335084_10448357 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300033807|Ga0314866_020231 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 16.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.90% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.72% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.72% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.72% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004617 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004970 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010386 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63 | Environmental | Open in IMG/M |
| 3300011026 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 51 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011062 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011083 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1038173572 | 3300004092 | Bog Forest Soil | ALSVLEDKVKKLDLLEIDRKALTAGRLFIDDQAHIGAVSQPDGFA* |
| Ga0068968_10076635 | 3300004474 | Peatlands Soil | ALSVLEDKVKKVDLLEIDRKALTAGRLFVDDQAHVGAVTQPDGFA* |
| Ga0068971_14789292 | 3300004477 | Peatlands Soil | SVLEDKVKKLDLLEVDRKALTAGRLFIDDQAHIGAVSQPDGFA* |
| Ga0068955_13174492 | 3300004617 | Peatlands Soil | ECLAPGTALSVLEDMVKKLDLLEIDRKALTAGRLFIDQQAHLGAVSQPDGFA* |
| Ga0072320_12976472 | 3300004970 | Peatlands Soil | VLEDKVKKLDLLEIDRNALTAGRLFIDDQAHVGAVSQPDGFA* |
| Ga0070708_1014138151 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TECLAPGTALGVLEDKVKNLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0070734_106553142 | 3300005533 | Surface Soil | KKVALLDVNRRALASGRLFVDKEAHVGAVTQPDGFGG* |
| Ga0070733_104071693 | 3300005541 | Surface Soil | APGTALDVLTDKVKKLDLLEIDRAALSAGRSFVDDQAHIGAVSQPDGFA* |
| Ga0070732_101735252 | 3300005542 | Surface Soil | LSVLEDKMKKLDLLEIDRNALTAGRLFIDDMAHVGAVSQPDGFA* |
| Ga0070717_104185391 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KKIKLLEVDRKALLAGRDYMDHQANIGAVSQPDGFA* |
| Ga0075019_105435193 | 3300006086 | Watersheds | APGTALSVLEDKVKKLDLLEIDRKALAAGRLFIDEQAHVGAVSQPDGFA* |
| Ga0075015_1002210093 | 3300006102 | Watersheds | GTALSVLEDKVKKLDLLEIDRKALAAGRLFIDEQAHVGAVSQPDGFA* |
| Ga0075014_1005863641 | 3300006174 | Watersheds | ALSVLEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0079221_104996491 | 3300006804 | Agricultural Soil | KVKKVQLLEIDRKALTAGRDYIDHQVGAVSQPDGFA* |
| Ga0105240_126048461 | 3300009093 | Corn Rhizosphere | TAMQVLEAKVKKVQLLEIDRKALAAGRDYIDHQANVGAVSQPDGFA* |
| Ga0116222_15578092 | 3300009521 | Peatlands Soil | LEDKVKKLDLLEIDRNALTAGRLFIDDQAHVGAVSQPDGFA* |
| Ga0105237_102856781 | 3300009545 | Corn Rhizosphere | CLNPETAMKVLEAKVKKVQLLEIDRKALAAGRDYIDHQVGAVSQPDGFA* |
| Ga0116138_12153032 | 3300009552 | Peatland | LEDKVKKLDLLEIDRKALAAGRRFIEEQAHVGAVSQPDGFA* |
| Ga0116105_10186611 | 3300009624 | Peatland | QDKVKKLDLLEVDRKALTAGRLFIDDQAHIGAVSQPDGFA* |
| Ga0116105_11163081 | 3300009624 | Peatland | TECLAPGTALSVLEDKVKKLDLLEIDRKALAAGRQFIDEQAHIGAVSQSDGFA* |
| Ga0116120_10305043 | 3300009641 | Peatland | EDKVKKLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0116120_11409352 | 3300009641 | Peatland | SVLEDKVKKLDLLEIDRKALSAGRLFIDDQAHVGALSQPDGFA* |
