| Basic Information | |
|---|---|
| Family ID | F079050 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MATTTTLPQTDWRQEWFEIEDATYLNLAGQSPMPKVSIRAVQ |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 84.48 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.414 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.310 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.172 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.14% β-sheet: 0.00% Coil/Unstructured: 92.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 43.97 |
| PF01402 | RHH_1 | 5.17 |
| PF14378 | PAP2_3 | 4.31 |
| PF13242 | Hydrolase_like | 3.45 |
| PF07238 | PilZ | 2.59 |
| PF04101 | Glyco_tran_28_C | 1.72 |
| PF13620 | CarboxypepD_reg | 1.72 |
| PF06925 | MGDG_synth | 1.72 |
| PF11010 | DUF2848 | 0.86 |
| PF02558 | ApbA | 0.86 |
| PF12710 | HAD | 0.86 |
| PF00082 | Peptidase_S8 | 0.86 |
| PF09286 | Pro-kuma_activ | 0.86 |
| PF12146 | Hydrolase_4 | 0.86 |
| PF00266 | Aminotran_5 | 0.86 |
| PF01226 | Form_Nir_trans | 0.86 |
| PF03449 | GreA_GreB_N | 0.86 |
| PF03551 | PadR | 0.86 |
| PF03795 | YCII | 0.86 |
| PF00072 | Response_reg | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.86 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.86 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.86 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.86 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 0.86 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.41 % |
| Unclassified | root | N/A | 2.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100398840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1255 | Open in IMG/M |
| 3300002561|JGI25384J37096_10243254 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004091|Ga0062387_101404343 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300004092|Ga0062389_101002376 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300004092|Ga0062389_101750796 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300004092|Ga0062389_102050661 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005176|Ga0066679_11009781 | Not Available | 518 | Open in IMG/M |
| 3300005437|Ga0070710_10155404 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300005518|Ga0070699_101665134 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005542|Ga0070732_10022001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3594 | Open in IMG/M |
| 3300005542|Ga0070732_10920622 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005591|Ga0070761_10049639 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
| 3300005602|Ga0070762_10512602 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005712|Ga0070764_10364510 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300006102|Ga0075015_100826666 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006102|Ga0075015_100954299 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006174|Ga0075014_100721338 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006176|Ga0070765_102071117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300006755|Ga0079222_11535442 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006794|Ga0066658_10346113 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300006797|Ga0066659_10854333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 757 | Open in IMG/M |
| 3300006806|Ga0079220_10176185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300007255|Ga0099791_10093036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1382 | Open in IMG/M |
| 3300009012|Ga0066710_100005102 | All Organisms → cellular organisms → Bacteria | 11860 | Open in IMG/M |