| Ga0116217_104139682 | 3300009700 | Peatlands Soil | ECLAPGTALSVLEDKVKKLDLLEIDRKALAAGRLFIEEQAHIGAVSQSDGFA* |
| Ga0116131_10252943 | 3300009760 | Peatland | LEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0074046_100006631 | 3300010339 | Bog Forest Soil | LEDKVKKLNLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0074046_101536941 | 3300010339 | Bog Forest Soil | KKLDLLEIDRKALAAGRLFINEEAHIGAVSQPDGFA* |
| Ga0136449_1032418992 | 3300010379 | Peatlands Soil | ECLAPGTALSVLEDKVKKLDMLEINRKALAAGRRFIEEQAHVGAVSQPDGFA* |
| Ga0136806_10227395 | 3300010386 | Sediment | AVATAWSVLQEKVKKLDLLELDRKALNAGRLFVDEHAHIGALDQPDGFA* |
| Ga0138566_1262351 | 3300011026 | Peatlands Soil | LSVLEDKVKKVDLLEIDRKALTAGRLFVDDQAHVGAVTQPDGFA* |
| Ga0138582_10208121 | 3300011062 | Peatlands Soil | GTALSVLEDKVKKVDLLEIDRKALTAGRLFVDDQAHVGAVTQPDGFA* |
| Ga0138595_10215211 | 3300011071 | Peatlands Soil | LEDKVKKLDLLEVDRKALTAGRLFIDDQAHIGAVSQPDGFA* |
| Ga0138584_11195191 | 3300011073 | Peatlands Soil | KVDLLEIDRKALTAGRLFVDDQAHVGAVTQPDGFA* |
| Ga0138559_10055031 | 3300011074 | Peatlands Soil | PGTALSVLEDMVKKLDLLEIDRKALTAGRLFIDEQAHLGAVSQPDGFA* |
| Ga0138560_10712811 | 3300011083 | Peatlands Soil | LAPGTALSVLEDKVKKLNLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0138562_10575021 | 3300011084 | Peatlands Soil | KVKKVDLLEIDRKALTAGRLFVDDQAHVGAVTQPDGFA* |
| Ga0138579_10484893 | 3300011090 | Peatlands Soil | LSVLEDKVKKLDLLEVDCKALTAGRLFIDDQAHIGAVSQPDGFA* |
| Ga0137393_109892181 | 3300011271 | Vadose Zone Soil | ECLAPGTALGVLEDKVKNLDLLEIDRKALTAGRVFIDEQAHIGAVSQPDGFA* |
| Ga0137366_100206751 | 3300012354 | Vadose Zone Soil | VKKVDLLEIDRKALTAGRDFVEHQLNIGPVSQPDGFA* |
| Ga0164303_105449912 | 3300012957 | Soil | TAIKVLEIKVKKIKLLEVDRKALLAGRDYMDHQVNIGAVSQPDGFA* |
| Ga0164303_107310582 | 3300012957 | Soil | LEEKIRDQELLAIDRKALLAGRDFIETELNVGPVSQPDGFA* |
| Ga0181524_104700361 | 3300014155 | Bog | CLAPGTALSVLEDKVKKLDLLELDRKALSAGRLFIDEQAHVGAVSQPDGFA* |
| Ga0181530_101470211 | 3300014159 | Bog | TECLAPGTALSVLEDKVKKLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0181530_104072371 | 3300014159 | Bog | TECLAPGTALSVLEDKVKKLDLLEIDRKALAAGRRFIEEQAHVGAVSQPDGFA* |
| Ga0181529_103672941 | 3300014161 | Bog | KVKKLDLLEVDRKALTAGRLFIDDQAHIGAVSQPDGFA* |
| Ga0181532_103502722 | 3300014164 | Bog | GTALSVLEDKVKKLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0181535_103618581 | 3300014199 | Bog | EDKVKKVALLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0182016_101434531 | 3300014493 | Bog | NVLEDKVKKLDLLEIDRKALSAGRLFIDDQAHIGALSQPDGFA* |
| Ga0182024_122354642 | 3300014501 | Permafrost | CLSPRTALSVLEDKVKKLDLLEIDRRALHAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0181536_101836131 | 3300014638 | Bog | KLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0182027_114350942 | 3300014839 | Fen | VLEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA* |
| Ga0187802_100314451 | 3300017822 | Freshwater Sediment | TECLASGTALSVLEDKVKKLDLLEIDRNALTAGRLFIDDQAHVGAVSQPDGFA |
| Ga0187802_101007831 | 3300017822 | Freshwater Sediment | CLAPGTALSVLEDKVKKLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187803_103575051 | 3300017934 | Freshwater Sediment | SVLEDKVKKVSLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187821_100562481 | 3300017936 | Freshwater Sediment | LAPGTALGVLEDKVKKLDLLEIDRKALNAGRLFIDDQAHIGAVSQPDGFAY |