| 3300009012|Ga0066710_101978857 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300009038|Ga0099829_10923004 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300009089|Ga0099828_10086230 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300009089|Ga0099828_10125218 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
| 3300009520|Ga0116214_1415272 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010047|Ga0126382_11030567 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010159|Ga0099796_10543260 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010301|Ga0134070_10462478 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010321|Ga0134067_10402058 | Not Available | 549 | Open in IMG/M |
| 3300010335|Ga0134063_10027337 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300010361|Ga0126378_10640517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300010376|Ga0126381_100355991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2025 | Open in IMG/M |
| 3300011271|Ga0137393_10722646 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300011271|Ga0137393_11129034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300012189|Ga0137388_10266173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1564 | Open in IMG/M |
| 3300012189|Ga0137388_10430846 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300012203|Ga0137399_11737196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012203|Ga0137399_11752801 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012207|Ga0137381_11280973 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012209|Ga0137379_11311311 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012211|Ga0137377_11349718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300012285|Ga0137370_10095405 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300012357|Ga0137384_11126202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300012363|Ga0137390_10935655 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300012918|Ga0137396_10549309 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300012918|Ga0137396_10593565 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300012918|Ga0137396_11186808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300012924|Ga0137413_10998123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300012925|Ga0137419_10964242 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300012925|Ga0137419_11028689 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012927|Ga0137416_10014267 | All Organisms → cellular organisms → Bacteria | 4883 | Open in IMG/M |
| 3300012957|Ga0164303_10356291 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012975|Ga0134110_10330357 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300017961|Ga0187778_10777538 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300019789|Ga0137408_1212852 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300019789|Ga0137408_1451196 | All Organisms → cellular organisms → Bacteria | 5828 | Open in IMG/M |
| 3300020580|Ga0210403_11008987 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300020581|Ga0210399_10098067 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300021086|Ga0179596_10086773 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300021168|Ga0210406_10147643 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300021170|Ga0210400_10195663 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300021170|Ga0210400_11076634 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300021171|Ga0210405_10058420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3045 | Open in IMG/M |
| 3300021171|Ga0210405_11101692 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300021181|Ga0210388_11546219 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300021475|Ga0210392_10288380 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300021479|Ga0210410_10094094 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300022840|Ga0224549_1052131 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300024290|Ga0247667_1039134 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300025898|Ga0207692_10120519 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300025915|Ga0207693_10411381 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300026214|Ga0209838_1052936 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300026291|Ga0209890_10079095 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300026305|Ga0209688_1105737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300026527|Ga0209059_1063634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1600 | Open in IMG/M |
| 3300026527|Ga0209059_1108180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300026547|Ga0209156_10302139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300027073|Ga0208366_1004452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
| 3300027173|Ga0208097_1018228 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300027591|Ga0209733_1032143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1410 | Open in IMG/M |
| 3300027603|Ga0209331_1035350 | Not Available | 1280 | Open in IMG/M |
| 3300027671|Ga0209588_1202033 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300027745|Ga0209908_10121808 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300027767|Ga0209655_10083104 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300027846|Ga0209180_10035746 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
| 3300027846|Ga0209180_10146451 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300027846|Ga0209180_10152398 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300027853|Ga0209274_10034029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2373 | Open in IMG/M |
| 3300027855|Ga0209693_10185291 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300027855|Ga0209693_10187793 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300027875|Ga0209283_10043529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2837 | Open in IMG/M |
| 3300027879|Ga0209169_10291588 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300027884|Ga0209275_10238362 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300028536|Ga0137415_10660414 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300028536|Ga0137415_10692627 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300028806|Ga0302221_10318387 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300028906|Ga0308309_10032032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3616 | Open in IMG/M |
| 3300028906|Ga0308309_10150968 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300030043|Ga0302306_10375756 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300030991|Ga0073994_10079962 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300030991|Ga0073994_11912236 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031234|Ga0302325_13114074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300031708|Ga0310686_111651273 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031753|Ga0307477_10041169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3172 | Open in IMG/M |
| 3300031754|Ga0307475_10078431 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300031754|Ga0307475_10412581 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300031820|Ga0307473_11377545 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031962|Ga0307479_11351121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300032174|Ga0307470_10876590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300032180|Ga0307471_100577739 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300032180|Ga0307471_101644005 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300032955|Ga0335076_11239669 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1003988403 | 3300002245 | Forest Soil | MATATSSPTHTNWRDEWFEFEDATYLNVAGNAPMPKASLK |