| Ga0187817_101382512 | 3300017955 | Freshwater Sediment | LASGTAMSVLEDKVKRVALLEVDRKALAAGRQFIDHEAHVGAVTQPDGFAE |
| Ga0187778_101629571 | 3300017961 | Tropical Peatland | DKVKRVALLEVDRKAQTAGRQFIDHEAHIGAVTQPDGFGE |
| Ga0187778_101820093 | 3300017961 | Tropical Peatland | NVIEDKVKKIALLEIDRQALTAGRLFIDHEAHIGAMSQPDGFAE |
| Ga0187783_105777982 | 3300017970 | Tropical Peatland | AMDVIEDKVKRVALLEIDRKALAAGRQFIDHEAHIGAVTQPDGFAE |
| Ga0187782_114715391 | 3300017975 | Tropical Peatland | KNPALLEVDLKAIRAGCDAVDHQGNLGAVSQPDGFA |
| Ga0187816_100589511 | 3300017995 | Freshwater Sediment | KVKKLDLLEIDRQALTAGRLFIDDQAHIGAVSQPDGFA |
| Ga0187816_100851852 | 3300017995 | Freshwater Sediment | LSVLEDKVKKLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187816_102276103 | 3300017995 | Freshwater Sediment | ALSVLEDKVKKLNLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187870_12286501 | 3300017998 | Peatland | LEDKVKKLDLLEIDRKALAAGRLFIDDQAHVGAVNQPDGFA |
| Ga0187815_103836181 | 3300018001 | Freshwater Sediment | ETALAVLQTKIKKADLLELDREALMAGRNFIDNQIRVGAVSQPDGFAY |
| Ga0187878_10182341 | 3300018005 | Peatland | KKLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187878_12007251 | 3300018005 | Peatland | TECLAPGTALSVLEDKVKKLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187884_104111081 | 3300018009 | Peatland | SVLEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVNQPDGFA |
| Ga0187873_12193602 | 3300018013 | Peatland | EDKVKKLNLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187872_101400572 | 3300018017 | Peatland | LAPGTALSVLEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187886_13189262 | 3300018018 | Peatland | SVLEDKVKKLDLLEIDRKALAAGRRFIEEQAHVGAVSQPDGFA |
| Ga0187885_100136201 | 3300018025 | Peatland | ETECLAAGTALSVLEDKVKKLDLLELDRKALSAGRLFIDDQAHAGAVSQPDGFA |
| Ga0187857_100197445 | 3300018026 | Peatland | LSVLEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187869_103594762 | 3300018030 | Peatland | ALSVLEDKVKKLDLLEIDRKALSAGRLFIDDQAHVGALSQPDGFA |
| Ga0187863_104537773 | 3300018034 | Peatland | TALSVLEDKVKKLDLLEIDRRALHAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187855_100115161 | 3300018038 | Peatland | ECLAPGTALSVLEDKVKKLDLLEIDRKALAAGRLFIDEQAHIGAVSQPDGFA |
| Ga0187862_107156491 | 3300018040 | Peatland | TECLAPGTALSVLEDKVKKLDLLEIDRKALAAGRRFIEEQAHVGAVSQPDGFA |
| Ga0187772_111830792 | 3300018085 | Tropical Peatland | AMKVIEDKVKRVALLEVNRKSLVAGRQFIDHEAHLAAMSQPDGFAG |
| Ga0187772_113699822 | 3300018085 | Tropical Peatland | GTALSVIEDKVTKLALLDIDRKALAAGRQYIDHEAHIGALSQPDGFAE |
| Ga0187769_101820243 | 3300018086 | Tropical Peatland | VIEDKVKKVALLEVNRNALGAGRQFIDHEAHVGAVSQPDGFAE |
| Ga0187770_101299993 | 3300018090 | Tropical Peatland | ALSVIEDKVKKLALLEIDRKALVAGRQFIDHEAHIGALSQPDGFAE |
| Ga0187797_10720701 | 3300019284 | Peatland | SSAMEVLETKVKKVSMLEVNRKALAAGRQYIDHEAHIGAVSQPDGCGE |
| Ga0187797_14061731 | 3300019284 | Peatland | SAMEVLETKVKKVSMLEVNRKALAAGRQYIDHEAHIGAVSQPDGCGE |
| Ga0182022_10838341 | 3300019785 | Fen | ALSVLLEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Ga0182031_12744575 | 3300019787 | Bog | EDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVNQPDGFA |
| Ga0210406_100001813 | 3300021168 | Soil | MMGALLGETECMAPKTALIVLEDKVKKLDLLEIDRNALTARRLFMDDQAHVGAVSQPDGF |
| Ga0210400_112474741 | 3300021170 | Soil | MMGALLGETECMAPKTALIVLEDKVKKLDLLEIDRNALTAGRLFMDDQAHVGAVSQPDGF |
| Ga0210405_112728961 | 3300021171 | Soil | LLGETECMAPKTALIVLEDKVKKLDLLEIDRNALTARRLFMDDQAHVGAVSQPDGFA |
| Ga0210408_107103602 | 3300021178 | Soil | VLEDKVKKLDLLDIDRQALTAGRLFIDDQAHIGAVSQPDGFA |
| Ga0210391_104158263 | 3300021433 | Soil | ASGTALSVLQDKVRKLDLLEIDRQALTVGRLFIDDQTHVGAVSQPDGCA |
| Ga0208194_10012451 | 3300025412 | Peatland | LEDKVKKLDLLELDRKALSAGRLFIDDQAHAGAVSQPDGFA |
| Ga0208188_10935352 | 3300025507 | Peatland | EDTECLAPGTALSVLEDKVKKVDMLEIDRKALAAGRRFIEEQAHVGAVSQPDGFA |
| Ga0208820_10196491 | 3300025576 | Peatland | TALSVLEDKVKKLNLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Ga0207692_109796042 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KVKKIKLLEVDRKALLAGRDYMDHQVNIGAVSQPDGFA |
| Ga0207639_110135992 | 3300026041 | Corn Rhizosphere | TECLNSETAMQVLEAKVKKVQLLEIDRKALTAGRDYIDHQVGAVSQPDGFA |
| Ga0209113_10416642 | 3300027517 | Forest Soil | MGVIEDKVKKVELLETNRRALAAGRHFIDEHAHEEALSQPD |
| Ga0209446_11943082 | 3300027698 | Bog Forest Soil | TALRVLEDKVKKLDLLEIDRRALTAGRLFIDDQAHVGAVSQPDGFA |
| Ga0209656_102628301 | 3300027812 | Bog Forest Soil | DKVKKLDLLEIDRKALSAGRLFIDDQAHVGAVSQSDGFA |
| Ga0209040_102865142 | 3300027824 | Bog Forest Soil | SVLEDKVKKLDLLEIDRKALAAGRLFIDDQAHVGAVSQPDGFA |
| Ga0209415_105260902 | 3300027905 | Peatlands Soil | ECLAPGTALSVLEDKVKKLDLLEIDRKALTAGRLFIDEQAHIGAVSQPDGFA |
| Ga0209415_105558533 | 3300027905 | Peatlands Soil | DKVKKLDLLEIDRNALTAGRLFIDDQAHVGAVSQPDGFA |
| Ga0209415_110160491 | 3300027905 | Peatlands Soil | VKKLDLLEIDRKALSAGRLFIDDQAHIGAVSQPDGFA |
| Ga0209583_101319012 | 3300027910 | Watersheds | MSVIEDKVKKVALLEIDRKALAAGRVFIDHEAHIGAVTQPDGFAG |
| Ga0255358_10260982 | 3300028069 | Soil | PGTALSVLEDKVKKVSLLEIDRKALNAGRLFIDEQAHIGAVSQPDGFA |
| Ga0302197_100246011 | 3300028873 | Bog | KKLDLLDIDRKALHAGRLFIDGQAHIGAVSQPDGFA |
| Ga0311358_103345543 | 3300029915 | Bog | KLDLLEIDRRALHAGRLFIDEQAHIGAVSQPDGFA |
| Ga0311333_120404232 | 3300030114 | Fen | TECLSPVTAMSVLEDKVKKLNLLEIDRKAFAEGRQFVDHLAHVGAVTQSDGFAG |
| Ga0310037_102915352 | 3300030494 | Peatlands Soil | SVLEDKVKKLDLLEIDRNALTAGRLFIDDQAHVGAVSQPDGFA |
| Ga0302192_104297101 | 3300030507 | Bog | LNVLEDKVKKLDLLEIDRKALHAGRLFIDEQAHIGAVSQPDGFA |
| Ga0265765_10193531 | 3300030879 | Soil | ETECLAPGTAFRVLEDKVKKLDLLEIDRQALTAGRLFIDDQAHVGAVSQPDGFA |
| Ga0307373_106771451 | 3300031672 | Soil | CLAAGTAWSVLQDKVKKLDLLELDRKALNAGRLFVDEHAHIGALDQPDGFA |
| Ga0307479_119821852 | 3300031962 | Hardwood Forest Soil | LASRTALSVLEDKVKKLDLLEIDRNALTAGRLFIDDMAHVGAVSQPDGFA |
| Ga0307472_1014197861 | 3300032205 | Hardwood Forest Soil | SPGTAIGVLEDKVKKLDLLEIDRKALTAGRLFIDDQAHIGAVSQPDGFA |
| Ga0335078_119265491 | 3300032805 | Soil | AMSVIEDKVKKVALLEVNRNALVAGRQFIDHEAHIGAVSQPDGFAE |
| Ga0335074_114661882 | 3300032895 | Soil | QWLAPDTAQTVLEDKVKKLELLELDRKALNAGRDFNEHHVNVGAISQPDGFA |
| Ga0335084_104483573 | 3300033004 | Soil | TAERVLEVKVKKANLLEIDRRALVEGKKFVEHEMHIGAVTQPDGFA |
| Ga0314866_020231_3_116 | 3300033807 | Peatland | KKVALLEVNRNALVAGRQFIDHEAHIGAVSQPDGFAE |
| ⦗Top⦘ |