| JGI25384J37096_102432541 | 3300002561 | Grasslands Soil | VSTTAISPQTDWRQEWFEMEDATYLNLASQSPMPKVSIRAVQA |
| Ga0062387_1014043431 | 3300004091 | Bog Forest Soil | MATATTLPRSDWRQEWFENEEATYLNVAGQSPMPKVAVRAVQAAI |
| Ga0062389_1010023761 | 3300004092 | Bog Forest Soil | MATIAAALRTDWRKEWFEIEDATYLNTAMQSAMPKVAVRAVQE |
| Ga0062389_1017507962 | 3300004092 | Bog Forest Soil | MATIAAPLRTDWRKEWFEIEDATYLNTAMQCAMPKVAVRAV |
| Ga0062389_1020506611 | 3300004092 | Bog Forest Soil | MASTVAPLRTDWRKEWFEIEDASYLNCAGQAPMPKTSLRAAQN |
| Ga0066679_110097811 | 3300005176 | Soil | MATTTTSLETGWRQEWFEIEDATYLNLAGQSPMPKVSIRAVQAALEA |
| Ga0070710_101554043 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAATLPRTDWRQEWFDNEEAVYLNLAGQSPMPKVSFRAVQASLE |
| Ga0070699_1016651342 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MATATPSRKDWRQEWFEFEEAIYLNVAGQSPMPKVSLRAAQGA |
| Ga0070732_100220012 | 3300005542 | Surface Soil | MATATSSLKSDYRQEWFEIEDATYLNLAAQSPMPK |
| Ga0070732_109206222 | 3300005542 | Surface Soil | MATASTPMHTDWRQEWFEFEDATYLNLAGESPMPKVSLRALQAAQEWK |
| Ga0070761_100496391 | 3300005591 | Soil | MATAGTSIPTDWRQEWFEFEDATYLNLAGQSPMPKVSLRALQ |
| Ga0070762_105126022 | 3300005602 | Soil | MATTATTLPRSDWRQEWFENEEATYLNVAGQSPLPKVAVRAVQAAIEW |
| Ga0070764_103645102 | 3300005712 | Soil | MATPGISAHTDWRQEWFEFEDATYLNLAGQSPMPKVSLRA |
| Ga0075015_1008266662 | 3300006102 | Watersheds | MATATASLQTDWRQEWFEIEDATYLNLASQSPMPKVT |
| Ga0075015_1009542992 | 3300006102 | Watersheds | MATATTSPVTDYRQEWFEIEDATYLNLAAQSPMPK |
| Ga0075014_1007213382 | 3300006174 | Watersheds | MATSSIPVHTDWRQEWFEFEDATYLNLAGQAPMPKVS |
| Ga0070765_1020711171 | 3300006176 | Soil | MATATTSPTTDWRQEWFENEEATYLNLAGQSPMPKVSFR |
| Ga0079222_115354422 | 3300006755 | Agricultural Soil | VATTIASTQTDWRQEWFEIEDATYLNLASESPMPK |
| Ga0066658_103461132 | 3300006794 | Soil | MATTVTSSQTDWRQEWFEIEDATYLNLAGQSPMPKDAIRAVQAALE |
| Ga0066659_108543333 | 3300006797 | Soil | MATTTTSLQTGWRQEWFEIEDATYLNLAGQSPMPKVSIRAVQAALE |
| Ga0079220_101761851 | 3300006806 | Agricultural Soil | MATTTTSPQIDWRQEWFEFEEATYLNLAGQSPLPRV |
| Ga0099791_100930361 | 3300007255 | Vadose Zone Soil | MATATSSPITDYRQEWFEIEDATYLNLAGQSPMPKVAHRAVQAALE |
| Ga0066710_10000510214 | 3300009012 | Grasslands Soil | MATTTTSLQTGWRQEWFEIEDATYLNLAGQSPMPK |
| Ga0066710_1019788572 | 3300009012 | Grasslands Soil | VATTVASTQTDWRQEWFEIEDATYLNLASESPMPKVSIRAV |
| Ga0099829_109230042 | 3300009038 | Vadose Zone Soil | MATTTTSVQTDWRQEWFEIEDATYLNLAGQSPMPKISIRAVQ |
| Ga0099828_100862305 | 3300009089 | Vadose Zone Soil | MATATTSAPVDWRQEWFEFEDATYLNVSGQSPMPRVSIRAVQA |
| Ga0099828_101252184 | 3300009089 | Vadose Zone Soil | MATTTTSVQTDWRQEWFEIEDATYLNLAGQSPMPKIS |
| Ga0116214_14152721 | 3300009520 | Peatlands Soil | MATPGISASTDWRQEWFEFEDATYLNLAGQSPMPKVSLRALQAAQE |
| Ga0126382_110305671 | 3300010047 | Tropical Forest Soil | MASTTTSPQIDWRQEWFEFEDATYLNLAGQSPMPRV |
| Ga0099796_105432602 | 3300010159 | Vadose Zone Soil | MATATSSPVTDYRHEWFDIEDATYLNLAAQSPMPKVAHRAVQA |
| Ga0134070_104624783 | 3300010301 | Grasslands Soil | MVTAISLKPTDWRQEWFEFEDAAYLNAAGQAPMPKVSLRAVQAA |
| Ga0134067_104020582 | 3300010321 | Grasslands Soil | MATTTTSLQVGWRQEWFEIEDATYLNLAGQSPMPKVSIRAVQA |
| Ga0134063_100273374 | 3300010335 | Grasslands Soil | MATTTTSLQTGWRQEWFEIEDATYLNLAGQSPMPKVSIRAVQA |
| Ga0126378_106405171 | 3300010361 | Tropical Forest Soil | MASTTISPQIDWRQEWFELEDATYLNLAGQSPLPRVSI |
| Ga0126381_1003559911 | 3300010376 | Tropical Forest Soil | MVTTTTSLETDWRQEWFEFEDATYLNLAGQSPLPRASI |
| Ga0137393_107226461 | 3300011271 | Vadose Zone Soil | MATTTTSVQTDWRQEWFEIEDATYLNLAGQSPMPKISIRAVQAA |
| Ga0137393_111290341 | 3300011271 | Vadose Zone Soil | MQENTMATATTPLHTDCRQEWFEIEDATYLNLAAQSPMPKVAHRAVQAAIEW |
| Ga0137388_102661731 | 3300012189 | Vadose Zone Soil | MATATTSPITDYRQEWFEIEDATYLNLAAQSPMPKVAHRAVQA |
| Ga0137388_104308461 | 3300012189 | Vadose Zone Soil | MASTTISPQTDWRQEWFEFEDATYLNLAGQSPLPRVSIRA |
| Ga0137399_117371961 | 3300012203 | Vadose Zone Soil | MATTTTSLQTDWRQEWFEIEDATYLNLASQSPMPKVSIRAV |
| Ga0137399_117528011 | 3300012203 | Vadose Zone Soil | MATATSSPVTDYRHEWFDIEDATYLNLAAQSPMPKVAHRAVQTALE |
| Ga0137381_112809732 | 3300012207 | Vadose Zone Soil | MPTTTASLQTDWRQEWFEIEDATYLNLASQSPMPKV |
| Ga0137379_113113111 | 3300012209 | Vadose Zone Soil | MPTTTASLQTDWRQEWFEIEDATYLNLASQSPMPKVSIRAVQ |
| Ga0137377_113497181 | 3300012211 | Vadose Zone Soil | MATTTTSLETGWRQEWFEIEDATYLNLAGQSPMPKVSIRAVQAA |
| Ga0137370_100954051 | 3300012285 | Vadose Zone Soil | MATTTTSLHTGWRQEWFEIEDATYLNLAGQSPMPKVSIRAVQAA |
| Ga0137384_111262021 | 3300012357 | Vadose Zone Soil | MASTTSSLQTDWRQEWFEFEDATYLNLAGQSPLPRVSV |
| Ga0137390_109356551 | 3300012363 | Vadose Zone Soil | MAAATPSPITDYRQEWFEIEDATYLNLAGQSPMPKVAHRA |
| Ga0137396_105493092 | 3300012918 | Vadose Zone Soil | VATTVTSPHTDWRQEWFEIEDATYLNLASQSPMPKVSIRAV |
| Ga0137396_105935652 | 3300012918 | Vadose Zone Soil | VATTVASTQTEWRQEWFEIEDATYLNLASQSPMPRVSI |
| Ga0137396_111868081 | 3300012918 | Vadose Zone Soil | MATTTTSLQTDWRQEWFEIEDATYLNLASQSPMPKVSIR |
| Ga0137413_109981232 | 3300012924 | Vadose Zone Soil | MATATSFPVTDYRHEWFEIEDATYLNLAGQSPMPKVAHRAVHAALEWKK |
| Ga0137419_109642422 | 3300012925 | Vadose Zone Soil | MRMATTTTVLHTDWRQEWFEIEDATYLNLAGQSPMPKVSIRAVHAAL |
| Ga0137419_110286892 | 3300012925 | Vadose Zone Soil | MASTTTVPQTDWRQEWFEIEDATYLNLASQSPMPKVSIRAVQA |
| Ga0137416_100142671 | 3300012927 | Vadose Zone Soil | VSTTAISPQTDWRQQWFEIEDATYLNLASQSPMPKVSVRAVQAAL |
| Ga0164303_103562912 | 3300012957 | Soil | MAIAPRVVHTDWRSEWFEIENATYLNLAGQSPMPKVAHRAVQASL |
| Ga0134110_103303571 | 3300012975 | Grasslands Soil | VATTVASTQTDWRQEWFEIEDATYLNLASESPMPKVSIRA |
| Ga0187778_107775381 | 3300017961 | Tropical Peatland | MATTTAPIHTDWRQEWFEFEDATYLNLAGESPMPKVSLRA |
| Ga0137408_12128522 | 3300019789 | Vadose Zone Soil | MATTTTAPQTDWRQEWFEIEDATYLNLAGQSPMPKVSIRAV |
| Ga0137408_14511964 | 3300019789 | Vadose Zone Soil | MATTTSVPRTDWRQEWFEIEDATYLNLAGQSPMPKVHSRRASGA |
| Ga0210403_110089871 | 3300020580 | Soil | MATATTSAIADYRQEWFEIEDATYLNLAAQSPMPKV |
| Ga0210399_100980674 | 3300020581 | Soil | MATTSIPVHTDWRQEWFEFEDATYLNLAGQSPMPKVSLRAIQSAIA |
| Ga0179596_100867731 | 3300021086 | Vadose Zone Soil | VSTTAISPQTDWRQEWFEIEDATYLNLAGESPMPKVSIR |
| Ga0210406_101476431 | 3300021168 | Soil | MATTSISPRTDWREEWFEFEDATYLNLAGESPMPKVSLRA |
| Ga0210400_101956633 | 3300021170 | Soil | VATATTSPITDWRQEWFEIEDAIYLNLAGQSPMPKVAHR |
| Ga0210400_110766342 | 3300021170 | Soil | MATTSISPRTDWREEWFEFEDATYLNLAGESPMPKVSLRAIQA |
| Ga0210405_100584205 | 3300021171 | Soil | MATATTLPRSDWRQEWFENEEATYLNVAGQSPMPKVAVRAVQ |
| Ga0210405_111016921 | 3300021171 | Soil | MATTGISPRTDWREEWFEFEDATYLNLAGESPMPKVSLRAIQAT |
| Ga0210388_115462192 | 3300021181 | Soil | MVTSSVAVPTDRRQEWFEFEDATYLNLAGQSPMPKVSLRALQTAQEWKKFPHH |
| Ga0210392_102883803 | 3300021475 | Soil | MEGESLMASVATLPRTDWRKEWFEIEDAVYLNTAMQSAMPKM |
| Ga0210410_100940945 | 3300021479 | Soil | MATTTTLPQTDWRQEWFEIEDATYLNLAGQSPMPKVSIRAVQ |
| Ga0224549_10521312 | 3300022840 | Soil | MATIAAPLRTDWRKEWFEIEDATYLNVAGQAPMPKAS |
| Ga0247667_10391341 | 3300024290 | Soil | MATPGTSLHTDWRQEWFEFEDATYLNLAGESPMPKVSLRALQ |
| Ga0207692_101205191 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAATLPRTDWRQEWFDNEEAVYLNLAGQSPMPKVSFRAVQASLEW |
| Ga0207693_104113811 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAATLPRTDWRQEWFDNEEAVYLNLAGQSPMPKVSFRAVQASLEWKKFPQ |
| Ga0209838_10529361 | 3300026214 | Soil | MATAAALPRTDWRQDWFENEDATYLNLAAQSPMPKVS |
| Ga0209890_100790951 | 3300026291 | Soil | MATAATTLPRTDWRQEWFDNEEATYLNLAGQSPMPKVAVRAIQAAVEWKKFPQRIP |
| Ga0209688_11057372 | 3300026305 | Soil | MATTTTSLQAGWRQEWFEIEDATYLNLAGQSPMPKVSIRA |
| Ga0209059_10636341 | 3300026527 | Soil | MASTTISPQIDWRQEWFEFEDATYLNLAGQSPLPR |
| Ga0209059_11081802 | 3300026527 | Soil | MAATTISPQIDWRQEWFEFEDATYLNLAGQSPLPR |
| Ga0209156_103021391 | 3300026547 | Soil | MATTTTSLQTGWRQEWFEIEDATYLNLAGQSPMPKVS |
| Ga0208366_10044522 | 3300027073 | Forest Soil | MVTATTSPLTDYRQEWFEIDDATYLNAASQAPMPKVSHRA |
| Ga0208097_10182282 | 3300027173 | Forest Soil | MATLASNPQTDWRQEWFEFEDATYLNVSGQSPMPRISIRAVQAALEA |
| Ga0209733_10321432 | 3300027591 | Forest Soil | MATATTSPITDYRQEWFEIEDATYLNLAAQSPMPKVAHRAVQTA |
| Ga0209331_10353501 | 3300027603 | Forest Soil | MATATTSPATDYRQEWFEIEDATYLNAAGQAPMPKVSHRAVQAALEWK |
| Ga0209588_12020331 | 3300027671 | Vadose Zone Soil | MATATTSPATDYRQEWFEIEDATYLNAAGQAPMPKVSH |
| Ga0209908_101218081 | 3300027745 | Thawing Permafrost | MATATTLPRSDWRQEWFDNEDATYLNLAGQSPMPKVAIRAVQAAIEWKKF |
| Ga0209655_100831042 | 3300027767 | Bog Forest Soil | MATIAAPLRTDWRKEWFEFEDATYLNVAGQSAMPKVALRAA |
| Ga0209180_100357461 | 3300027846 | Vadose Zone Soil | MATTTTSPQADWRQEWFEIEDATYLNLASQSPMPKVS |
| Ga0209180_101464511 | 3300027846 | Vadose Zone Soil | MASTTTSPQTDWRQEWFEIEDATYLNLASQSPMPK |
| Ga0209180_101523983 | 3300027846 | Vadose Zone Soil | MATSTVPLQADWRQEWFEIEDATYLNVASQSPMPKVSIRA |
| Ga0209274_100340294 | 3300027853 | Soil | MATAGTSIPTDWRQEWFEFEDATYLNLAGQSPMPKVSLRALQAAQE |
| Ga0209693_101852912 | 3300027855 | Soil | VATTSTAPRTDWRQEWFEFEDATYLNLAGQSPMPKVSLRALQAAQEWK |
| Ga0209693_101877932 | 3300027855 | Soil | MATTSAAPRTDWRQEWFEFEDATYLNLAGQSPMPIASLRALQAAQEWKK |
| Ga0209283_100435291 | 3300027875 | Vadose Zone Soil | MATVTSLLHTDWRQEWFEIEDATYLNLAAQSPMPKVAHRAVQ |
| Ga0209169_102915882 | 3300027879 | Soil | MATPGISAHTDWRQEWFEFEDATYLNLAGQSPMPKVSLRALQA |
| Ga0209275_102383621 | 3300027884 | Soil | MATASISPRTDWREEWFEFEDATYLNLAGESPMPKASLRAIQTAIG |
| Ga0137415_106604142 | 3300028536 | Vadose Zone Soil | VSTTAISPQTDWRQEWFEIEDATYLNLASQSPMPKVSVRA |
| Ga0137415_106926272 | 3300028536 | Vadose Zone Soil | VSTTAISPQTDWRQQWFEIEDATYLNLASQSPMPKVSVRA |
| Ga0302221_103183872 | 3300028806 | Palsa | MATATVSRTDWRQEWFEFEDATYLNTAAQSAMPKASLKAAQNAIE |
| Ga0308309_100320326 | 3300028906 | Soil | MATTSISPRTDWREEWFEFEDATYLNLAGESPMPKEYLRAI |
| Ga0308309_101509683 | 3300028906 | Soil | MATPGIPAGIDWREEWFEFEDATYLNLAGQSPMPKVSLRA |
| Ga0302306_103757562 | 3300030043 | Palsa | MATATVSRTDWRQEWFEFEDATYLNTAAQSAMPKASLKAAQNA |
| Ga0073994_100799622 | 3300030991 | Soil | MATATTTPITDYRQEWFEIEDATYLNLAGQSPMPKVAHRAVQTAIEWKKFP |
| Ga0073994_119122361 | 3300030991 | Soil | MATATSSPAHTNWRDEWFEFEDATYLNVAGNAPMPK |
| Ga0302325_131140741 | 3300031234 | Palsa | MATTVAPVRTDWRKEWFEIEDAVYLNTAMQSALPKVAVRAV |
| Ga0310686_1116512732 | 3300031708 | Soil | MATAATPLRIDWRQEWFEIEDATYLNLAGQSPMPKVSH |
| Ga0307477_100411691 | 3300031753 | Hardwood Forest Soil | MAAATHSPLTDYRQEWFEIEDATYLNAASQAPMPRASHRA |
| Ga0307475_100784311 | 3300031754 | Hardwood Forest Soil | VSTTAISPQTDWRQEWFEIEDATYLNLAGESPMPKISIRAVQ |
| Ga0307475_104125811 | 3300031754 | Hardwood Forest Soil | MATATTTLPRSDWLQEWFEIEDATYLNLAGQSPMPK |
| Ga0307473_113775452 | 3300031820 | Hardwood Forest Soil | MATATTTLPGTDWRQEWHEFEDATYLNLASQAPMPKVSLKAVQAA |
| Ga0307479_113511212 | 3300031962 | Hardwood Forest Soil | MAAATISPITDYRQEWFEIEDATYLNAASQAPMPRAS |
| Ga0307470_108765902 | 3300032174 | Hardwood Forest Soil | MATATTSPITDYRHEWFEIEDATYMNIAAQSPMPKVAHRAVQTAIEWKKF |
| Ga0307471_1005777392 | 3300032180 | Hardwood Forest Soil | MATATTTLPGTDWRQEWHEFEDATYLNLASQAPMPKVS |
| Ga0307471_1016440051 | 3300032180 | Hardwood Forest Soil | MATTTTAPRIDWRQEWFEIEDATYLNLAGQSPMPKVSIRAV |
| Ga0335076_112396691 | 3300032955 | Soil | MATPGVSAPTTDWRQEWFEFEDATYLNLAGQSPMPKVSL |
| ⦗Top⦘ |